F382318

General Info

Members Datasets Scaffolds Average Seq Length
278 201 556 126

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10019841|Ga0075366_100198412
Length 123
Sequence MSKHVLIADDEPNIVVSLEYLMKREGHRVSIARDGDAALAMIRSERPDLVLLDVMMPGRSGFEVCQTVRADESLAGVRILMLSAKGRDTDLAKGSALGADAYMTKPFSTRELADKVRELLGGP

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
101 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
138 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
139 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
155 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
156 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
157 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
184 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
185 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
186 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
187 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
198 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
199 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
200 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.31
Nodule 0
Rhizoplane 2.16
Rhizosphere 78.06
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10019841 3300006195 Bacteria 3895
2 rootH1_10057325 3300003323 Bacteria 7655
3 Ga0065712_10458888 3300005290 Bacteria 679
4 Ga0070683_100060532 3300005329 Bacteria 3519
5 Ga0070690_100031272 3300005330 Bacteria 3315
6 Ga0068869_100044958 3300005334 Bacteria 3177
7 Ga0068869_100353066 3300005334 Bacteria 1199
8 Ga0070680_101022320 3300005336 Bacteria 714
9 Ga0070682_101061917 3300005337 Bacteria 676
10 Ga0068868_100248648 3300005338 Bacteria 1496
11 Ga0070689_100691878 3300005340 Bacteria 890
12 Ga0070692_10309886 3300005345 Bacteria 967
13 Ga0070668_100168619 3300005347 Bacteria 1781
14 Ga0070669_101701306 3300005353 Bacteria 550
15 Ga0070688_100055797 3300005365 Unclassified 2479
16 Ga0070688_100057534 3300005365 Bacteria 2444
17 Ga0070694_100826774 3300005444 Bacteria 761
18 Ga0070708_101784368 3300005445 Bacteria 571
19 Ga0070681_10410439 3300005458 Bacteria 1266
20 Ga0070685_10079581 3300005466 Bacteria 1961
21 Ga0070679_100054796 3300005530 Bacteria 3971
22 Ga0070679_100220845 3300005530 Bacteria 1856
23 Ga0070684_100299713 3300005535 Bacteria 1475
24 Ga0070684_100745385 3300005535 Unclassified 914
25 Ga0070697_100059305 3300005536 Bacteria 3116
26 Ga0070686_100707582 3300005544 Bacteria 804
27 Ga0070695_100575756 3300005545 Bacteria 881
28 Ga0068855_100570566 3300005563 Bacteria 1223
29 Ga0068857_100201386 3300005577 Bacteria 1815
30 Ga0068856_100024448 3300005614 Bacteria 5881
31 Ga0070702_100299349 3300005615 Bacteria 1112
32 Ga0068852_100969749 3300005616 Bacteria 868
33 Ga0068859_100360915 3300005617 Bacteria 1548
34 Ga0068859_100414426 3300005617 Bacteria 1443
35 Ga0068859_102691709 3300005617 Bacteria 547
36 Ga0068864_102082286 3300005618 Bacteria 574
37 Ga0068866_10015535 3300005718 Bacteria 3383
38 Ga0068861_100099107 3300005719 Bacteria 2314
39 Ga0068870_10271071 3300005840 Bacteria 1060
40 Ga0068870_10853135 3300005840 Bacteria 640
41 Ga0068863_101361734 3300005841 Bacteria 717
42 Ga0068860_100108573 3300005843 Bacteria 2652
43 Ga0068862_100889290 3300005844 Bacteria 875
44 Ga0081455_10179256 3300005937 Bacteria 1606
45 Ga0070717_10014804 3300006028 Bacteria 6001
46 Ga0070717_10345970 3300006028 Bacteria 1328
47 Ga0075366_11041651 3300006195 Bacteria 511
48 Ga0097621_100150721 3300006237 Bacteria 1994
49 Ga0068871_100123079 3300006358 Bacteria 2193
50 Ga0068871_100317074 3300006358 Bacteria 1372
51 Ga0075428_100642284 3300006844 Bacteria 1132
52 Ga0075430_100849901 3300006846 Bacteria 752
53 Ga0075430_101438809 3300006846 Unclassified 566
54 Ga0075429_100090017 3300006880 Unclassified 2676
55 Ga0075429_100412473 3300006880 Bacteria 1183
56 Ga0075436_101301327 3300006914 Bacteria 550
57 Ga0097620_100360917 3300006931 Bacteria 1548
58 Ga0097620_100414437 3300006931 Bacteria 1443
59 Ga0097620_102691684 3300006931 Bacteria 547
60 Ga0075435_100457735 3300007076 Unclassified 1101
61 Ga0075435_101075617 3300007076 Bacteria 703
62 Ga0075435_101477204 3300007076 Bacteria 596
63 Ga0075435_101610453 3300007076 Bacteria 570
64 Ga0105245_10000809 3300009098 Bacteria 28488
65 Ga0105245_10315275 3300009098 Bacteria 1539
66 Ga0105245_10477037 3300009098 Bacteria 1260
67 Ga0114129_11516268 3300009147 Bacteria 823
68 Ga0105243_10262368 3300009148 Bacteria 1547
69 Ga0105243_10372305 3300009148 Bacteria 1318
70 Ga0105241_10609975 3300009174 Bacteria 987
71 Ga0105248_10188420 3300009177 Bacteria 2324
72 Ga0105249_10182038 3300009553 Bacteria 2045
73 Ga0105249_11244969 3300009553 Bacteria 815
74 Ga0105239_10210611 3300010375 Bacteria 2179
75 Ga0157374_10396488 3300013296 Bacteria 1376
76 Ga0157378_10112459 3300013297 Bacteria 2498
77 Ga0157372_11887061 3300013307 Bacteria 687
78 Ga0163163_10197325 3300014325 Bacteria 2061
79 Ga0163163_11012231 3300014325 Bacteria 894
80 Ga0163163_12262851 3300014325 Bacteria 602
81 Ga0157379_11738021 3300014968 Bacteria 612
82 Ga0157376_10722131 3300014969 Bacteria 1003
83 Ga0213873_10054266 3300021358 Bacteria 1069
84 Ga0213876_10182372 3300021384 Unclassified 1116
85 Ga0213876_10546463 3300021384 Bacteria 616
86 Ga0207642_10105069 3300025899 Bacteria 1426
87 Ga0207643_10334429 3300025908 Bacteria 948
88 Ga0207643_10366679 3300025908 Bacteria 906
89 Ga0207684_10032177 3300025910 Bacteria 4461
90 Ga0207654_10464803 3300025911 Bacteria 889
91 Ga0207707_10294917 3300025912 Bacteria 1403
92 Ga0207662_10105269 3300025918 Bacteria 1753
93 Ga0207662_10220822 3300025918 Bacteria 1234
94 Ga0207657_10919626 3300025919 Bacteria 673
95 Ga0207652_10037908 3300025921 Bacteria 4082
96 Ga0207652_10261986 3300025921 Bacteria 1559
97 Ga0207681_11277873 3300025923 Bacteria 616
98 Ga0207694_10388108 3300025924 Bacteria 1160
99 Ga0207687_10000429 3300025927 Bacteria 28464
100 Ga0207687_10133862 3300025927 Bacteria 1872
101 Ga0207709_10105642 3300025935 Bacteria 1871
102 Ga0207670_10406182 3300025936 Bacteria 1090
103 Ga0207689_10109897 3300025942 Bacteria 2265
104 Ga0207689_10321529 3300025942 Bacteria 1284
105 Ga0207661_10471257 3300025944 Bacteria 1145
106 Ga0207712_10830857 3300025961 Bacteria 813
107 Ga0207668_10207686 3300025972 Bacteria 1564
108 Ga0207640_10608957 3300025981 Bacteria 926
109 Ga0207708_10096035 3300026075 Bacteria 2290
110 Ga0207676_10762240 3300026095 Unclassified 942
111 Ga0207676_11609108 3300026095 Bacteria 647
112 Ga0207674_10294577 3300026116 Bacteria 1571
113 Ga0207675_100133318 3300026118 Bacteria 2356
114 Ga0207675_100271943 3300026118 Bacteria 1644
115 Ga0207698_11155927 3300026142 Bacteria 788
116 Ga0268265_12279332 3300028380 Bacteria 548
117 Ga0268264_10196784 3300028381 Bacteria 1841
118 Ga0307517_10035943 3300028786 Bacteria 5590
119 Ga0307515_10017096 3300028794 Bacteria 13243
120 Ga0265338_10351068 3300028800 Bacteria 1060
121 Ga0307513_10000989 3300031456 Bacteria 41072
122 Ga0307513_10276488 3300031456 Bacteria 1459
123 Ga0307509_10000040 3300031507 Bacteria 184460
124 Ga0307509_10002692 3300031507 Bacteria 28368
125 Ga0307509_10036676 3300031507 Bacteria 5366
126 Ga0307408_101130128 3300031548 Bacteria 728
127 Ga0307408_101203188 3300031548 Bacteria 707
128 Ga0307508_10040165 3300031616 Bacteria 4202
129 Ga0307516_10034851 3300031730 Bacteria 5054
130 Ga0307405_10276967 3300031731 Bacteria 1261
131 Ga0307406_10021360 3300031901 Bacteria 3827
132 Ga0307412_10364191 3300031911 Bacteria 1165
133 Ga0307412_10433828 3300031911 Bacteria 1078
134 Ga0307416_100877382 3300032002 Bacteria 996
135 Ga0307415_100148283 3300032126 Bacteria 1802
136 Ga0307507_10086370 3300033179 Bacteria 2721
137 Ga0373949_0000200 3300035090 Bacteria 23039
138 Ga0373932_0179775 3300035112 Bacteria 742
139 Ga0373936_0163656 3300035113 Bacteria 970
140 Ga0373941_0044187 3300035115 Bacteria 1389
141 Ga0373956_0023782 3300035119 Bacteria 2633
142 Ga0373960_0220162 3300035121 Bacteria 679
143 Ga0373961_0000103 3300035241 Bacteria 44859
144 Ga0373937_0013761 3300036401 Bacteria 7129
145 Ga0373937_1874145 3300036401 Bacteria 546
146 Ga0373925_1045600 3300037068 Bacteria 672
147 Ga0395899_0007971 3300037312 Bacteria 8158
148 Ga0395900_0008099 3300037418 Bacteria 10818
149 Ga0395900_0063218 3300037418 Bacteria 3805
150 Ga0395898_1546259 3300037466 Bacteria 588
151 Ga0395905_0183440 3300037471 Bacteria 1965
152 Ga0395905_0241921 3300037471 Bacteria 1686
153 Ga0395901_0127740 3300038443 Bacteria 2672
154 Ga0395901_0191685 3300038443 Bacteria 2143
155 Ga0395901_1948655 3300038443 Bacteria 534
156 Ga0436365_0157589 3300039437 Bacteria 1230
157 Ga0436365_0381276 3300039437 Bacteria 1430
158 Ga0436363_1343728 3300039450 Bacteria 651
159 Ga0436362_0772064 3300039453 Bacteria 1015
160 Ga0451787_444733 3300041441 Bacteria 1016
161 Ga0451791_0434644 3300041451 Bacteria 553
162 Ga0451802_0596154 3300041460 Bacteria 575
163 Ga0451807_0264645 3300041486 Bacteria 1199
164 Ga0451843_0531286 3300041509 Bacteria 504
165 Ga0451853_0533836 3300041512 Bacteria 1317
166 Ga0451577_0018296 3300042876 Bacteria 6457
167 Ga0451577_0103621 3300042876 Bacteria 2543
168 Ga0451577_1174583 3300042876 Bacteria 685
169 Ga0451577_1586936 3300042876 Bacteria 577
170 Ga0451577_1677912 3300042876 Bacteria 559
171 Ga0466961_0684124 3300044693 Bacteria 615
172 Ga0453684_0018437 3300044712 Bacteria 10711
173 Ga0453684_0099394 3300044712 Bacteria 3564
174 Ga0453684_0318628 3300044712 Bacteria 1762
175 Ga0453684_1190320 3300044712 Bacteria 800
176 Ga0451576_0046692 3300045051 Bacteria 4559
177 Ga0451576_0173890 3300045051 Bacteria 2248
178 Ga0451576_1305422 3300045051 Bacteria 756
179 Ga0466967_0268273 3300045976 Bacteria 1635
180 Ga0495650_0008516 3300046471 Bacteria 5968
181 Ga0495594_0771894 3300046499 Bacteria 542
182 Ga0495622_0067484 3300046557 Bacteria 1653
183 Ga0495668_0541702 3300046616 Bacteria 642
184 Ga0495649_0209199 3300046694 Unclassified 1011
185 Ga0495686_0027240 3300047472 Bacteria 3733
186 Ga0496105_0797440 3300048908 Bacteria 718
187 Ga0496114_0138141 3300048917 Bacteria 2108
188 Ga0495682_0293340 3300049460 Bacteria 574
189 Ga0501292_009632 3300049515 Bacteria 1436
190 Ga0501298_017248 3300049521 Bacteria 1316
191 Ga0501033_0282435 3300049570 Bacteria 1172
192 Ga0501034_0055164 3300049571 Bacteria 4000
193 Ga0501034_0173002 3300049571 Bacteria 2126
194 Ga0501034_1323508 3300049571 Bacteria 597
195 Ga0501043_0300891 3300049579 Bacteria 1226
196 Ga0501046_1077295 3300049580 Bacteria 556
197 Ga0501047_0023225 3300049581 Bacteria 5954
198 Ga0501047_0107795 3300049581 Bacteria 2667
199 Ga0501068_0685707 3300049584 Bacteria 670
200 Ga0501069_0151571 3300049585 Bacteria 1332
201 Ga0501070_0072161 3300049586 Bacteria 2858
202 Ga0501070_0161321 3300049586 Bacteria 1848
203 Ga0501070_0497562 3300049586 Bacteria 979
204 Ga0501071_0254104 3300049587 Bacteria 1327
205 Ga0501072_0717131 3300049588 Bacteria 785
206 Ga0501073_0167606 3300049589 Bacteria 1521
207 Ga0501074_0592490 3300049590 Bacteria 784
208 Ga0501198_050460 3300049649 Bacteria 740
209 Ga0501202_040143 3300049652 Bacteria 1008
210 Ga0501207_081503 3300049654 Bacteria 623
211 Ga0501209_010808 3300049656 Bacteria 1891
212 Ga0501214_006014 3300049659 Bacteria 1188
213 Ga0501216_002745 3300049660 Bacteria 2523
214 Ga0501217_009515 3300049661 Bacteria 2116
215 Ga0501227_004579 3300049665 Bacteria 2972
216 Ga0501227_123286 3300049665 Bacteria 701
217 Ga0501230_003147 3300049667 Bacteria 2167
218 Ga0501233_001286 3300049668 Bacteria 4289
219 Ga0501235_056001 3300049669 Bacteria 919
220 Ga0501249_064567 3300049679 Bacteria 850
221 Ga0501221_002317 3300049704 Bacteria 3164
222 Ga0501225_0013728 3300049705 Bacteria 2265
223 Ga0501225_0189678 3300049705 Bacteria 647
224 Ga0501225_0313289 3300049705 Bacteria 534
225 Ga0501229_002758 3300049706 Bacteria 2079
226 Ga0501080_0104628 3300049742 Bacteria 2625
227 Ga0501080_0180494 3300049742 Bacteria 1943
228 Ga0501081_0136514 3300049743 Unclassified 1756
229 Ga0501267_004802 3300049764 Bacteria 1266
230 Ga0501035_0161511 3300049822 Bacteria 1939
231 Ga0501044_0007009 3300049823 Bacteria 12403
232 Ga0501044_0282446 3300049823 Bacteria 1593
233 Ga0501204_025166 3300049850 Bacteria 799
234 nmdc:mga0k408_18783_c1 3300050493 Bacteria 3860
235 nmdc:mga0k408_47599_c1 3300050493 Bacteria 2478
236 nmdc:mga0k408_874919_c1 3300050493 Bacteria 522
237 nmdc:mga09592_1276857_c1 3300050508 Bacteria 604
238 nmdc:mga09592_132460_c1 3300050508 Bacteria 2146
239 nmdc:mga09592_982396_c1 3300050508 Bacteria 706
240 nmdc:mga0qj67_302785_c1 3300050509 Bacteria 1295
241 nmdc:mga0qj67_945051_c1 3300050509 Unclassified 678
242 nmdc:mga06r32_467967_c1 3300050510 Bacteria 1239
243 nmdc:mga0n895_1319401_c1 3300050512 Bacteria 692
244 nmdc:mga0rr50_188542_c1 3300050513 Bacteria 1689
245 nmdc:mga0rr50_939224_c1 3300050513 Bacteria 737
246 Ga0500635_0420418 3300053080 Bacteria 529
247 Ga0500578_0233997 3300053086 Bacteria 1112
248 Ga0500647_0131368 3300053091 Bacteria 1180
249 Ga0500566_0000256 3300053094 Bacteria 28676
250 Ga0500566_0005757 3300053094 Bacteria 7363
251 Ga0500640_003703 3300053095 Bacteria 5406
252 Ga0500654_025565 3300053099 Bacteria 3676
253 Ga0500554_000299 3300053102 Bacteria 10742
254 Ga0500554_023525 3300053102 Bacteria 1734
255 Ga0500554_248616 3300053102 Bacteria 586
256 Ga0500572_002342 3300053111 Bacteria 4585
257 Ga0500594_0106522 3300053118 Bacteria 868
258 Ga0500595_001884 3300053119 Bacteria 10815
259 Ga0500595_081802 3300053119 Bacteria 944
260 Ga0500597_001818 3300053120 Bacteria 5637
261 Ga0500597_054192 3300053120 Bacteria 1714
262 Ga0500614_000819 3300053123 Bacteria 7851
263 Ga0500614_013507 3300053123 Bacteria 1795
264 Ga0500642_0012078 3300053130 Bacteria 3118
265 Ga0500642_0071535 3300053130 Bacteria 1579
266 Ga0500658_0142226 3300053134 Bacteria 1077
267 Ga0500658_0200631 3300053134 Bacteria 912
268 Ga0500559_0003311 3300053136 Bacteria 7989
269 Ga0500559_0055737 3300053136 Bacteria 1754
270 Ga0500568_0004182 3300053139 Bacteria 7787
271 Ga0500603_002200 3300053150 Bacteria 4305
272 Ga0500603_090758 3300053150 Bacteria 897
273 Ga0500622_0038287 3300053156 Bacteria 2502
274 Ga0500630_099130 3300053159 Bacteria 1331
275 Ga0500638_107294 3300053162 Bacteria 1294
276 Ga0500637_0046089 3300053178 Bacteria 2475
277 Ga0500601_007294 3300053737 Bacteria 1224
278 Ga0501082_0063769 3300060353 Bacteria 3172
279 Ga0075366_10019841
280 rootH1_10057325
281 Ga0065712_10458888
282 Ga0070683_100060532
283 Ga0070690_100031272
284 Ga0068869_100044958
285 Ga0068869_100353066
286 Ga0070680_101022320
287 Ga0070682_101061917
288 Ga0068868_100248648
289 Ga0070689_100691878
290 Ga0070692_10309886
291 Ga0070668_100168619
292 Ga0070669_101701306
293 Ga0070688_100055797
294 Ga0070688_100057534
295 Ga0070694_100826774
296 Ga0070708_101784368
297 Ga0070681_10410439
298 Ga0070685_10079581
299 Ga0070679_100054796
300 Ga0070679_100220845
301 Ga0070684_100299713
302 Ga0070684_100745385
303 Ga0070697_100059305
304 Ga0070686_100707582
305 Ga0070695_100575756
306 Ga0068855_100570566
307 Ga0068857_100201386
308 Ga0068856_100024448
309 Ga0070702_100299349
310 Ga0068852_100969749
311 Ga0068859_100360915
312 Ga0068859_100414426
313 Ga0068859_102691709
314 Ga0068864_102082286
315 Ga0068866_10015535
316 Ga0068861_100099107
317 Ga0068870_10271071
318 Ga0068870_10853135
319 Ga0068863_101361734
320 Ga0068860_100108573
321 Ga0068862_100889290
322 Ga0081455_10179256
323 Ga0070717_10014804
324 Ga0070717_10345970
325 Ga0075366_11041651
326 Ga0097621_100150721
327 Ga0068871_100123079
328 Ga0068871_100317074
329 Ga0075428_100642284
330 Ga0075430_100849901
331 Ga0075430_101438809
332 Ga0075429_100090017
333 Ga0075429_100412473
334 Ga0075436_101301327
335 Ga0097620_100360917
336 Ga0097620_100414437
337 Ga0097620_102691684
338 Ga0075435_100457735
339 Ga0075435_101075617
340 Ga0075435_101477204
341 Ga0075435_101610453
342 Ga0105245_10000809
343 Ga0105245_10315275
344 Ga0105245_10477037
345 Ga0114129_11516268
346 Ga0105243_10262368
347 Ga0105243_10372305
348 Ga0105241_10609975
349 Ga0105248_10188420
350 Ga0105249_10182038
351 Ga0105249_11244969
352 Ga0105239_10210611
353 Ga0157374_10396488
354 Ga0157378_10112459
355 Ga0157372_11887061
356 Ga0163163_10197325
357 Ga0163163_11012231
358 Ga0163163_12262851
359 Ga0157379_11738021
360 Ga0157376_10722131
361 Ga0213873_10054266
362 Ga0213876_10182372
363 Ga0213876_10546463
364 Ga0207642_10105069
365 Ga0207643_10334429
366 Ga0207643_10366679
367 Ga0207684_10032177
368 Ga0207654_10464803
369 Ga0207707_10294917
370 Ga0207662_10105269
371 Ga0207662_10220822
372 Ga0207657_10919626
373 Ga0207652_10037908
374 Ga0207652_10261986
375 Ga0207681_11277873
376 Ga0207694_10388108
377 Ga0207687_10000429
378 Ga0207687_10133862
379 Ga0207709_10105642
380 Ga0207670_10406182
381 Ga0207689_10109897
382 Ga0207689_10321529
383 Ga0207661_10471257
384 Ga0207712_10830857
385 Ga0207668_10207686
386 Ga0207640_10608957
387 Ga0207708_10096035
388 Ga0207676_10762240
389 Ga0207676_11609108
390 Ga0207674_10294577
391 Ga0207675_100133318
392 Ga0207675_100271943
393 Ga0207698_11155927
394 Ga0268265_12279332
395 Ga0268264_10196784
396 Ga0307517_10035943
397 Ga0307515_10017096
398 Ga0265338_10351068
399 Ga0307513_10000989
400 Ga0307513_10276488
401 Ga0307509_10000040
402 Ga0307509_10002692
403 Ga0307509_10036676
404 Ga0307408_101130128
405 Ga0307408_101203188
406 Ga0307508_10040165
407 Ga0307516_10034851
408 Ga0307405_10276967
409 Ga0307406_10021360
410 Ga0307412_10364191
411 Ga0307412_10433828
412 Ga0307416_100877382
413 Ga0307415_100148283
414 Ga0307507_10086370
415 Ga0373949_0000200
416 Ga0373932_0179775
417 Ga0373936_0163656
418 Ga0373941_0044187
419 Ga0373956_0023782
420 Ga0373960_0220162
421 Ga0373961_0000103
422 Ga0373937_0013761
423 Ga0373937_1874145
424 Ga0373925_1045600
425 Ga0395899_0007971
426 Ga0395900_0008099
427 Ga0395900_0063218
428 Ga0395898_1546259
429 Ga0395905_0183440
430 Ga0395905_0241921
431 Ga0395901_0127740
432 Ga0395901_0191685
433 Ga0395901_1948655
434 Ga0436365_0157589
435 Ga0436365_0381276
436 Ga0436363_1343728
437 Ga0436362_0772064
438 Ga0451787_444733
439 Ga0451791_0434644
440 Ga0451802_0596154
441 Ga0451807_0264645
442 Ga0451843_0531286
443 Ga0451853_0533836
444 Ga0451577_0018296
445 Ga0451577_0103621
446 Ga0451577_1174583
447 Ga0451577_1586936
448 Ga0451577_1677912
449 Ga0466961_0684124
450 Ga0453684_0018437
451 Ga0453684_0099394
452 Ga0453684_0318628
453 Ga0453684_1190320
454 Ga0451576_0046692
455 Ga0451576_0173890
456 Ga0451576_1305422
457 Ga0466967_0268273
458 Ga0495650_0008516
459 Ga0495594_0771894
460 Ga0495622_0067484
461 Ga0495668_0541702
462 Ga0495649_0209199
463 Ga0495686_0027240
464 Ga0496105_0797440
465 Ga0496114_0138141
466 Ga0495682_0293340
467 Ga0501292_009632
468 Ga0501298_017248
469 Ga0501033_0282435
470 Ga0501034_0055164
471 Ga0501034_0173002
472 Ga0501034_1323508
473 Ga0501043_0300891
474 Ga0501046_1077295
475 Ga0501047_0023225
476 Ga0501047_0107795
477 Ga0501068_0685707
478 Ga0501069_0151571
479 Ga0501070_0072161
480 Ga0501070_0161321
481 Ga0501070_0497562
482 Ga0501071_0254104
483 Ga0501072_0717131
484 Ga0501073_0167606
485 Ga0501074_0592490
486 Ga0501198_050460
487 Ga0501202_040143
488 Ga0501207_081503
489 Ga0501209_010808
490 Ga0501214_006014
491 Ga0501216_002745
492 Ga0501217_009515
493 Ga0501227_004579
494 Ga0501227_123286
495 Ga0501230_003147
496 Ga0501233_001286
497 Ga0501235_056001
498 Ga0501249_064567
499 Ga0501221_002317
500 Ga0501225_0013728
501 Ga0501225_0189678
502 Ga0501225_0313289
503 Ga0501229_002758
504 Ga0501080_0104628
505 Ga0501080_0180494
506 Ga0501081_0136514
507 Ga0501267_004802
508 Ga0501035_0161511
509 Ga0501044_0007009
510 Ga0501044_0282446
511 Ga0501204_025166
512 nmdc:mga0k408_18783_c1
513 nmdc:mga0k408_47599_c1
514 nmdc:mga0k408_874919_c1
515 nmdc:mga09592_1276857_c1
516 nmdc:mga09592_132460_c1
517 nmdc:mga09592_982396_c1
518 nmdc:mga0qj67_302785_c1
519 nmdc:mga0qj67_945051_c1
520 nmdc:mga06r32_467967_c1
521 nmdc:mga0n895_1319401_c1
522 nmdc:mga0rr50_188542_c1
523 nmdc:mga0rr50_939224_c1
524 Ga0500635_0420418
525 Ga0500578_0233997
526 Ga0500647_0131368
527 Ga0500566_0000256
528 Ga0500566_0005757
529 Ga0500640_003703
530 Ga0500654_025565
531 Ga0500554_000299
532 Ga0500554_023525
533 Ga0500554_248616
534 Ga0500572_002342
535 Ga0500594_0106522
536 Ga0500595_001884
537 Ga0500595_081802
538 Ga0500597_001818
539 Ga0500597_054192
540 Ga0500614_000819
541 Ga0500614_013507
542 Ga0500642_0012078
543 Ga0500642_0071535
544 Ga0500658_0142226
545 Ga0500658_0200631
546 Ga0500559_0003311
547 Ga0500559_0055737
548 Ga0500568_0004182
549 Ga0500603_002200
550 Ga0500603_090758
551 Ga0500622_0038287
552 Ga0500630_099130
553 Ga0500638_107294
554 Ga0500637_0046089
555 Ga0500601_007294
556 Ga0501082_0063769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

5

117

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9649 7 124
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9631 7 124
1m5t-assembly1.cif.gz_A crystal structure of the response regulator divk 0.9627 7 124
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.9606 7 124
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9599 7 124
ID Description Score Start End Superfamily
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9772 7 88 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9642 6 88 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9627 7 88 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.959 7 88 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9587 7 124 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y6PKX3-F1-model_v4 Response regulator 0.9965 6 124 GO:0000160
AF-A0A1F9B5E5-F1-model_v4 Response regulatory domain-containing protein 0.99 6 126 GO:0000155
AF-A0A538RKI5-F1-model_v4 Response regulator 0.9882 1 127 GO:0000160
AF-A0A6J4X0H3-F1-model_v4 Response regulatory domain-containing protein 0.9877 7 124 GO:0000160
AF-A0A1V5VJA6-F1-model_v4 Alkaline phosphatase synthesis transcriptional regulatory protein PhoP 0.9867 6 124 GO:0000160

Map