F382499

General Info

Members Datasets Scaffolds Average Seq Length
278 186 556 244

Family's Representative Sequence

Representative Sequence 3300035090|Ga0373949_0000070|Ga0373949_0000070_27491_28432
Length 270
Sequence MTATPPAFRTPAPGAPVPAAGRPLLTLEHVSKRFGGLRAVNNVSLTITEGEVLFIVGPNGAGKTTLFNLITGFLPPDEGVIRFAGRLLAGAPPHQAARLGISRTFQIVKPLFNLITGSLSVLENVMLGAFLHTRDVAGAAARAREVLEFLEMGAVSGLPAAGLPLATLKRLEIARALATRPKLILLDEVVAGLPTAEALALAGLLQRLPEWGVSAVAGVEHVMQVVMKVAHRVVVLDRGALIAEGTPADVVRRPEVIEAYLGAKYKQVTG

Samples

Sample ID Description Type Environment
1 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
175 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
179 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0
Rhizoplane 5.4
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373949_0000070 3300035090 Bacteria 37716
2 Ga0070683_100471196 3300005329 Bacteria 1199
3 Ga0070683_100836860 3300005329 Bacteria 882
4 Ga0070690_100047891 3300005330 Bacteria 2720
5 Ga0068869_100353717 3300005334 Bacteria 1198
6 Ga0070680_100083309 3300005336 Bacteria 2641
7 Ga0070689_100011601 3300005340 Bacteria 6317
8 Ga0070689_100019605 3300005340 Bacteria 5004
9 Ga0070692_10078455 3300005345 Bacteria 1773
10 Ga0070688_100452629 3300005365 Bacteria 960
11 Ga0070703_10000034 3300005406 Bacteria 66916
12 Ga0070709_10014472 3300005434 Bacteria 4463
13 Ga0070714_100024962 3300005435 Bacteria 4928
14 Ga0070714_100067916 3300005435 Bacteria 3075
15 Ga0070714_100536391 3300005435 Unclassified 1119
16 Ga0070713_100043322 3300005436 Bacteria 3679
17 Ga0070713_100113607 3300005436 Bacteria 2364
18 Ga0070710_10248432 3300005437 Bacteria 1143
19 Ga0070711_100135551 3300005439 Bacteria 1839
20 Ga0070705_100001269 3300005440 Bacteria 13616
21 Ga0070705_100469531 3300005440 Unclassified 948
22 Ga0070700_100265157 3300005441 Bacteria 1238
23 Ga0070708_100008595 3300005445 Bacteria 8204
24 Ga0070708_100121886 3300005445 Bacteria 2406
25 Ga0070681_10086728 3300005458 Bacteria 3083
26 Ga0070681_10105940 3300005458 Bacteria 2753
27 Ga0070681_10181035 3300005458 Bacteria 2029
28 Ga0070681_10220574 3300005458 Bacteria 1811
29 Ga0070681_10491612 3300005458 Bacteria 1140
30 Ga0070681_10665103 3300005458 Bacteria 957
31 Ga0070706_100000587 3300005467 Bacteria 42203
32 Ga0070706_100040187 3300005467 Bacteria 4317
33 Ga0070706_100056713 3300005467 Bacteria 3614
34 Ga0070707_100001114 3300005468 Bacteria 26522
35 Ga0070707_100062558 3300005468 Bacteria 3570
36 Ga0070698_100021172 3300005471 Bacteria 6813
37 Ga0070698_100188052 3300005471 Bacteria 2003
38 Ga0070698_100453550 3300005471 Bacteria 1218
39 Ga0070699_100000034 3300005518 Bacteria 135576
40 Ga0070699_100212862 3300005518 Bacteria 1721
41 Ga0070699_100693895 3300005518 Unclassified 930
42 Ga0070679_100023958 3300005530 Bacteria 5981
43 Ga0070697_100162466 3300005536 Bacteria 1887
44 Ga0068853_100136632 3300005539 Bacteria 2198
45 Ga0068853_100396211 3300005539 Bacteria 1291
46 Ga0070672_100230387 3300005543 Bacteria 1556
47 Ga0070695_100112314 3300005545 Bacteria 1851
48 Ga0070696_100000255 3300005546 Bacteria 32239
49 Ga0070696_100072004 3300005546 Bacteria 2433
50 Ga0070693_100010540 3300005547 Bacteria 4634
51 Ga0070693_100084644 3300005547 Bacteria 1898
52 Ga0070693_100110169 3300005547 Bacteria 1692
53 Ga0070665_100148117 3300005548 Bacteria 2350
54 Ga0070704_100036612 3300005549 Bacteria 3346
55 Ga0070704_100433544 3300005549 Bacteria 1128
56 Ga0068855_100080524 3300005563 Bacteria 3776
57 Ga0068857_100239659 3300005577 Bacteria 1660
58 Ga0068857_100294609 3300005577 Bacteria 1495
59 Ga0068856_100079242 3300005614 Bacteria 3257
60 Ga0070702_100254955 3300005615 Bacteria 1191
61 Ga0068864_100417641 3300005618 Bacteria 1278
62 Ga0068866_10014090 3300005718 Bacteria 3522
63 Ga0068870_10030705 3300005840 Bacteria 2718
64 Ga0068858_100554201 3300005842 Bacteria 1113
65 Ga0068860_100095042 3300005843 Bacteria 2840
66 Ga0081455_10012551 3300005937 Bacteria 8451
67 Ga0070717_10014338 3300006028 Bacteria 6097
68 Ga0070717_10139297 3300006028 Bacteria 2092
69 Ga0075364_10009822 3300006051 Bacteria 5755
70 Ga0070716_100203179 3300006173 Bacteria 1318
71 Ga0070712_100035581 3300006175 Bacteria 3380
72 Ga0097621_100146495 3300006237 Bacteria 2022
73 Ga0075428_100042807 3300006844 Unclassified 4979
74 Ga0075428_100148128 3300006844 Unclassified 2551
75 Ga0075431_100030350 3300006847 Bacteria 5567
76 Ga0075433_10093239 3300006852 Bacteria 2664
77 Ga0075433_10232356 3300006852 Bacteria 1637
78 Ga0075434_100034575 3300006871 Bacteria 4991
79 Ga0075434_100064738 3300006871 Bacteria 3640
80 Ga0075434_100645147 3300006871 Bacteria 1077
81 Ga0075436_100279972 3300006914 Unclassified 1192
82 Ga0075435_100054302 3300007076 Bacteria 3233
83 Ga0075435_100310561 3300007076 Unclassified 1349
84 Ga0075435_100396925 3300007076 Bacteria 1186
85 Ga0099794_10070772 3300007265 Bacteria 1708
86 Ga0099795_10020631 3300007788 Bacteria 2150
87 Ga0105240_10189023 3300009093 Bacteria 2423
88 Ga0105240_11134407 3300009093 Unclassified 830
89 Ga0111539_10265598 3300009094 Bacteria 1998
90 Ga0105245_10007607 3300009098 Bacteria 9487
91 Ga0105245_10017131 3300009098 Bacteria 6323
92 Ga0105245_10392392 3300009098 Bacteria 1385
93 Ga0114129_10018002 3300009147 Bacteria 10061
94 Ga0114129_10064755 3300009147 Bacteria 5101
95 Ga0105243_10029553 3300009148 Bacteria 4215
96 Ga0105238_10187637 3300009551 Bacteria 2044
97 Ga0105238_10191459 3300009551 Bacteria 2021
98 Ga0105238_10302055 3300009551 Bacteria 1584
99 Ga0105249_10184211 3300009553 Bacteria 2033
100 Ga0157369_10010842 3300013105 Bacteria 10380
101 Ga0157369_10082345 3300013105 Bacteria 3443
102 Ga0157369_10097227 3300013105 Bacteria 3141
103 Ga0157369_10185917 3300013105 Bacteria 2185
104 Ga0157369_10581909 3300013105 Bacteria 1156
105 Ga0157378_10023972 3300013297 Bacteria 5367
106 Ga0157378_10163668 3300013297 Bacteria 2082
107 Ga0163162_10197272 3300013306 Bacteria 2142
108 Ga0157372_10237417 3300013307 Bacteria 2115
109 Ga0163163_10284791 3300014325 Unclassified 1704
110 Ga0228598_1022405 3300024227 Bacteria 1242
111 Ga0207656_10051815 3300025321 Bacteria 1776
112 Ga0207653_10000015 3300025885 Bacteria 150553
113 Ga0207692_10297205 3300025898 Bacteria 982
114 Ga0207684_10000701 3300025910 Bacteria 39518
115 Ga0207684_10052665 3300025910 Bacteria 3454
116 Ga0207707_10044741 3300025912 Bacteria 3858
117 Ga0207707_10381839 3300025912 Bacteria 1211
118 Ga0207707_10569576 3300025912 Bacteria 961
119 Ga0207695_10200295 3300025913 Bacteria 1911
120 Ga0207693_10010604 3300025915 Bacteria 7476
121 Ga0207693_10192670 3300025915 Bacteria 1604
122 Ga0207660_10059605 3300025917 Bacteria 2741
123 Ga0207660_10155158 3300025917 Bacteria 1762
124 Ga0207652_10045988 3300025921 Bacteria 3722
125 Ga0207646_10000152 3300025922 Bacteria 95335
126 Ga0207694_10232276 3300025924 Bacteria 1506
127 Ga0207687_10008914 3300025927 Bacteria 6557
128 Ga0207687_10013259 3300025927 Bacteria 5381
129 Ga0207687_10468015 3300025927 Bacteria 1048
130 Ga0207700_10149762 3300025928 Bacteria 1927
131 Ga0207700_10235479 3300025928 Bacteria 1559
132 Ga0207700_10434975 3300025928 Bacteria 1154
133 Ga0207664_10026060 3300025929 Bacteria 4414
134 Ga0207664_10220874 3300025929 Bacteria 1643
135 Ga0207664_10254561 3300025929 Bacteria 1533
136 Ga0207709_10046338 3300025935 Bacteria 2638
137 Ga0207670_10003069 3300025936 Bacteria 8818
138 Ga0207665_10131404 3300025939 Bacteria 1778
139 Ga0207689_10310697 3300025942 Bacteria 1307
140 Ga0207661_10010055 3300025944 Bacteria 6798
141 Ga0207667_10009748 3300025949 Bacteria 11294
142 Ga0207677_10450692 3300026023 Bacteria 1102
143 Ga0207703_10500988 3300026035 Bacteria 1140
144 Ga0207639_10078512 3300026041 Bacteria 2606
145 Ga0207708_10128499 3300026075 Bacteria 1979
146 Ga0207675_100033151 3300026118 Bacteria 4812
147 Ga0207698_10168145 3300026142 Bacteria 1927
148 Ga0207698_10537179 3300026142 Bacteria 1144
149 Ga0207428_10147897 3300027907 Unclassified 1790
150 Ga0268266_10078822 3300028379 Bacteria 2867
151 Ga0307515_10002290 3300028794 Bacteria 41899
152 Ga0265332_10002029 3300031238 Bacteria 10608
153 Ga0265339_10091510 3300031249 Bacteria 1594
154 Ga0307509_10001844 3300031507 Bacteria 35043
155 Ga0307509_10124176 3300031507 Bacteria 2552
156 Ga0307508_10057029 3300031616 Bacteria 3457
157 Ga0307508_10173115 3300031616 Bacteria 1762
158 Ga0307508_10184477 3300031616 Bacteria 1689
159 Ga0307516_10023722 3300031730 Bacteria 6278
160 Ga0307507_10194110 3300033179 Bacteria 1420
161 Ga0373926_0007898 3300035083 Bacteria 3545
162 Ga0373944_0021066 3300035089 Bacteria 1884
163 Ga0373923_0067669 3300035111 Bacteria 1528
164 Ga0373936_0000060 3300035113 Bacteria 52820
165 Ga0373936_0003930 3300035113 Bacteria 5595
166 Ga0373945_0023567 3300035116 Bacteria 2127
167 Ga0373943_0119798 3300035170 Bacteria 1397
168 Ga0373946_0017034 3300035171 Bacteria 2775
169 Ga0373955_0010826 3300035172 Bacteria 4324
170 Ga0373955_0258028 3300035172 Bacteria 1046
171 Ga0373924_0001231 3300035410 Bacteria 8204
172 Ga0373924_0035508 3300035410 Bacteria 2022
173 Ga0373935_0011082 3300035692 Bacteria 5416
174 Ga0373935_0014194 3300035692 Bacteria 4807
175 Ga0373935_0080993 3300035692 Bacteria 2110
176 Ga0373927_0025346 3300035695 Bacteria 3876
177 Ga0373927_0063553 3300035695 Bacteria 2387
178 Ga0373933_0105360 3300035724 Bacteria 1754
179 Ga0373933_0127925 3300035724 Bacteria 1595
180 Ga0373933_0515044 3300035724 Bacteria 784
181 Ga0373947_0018358 3300035725 Bacteria 4025
182 Ga0373947_0118843 3300035725 Bacteria 1677
183 Ga0373937_0002928 3300036401 Bacteria 14276
184 Ga0373937_0032408 3300036401 Bacteria 4740
185 Ga0373937_0287091 3300036401 Bacteria 1554
186 Ga0373925_0008645 3300037068 Bacteria 7419
187 Ga0373925_0029364 3300037068 Bacteria 4034
188 Ga0373925_0116261 3300037068 Bacteria 2071
189 Ga0373925_0462634 3300037068 Bacteria 1039
190 Ga0395898_0087047 3300037466 Bacteria 3010
191 Ga0395898_0184099 3300037466 Bacteria 1996
192 Ga0436361_0505784 3300039447 Bacteria 3549
193 Ga0436363_1487063 3300039450 Bacteria 5405
194 Ga0453683_0009245 3300044673 Bacteria 6584
195 Ga0453683_0026906 3300044673 Bacteria 3651
196 Ga0453683_0039872 3300044673 Bacteria 2951
197 Ga0466963_0022204 3300044694 Bacteria 4016
198 Ga0453684_0035246 3300044712 Bacteria 6921
199 Ga0453684_0080111 3300044712 Bacteria 4079
200 Ga0466967_0008942 3300045976 Bacteria 7393
201 Ga0495651_0108515 3300046462 Bacteria 2056
202 Ga0495580_0107180 3300046472 Bacteria 1940
203 Ga0495580_0297679 3300046472 Bacteria 1099
204 Ga0495582_0338205 3300046473 Bacteria 866
205 Ga0495608_0016893 3300046511 Bacteria 5051
206 Ga0495666_0046387 3300046526 Bacteria 2095
207 Ga0495587_0129962 3300046536 Bacteria 1440
208 Ga0495622_0113855 3300046557 Bacteria 1237
209 Ga0495667_0160118 3300046559 Bacteria 1448
210 Ga0495599_0091608 3300046678 Bacteria 1897
211 Ga0495623_0029167 3300046679 Bacteria 3551
212 Ga0495658_0077238 3300046683 Bacteria 1947
213 Ga0495649_0064668 3300046694 Bacteria 1964
214 Ga0495581_0290553 3300047315 Bacteria 956
215 Ga0495672_0230312 3300047320 Bacteria 910
216 Ga0495675_0196269 3300047444 Bacteria 1230
217 Ga0495684_0125796 3300047471 Bacteria 1929
218 Ga0496102_0040487 3300048905 Bacteria 4215
219 Ga0496104_0040942 3300048907 Bacteria 4344
220 Ga0496104_0489586 3300048907 Bacteria 1141
221 Ga0496105_0114930 3300048908 Bacteria 2220
222 Ga0496110_0016242 3300048913 Bacteria 6211
223 Ga0496111_0003240 3300048914 Bacteria 10046
224 Ga0496111_0152737 3300048914 Bacteria 1713
225 Ga0496111_0415204 3300048914 Bacteria 994
226 Ga0496112_0003623 3300048915 Bacteria 12861
227 Ga0496112_0030164 3300048915 Bacteria 5247
228 Ga0496112_0353203 3300048915 Bacteria 1412
229 Ga0496112_0716039 3300048915 Bacteria 928
230 Ga0496113_0000727 3300048916 Bacteria 16865
231 Ga0496113_0557117 3300048916 Bacteria 919
232 Ga0496115_0172306 3300048918 Bacteria 1790
233 Ga0501033_0315177 3300049570 Bacteria 1099
234 Ga0501036_0013239 3300049572 Bacteria 6848
235 Ga0501037_0266973 3300049573 Bacteria 1195
236 Ga0501038_0083223 3300049574 Bacteria 2694
237 Ga0501040_0011176 3300049576 Bacteria 5871
238 Ga0501041_0003286 3300049577 Bacteria 9298
239 Ga0501042_0006967 3300049578 Bacteria 7376
240 Ga0501043_0116468 3300049579 Bacteria 2097
241 Ga0501046_0027879 3300049580 Bacteria 4604
242 Ga0501048_0136223 3300049582 Bacteria 1735
243 Ga0501068_0025764 3300049584 Bacteria 3461
244 Ga0501069_0083091 3300049585 Bacteria 1805
245 Ga0501070_0228971 3300049586 Bacteria 1523
246 Ga0501072_0029309 3300049588 Bacteria 4299
247 Ga0501075_0000528 3300049591 Bacteria 23105
248 Ga0501075_0387586 3300049591 Bacteria 1065
249 Ga0501075_0663811 3300049591 Bacteria 795
250 Ga0501076_0000391 3300049592 Bacteria 27401
251 Ga0501079_0006770 3300049741 Bacteria 8622
252 Ga0501080_0310815 3300049742 Bacteria 1428
253 Ga0501081_0001914 3300049743 Bacteria 12917
254 nmdc:mga05p37_704592_c1 3300050507 Bacteria 1121
255 nmdc:mga05p37_917_c1 3300050507 Bacteria 33246
256 nmdc:mga09592_25400_c1 3300050508 Bacteria 2720
257 nmdc:mga08y16_142818_c1 3300050511 Unclassified 2489
258 nmdc:mga0n895_96804_c1 3300050512 Bacteria 2956
259 nmdc:mga0rr50_318657_c1 3300050513 Unclassified 1303
260 nmdc:mga0rr50_43361_c1 3300050513 Bacteria 3291
261 nmdc:mga0a205_189262_c1 3300050515 Bacteria 1951
262 nmdc:mga0a205_243549_c1 3300050515 Bacteria 1679
263 Ga0500635_0004598 3300053080 Bacteria 3562
264 Ga0500578_0310691 3300053086 Bacteria 932
265 Ga0500583_0152121 3300053092 Bacteria 1152
266 Ga0500566_0001651 3300053094 Bacteria 13090
267 Ga0500566_0003738 3300053094 Bacteria 9088
268 Ga0500640_000399 3300053095 Bacteria 10415
269 Ga0500554_000295 3300053102 Bacteria 10797
270 Ga0500595_000225 3300053119 Bacteria 38629
271 Ga0500597_023540 3300053120 Bacteria 2462
272 Ga0500614_000303 3300053123 Bacteria 12701
273 Ga0500614_002191 3300053123 Bacteria 4435
274 Ga0500611_041965 3300053727 Bacteria 1009
275 Ga0501084_0031179 3300054114 Bacteria 4458
276 Ga0501084_0474052 3300054114 Bacteria 1058
277 Ga0501082_0001012 3300060353 Bacteria 24853
278 Ga0530510_0001725 3300061734 Bacteria 14858
279 Ga0373949_0000070
280 Ga0070683_100471196
281 Ga0070683_100836860
282 Ga0070690_100047891
283 Ga0068869_100353717
284 Ga0070680_100083309
285 Ga0070689_100011601
286 Ga0070689_100019605
287 Ga0070692_10078455
288 Ga0070688_100452629
289 Ga0070703_10000034
290 Ga0070709_10014472
291 Ga0070714_100024962
292 Ga0070714_100067916
293 Ga0070714_100536391
294 Ga0070713_100043322
295 Ga0070713_100113607
296 Ga0070710_10248432
297 Ga0070711_100135551
298 Ga0070705_100001269
299 Ga0070705_100469531
300 Ga0070700_100265157
301 Ga0070708_100008595
302 Ga0070708_100121886
303 Ga0070681_10086728
304 Ga0070681_10105940
305 Ga0070681_10181035
306 Ga0070681_10220574
307 Ga0070681_10491612
308 Ga0070681_10665103
309 Ga0070706_100000587
310 Ga0070706_100040187
311 Ga0070706_100056713
312 Ga0070707_100001114
313 Ga0070707_100062558
314 Ga0070698_100021172
315 Ga0070698_100188052
316 Ga0070698_100453550
317 Ga0070699_100000034
318 Ga0070699_100212862
319 Ga0070699_100693895
320 Ga0070679_100023958
321 Ga0070697_100162466
322 Ga0068853_100136632
323 Ga0068853_100396211
324 Ga0070672_100230387
325 Ga0070695_100112314
326 Ga0070696_100000255
327 Ga0070696_100072004
328 Ga0070693_100010540
329 Ga0070693_100084644
330 Ga0070693_100110169
331 Ga0070665_100148117
332 Ga0070704_100036612
333 Ga0070704_100433544
334 Ga0068855_100080524
335 Ga0068857_100239659
336 Ga0068857_100294609
337 Ga0068856_100079242
338 Ga0070702_100254955
339 Ga0068864_100417641
340 Ga0068866_10014090
341 Ga0068870_10030705
342 Ga0068858_100554201
343 Ga0068860_100095042
344 Ga0081455_10012551
345 Ga0070717_10014338
346 Ga0070717_10139297
347 Ga0075364_10009822
348 Ga0070716_100203179
349 Ga0070712_100035581
350 Ga0097621_100146495
351 Ga0075428_100042807
352 Ga0075428_100148128
353 Ga0075431_100030350
354 Ga0075433_10093239
355 Ga0075433_10232356
356 Ga0075434_100034575
357 Ga0075434_100064738
358 Ga0075434_100645147
359 Ga0075436_100279972
360 Ga0075435_100054302
361 Ga0075435_100310561
362 Ga0075435_100396925
363 Ga0099794_10070772
364 Ga0099795_10020631
365 Ga0105240_10189023
366 Ga0105240_11134407
367 Ga0111539_10265598
368 Ga0105245_10007607
369 Ga0105245_10017131
370 Ga0105245_10392392
371 Ga0114129_10018002
372 Ga0114129_10064755
373 Ga0105243_10029553
374 Ga0105238_10187637
375 Ga0105238_10191459
376 Ga0105238_10302055
377 Ga0105249_10184211
378 Ga0157369_10010842
379 Ga0157369_10082345
380 Ga0157369_10097227
381 Ga0157369_10185917
382 Ga0157369_10581909
383 Ga0157378_10023972
384 Ga0157378_10163668
385 Ga0163162_10197272
386 Ga0157372_10237417
387 Ga0163163_10284791
388 Ga0228598_1022405
389 Ga0207656_10051815
390 Ga0207653_10000015
391 Ga0207692_10297205
392 Ga0207684_10000701
393 Ga0207684_10052665
394 Ga0207707_10044741
395 Ga0207707_10381839
396 Ga0207707_10569576
397 Ga0207695_10200295
398 Ga0207693_10010604
399 Ga0207693_10192670
400 Ga0207660_10059605
401 Ga0207660_10155158
402 Ga0207652_10045988
403 Ga0207646_10000152
404 Ga0207694_10232276
405 Ga0207687_10008914
406 Ga0207687_10013259
407 Ga0207687_10468015
408 Ga0207700_10149762
409 Ga0207700_10235479
410 Ga0207700_10434975
411 Ga0207664_10026060
412 Ga0207664_10220874
413 Ga0207664_10254561
414 Ga0207709_10046338
415 Ga0207670_10003069
416 Ga0207665_10131404
417 Ga0207689_10310697
418 Ga0207661_10010055
419 Ga0207667_10009748
420 Ga0207677_10450692
421 Ga0207703_10500988
422 Ga0207639_10078512
423 Ga0207708_10128499
424 Ga0207675_100033151
425 Ga0207698_10168145
426 Ga0207698_10537179
427 Ga0207428_10147897
428 Ga0268266_10078822
429 Ga0307515_10002290
430 Ga0265332_10002029
431 Ga0265339_10091510
432 Ga0307509_10001844
433 Ga0307509_10124176
434 Ga0307508_10057029
435 Ga0307508_10173115
436 Ga0307508_10184477
437 Ga0307516_10023722
438 Ga0307507_10194110
439 Ga0373926_0007898
440 Ga0373944_0021066
441 Ga0373923_0067669
442 Ga0373936_0000060
443 Ga0373936_0003930
444 Ga0373945_0023567
445 Ga0373943_0119798
446 Ga0373946_0017034
447 Ga0373955_0010826
448 Ga0373955_0258028
449 Ga0373924_0001231
450 Ga0373924_0035508
451 Ga0373935_0011082
452 Ga0373935_0014194
453 Ga0373935_0080993
454 Ga0373927_0025346
455 Ga0373927_0063553
456 Ga0373933_0105360
457 Ga0373933_0127925
458 Ga0373933_0515044
459 Ga0373947_0018358
460 Ga0373947_0118843
461 Ga0373937_0002928
462 Ga0373937_0032408
463 Ga0373937_0287091
464 Ga0373925_0008645
465 Ga0373925_0029364
466 Ga0373925_0116261
467 Ga0373925_0462634
468 Ga0395898_0087047
469 Ga0395898_0184099
470 Ga0436361_0505784
471 Ga0436363_1487063
472 Ga0453683_0009245
473 Ga0453683_0026906
474 Ga0453683_0039872
475 Ga0466963_0022204
476 Ga0453684_0035246
477 Ga0453684_0080111
478 Ga0466967_0008942
479 Ga0495651_0108515
480 Ga0495580_0107180
481 Ga0495580_0297679
482 Ga0495582_0338205
483 Ga0495608_0016893
484 Ga0495666_0046387
485 Ga0495587_0129962
486 Ga0495622_0113855
487 Ga0495667_0160118
488 Ga0495599_0091608
489 Ga0495623_0029167
490 Ga0495658_0077238
491 Ga0495649_0064668
492 Ga0495581_0290553
493 Ga0495672_0230312
494 Ga0495675_0196269
495 Ga0495684_0125796
496 Ga0496102_0040487
497 Ga0496104_0040942
498 Ga0496104_0489586
499 Ga0496105_0114930
500 Ga0496110_0016242
501 Ga0496111_0003240
502 Ga0496111_0152737
503 Ga0496111_0415204
504 Ga0496112_0003623
505 Ga0496112_0030164
506 Ga0496112_0353203
507 Ga0496112_0716039
508 Ga0496113_0000727
509 Ga0496113_0557117
510 Ga0496115_0172306
511 Ga0501033_0315177
512 Ga0501036_0013239
513 Ga0501037_0266973
514 Ga0501038_0083223
515 Ga0501040_0011176
516 Ga0501041_0003286
517 Ga0501042_0006967
518 Ga0501043_0116468
519 Ga0501046_0027879
520 Ga0501048_0136223
521 Ga0501068_0025764
522 Ga0501069_0083091
523 Ga0501070_0228971
524 Ga0501072_0029309
525 Ga0501075_0000528
526 Ga0501075_0387586
527 Ga0501075_0663811
528 Ga0501076_0000391
529 Ga0501079_0006770
530 Ga0501080_0310815
531 Ga0501081_0001914
532 nmdc:mga05p37_704592_c1
533 nmdc:mga05p37_917_c1
534 nmdc:mga09592_25400_c1
535 nmdc:mga08y16_142818_c1
536 nmdc:mga0n895_96804_c1
537 nmdc:mga0rr50_318657_c1
538 nmdc:mga0rr50_43361_c1
539 nmdc:mga0a205_189262_c1
540 nmdc:mga0a205_243549_c1
541 Ga0500635_0004598
542 Ga0500578_0310691
543 Ga0500583_0152121
544 Ga0500566_0001651
545 Ga0500566_0003738
546 Ga0500640_000399
547 Ga0500554_000295
548 Ga0500595_000225
549 Ga0500597_023540
550 Ga0500614_000303
551 Ga0500614_002191
552 Ga0500611_041965
553 Ga0501084_0031179
554 Ga0501084_0474052
555 Ga0501082_0001012
556 Ga0530510_0001725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

240

266

0.94

PF00005

ABC_tran

ABC transporter

40

191

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9407 5 236
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9391 1 225
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9381 1 225
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.934 5 225
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9338 5 225
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 3 237 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9483 1 221 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9458 3 226 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9441 1 221 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9386 1 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C4S8X1-F1-model_v4 ABC transporter ATP-binding protein 0.981 3 237 GO:0005524
GO:0005886
GO:0016887
AF-A0A0S8CEG3-F1-model_v4 ABC transporter 0.9697 2 237 GO:0005524
GO:0005886
GO:0016887
AF-A0A364P0C7-F1-model_v4 ABC transporter ATP-binding protein 0.9678 5 240 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A5P2H818-F1-model_v4 ABC transporter ATP-binding protein 0.965 1 240 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A3N6MLS5-F1-model_v4 ABC transporter ATP-binding protein 0.9641 2 237 GO:0005524
GO:0005886
GO:0016887

Map