F381726

General Info

Members Datasets Scaffolds Average Seq Length
277 219 554 160

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000402|Ga0079104_100040256
Length 163
Sequence MASRGVNKVILLGHLGQDPEVRWLPKGGCVATLSLATSDTWRDKATGEPREKTEWHRVVIFNKLAEVAGEYLRKGAQVYIEGALQTRKWQDQSGQERYSTEVIVNTGGTMQMLGARPSGSPTQPTRGEQGPSGISAGAPMDFDDDIPFMGLGYGMAQSAVYCL

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
72 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
157 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
158 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
159 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
160 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
161 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
162 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
163 2643221651 Afipia sp. Root123D2 Isolate Unclassified
164 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
165 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
166 2643221688 Rhizobium sp. Root482 Isolate Unclassified
167 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
168 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
169 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
170 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
171 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
172 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
173 2818991435 Caulobacter henricii 536 Isolate Unclassified
174 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
175 2851153111 Caulobacter radicis 736 Isolate Unclassified
176 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
177 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
178 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
179 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
180 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
181 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
182 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
183 2904699407
184 2906610324
185 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
186 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
187 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
188 2922425934
189 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
190 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
191 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
192 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
193 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
194 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
195 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
196 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
197 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
198 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
199 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
200 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
201 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
202 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
203 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
204 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
205 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
206 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
207 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
208 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
209 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
210 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
211 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
212 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
213 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
214 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
215 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
216 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
217 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
218 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
219 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.64
Metatranscriptomes 1.09
Isolates 22.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 16.25
Rhizoplane 3.25
Rhizosphere 68.59
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1000402 3300006946 Bacteria 50102
2 rootH2_10265971 3300003320 Bacteria 3971
3 Ga0070683_100566867 3300005329 Bacteria 1086
4 Ga0070677_10322989 3300005333 Bacteria 791
5 Ga0070682_101338827 3300005337 Bacteria 610
6 Ga0070709_10583043 3300005434 Bacteria 859
7 Ga0070714_100055059 3300005435 Bacteria 3399
8 Ga0070714_100316234 3300005435 Bacteria 1459
9 Ga0070700_100059177 3300005441 Bacteria 2411
10 Ga0070708_100018255 3300005445 Bacteria 5868
11 Ga0070678_101064814 3300005456 Bacteria 745
12 Ga0068867_100229559 3300005459 Bacteria 1500
13 Ga0068867_100960259 3300005459 Bacteria 773
14 Ga0070707_101110940 3300005468 Bacteria 756
15 Ga0070699_100011071 3300005518 Bacteria 7801
16 Ga0068854_100100114 3300005578 Bacteria 2172
17 Ga0070702_100121219 3300005615 Bacteria 1637
18 Ga0081538_10178282 3300005981 Bacteria 914
19 Ga0081540_1010917 3300005983 Bacteria 6099
20 Ga0081540_1017788 3300005983 Bacteria 4388
21 Ga0075363_100077022 3300006048 Bacteria 1819
22 Ga0075363_100441238 3300006048 Bacteria 768
23 Ga0075364_10173754 3300006051 Bacteria 1457
24 Ga0075364_10317357 3300006051 Bacteria 1061
25 Ga0075428_100180949 3300006844 Bacteria 2282
26 Ga0075430_100057562 3300006846 Bacteria 3269
27 Ga0075430_100124616 3300006846 Bacteria 2148
28 Ga0075431_100020742 3300006847 Bacteria 6715
29 Ga0075431_100155192 3300006847 Bacteria 2355
30 Ga0075431_100691796 3300006847 Bacteria 998
31 Ga0075429_100547169 3300006880 Bacteria 1014
32 Ga0075429_101153260 3300006880 Bacteria 677
33 Ga0099824_1018619 3300006942 Bacteria 5645
34 Ga0111539_10604142 3300009094 Bacteria 1277
35 Ga0105245_10406512 3300009098 Bacteria 1362
36 Ga0114129_10119850 3300009147 Bacteria 3624
37 Ga0099796_10006903 3300010159 Bacteria 2936
38 Ga0105246_10082120 3300011119 Bacteria 2299
39 Ga0157369_10591642 3300013105 Bacteria 1146
40 Ga0157378_10022454 3300013297 Bacteria 5554
41 Ga0163162_10112772 3300013306 Bacteria 2818
42 Ga0157380_10039410 3300014326 Bacteria 3674
43 Ga0157376_10540736 3300014969 Bacteria 1151
44 Ga0182005_1014454 3300015265 Bacteria 2208
45 Ga0163161_11058893 3300017792 Bacteria 695
46 Ga0213872_10057237 3300021361 Bacteria 1765
47 Ga0213876_10051232 3300021384 Bacteria 2182
48 Ga0209758_1000681 3300025297 Bacteria 50614
49 Ga0209050_1042838 3300025298 Bacteria 1230
50 Ga0207688_10079813 3300025901 Bacteria 1867
51 Ga0207699_10084507 3300025906 Bacteria 1977
52 Ga0207684_10948418 3300025910 Bacteria 722
53 Ga0207695_10372356 3300025913 Bacteria 1314
54 Ga0207693_10082017 3300025915 Bacteria 2525
55 Ga0207649_10797863 3300025920 Bacteria 737
56 Ga0207646_11339651 3300025922 Bacteria 624
57 Ga0207709_10197462 3300025935 Bacteria 1434
58 Ga0207689_11461266 3300025942 Bacteria 572
59 Ga0207640_10103566 3300025981 Bacteria 2001
60 Ga0207708_10090424 3300026075 Bacteria 2360
61 Ga0207648_10909329 3300026089 Bacteria 822
62 Ga0207648_11507000 3300026089 Bacteria 632
63 Ga0207674_10003422 3300026116 Bacteria 19427
64 Ga0209281_1000100 3300027111 Bacteria 223560
65 Ga0268265_10014330 3300028380 Bacteria 5400
66 Ga0268265_10267565 3300028380 Bacteria 1523
67 Ga0265318_10142891 3300028577 Bacteria 878
68 Ga0265322_10000106 3300028654 Unclassified 38808
69 Ga0265336_10041925 3300028666 Unclassified 1398
70 Ga0265338_10001392 3300028800 Unclassified 39374
71 Ga0265316_10356214 3300031344 Bacteria 1059
72 Ga0307408_100245475 3300031548 Bacteria 1474
73 Ga0316579_10142600 3300031691 Bacteria 1155
74 Ga0316579_10338533 3300031691 Bacteria 727
75 Ga0316576_10220954 3300031727 Bacteria 1425
76 Ga0316578_10475410 3300031728 Bacteria 737
77 Ga0316577_10301027 3300031733 Bacteria 908
78 Ga0316585_10067063 3300032137 Bacteria 1163
79 Ga0316580_10012322 3300032139 Bacteria 2604
80 Ga0316593_10143646 3300032168 Bacteria 865
81 Ga0316588_1003910 3300033528 Bacteria 2771
82 Ga0316596_1085490 3300033541 Bacteria 849
83 Ga0316214_1004537 3300033545 Bacteria 1794
84 Ga0373936_0360449 3300035113 Bacteria 663
85 Ga0373955_0608796 3300035172 Bacteria 669
86 Ga0316574_0011685 3300035398 Bacteria 4999
87 Ga0316574_0495550 3300035398 Bacteria 762
88 Ga0373927_0595459 3300035695 Bacteria 731
89 Ga0373947_0768207 3300035725 Bacteria 658
90 Ga0373937_0977274 3300036401 Bacteria 795
91 Ga0316582_0153536 3300036647 Bacteria 1557
92 Ga0316584_0068270 3300036712 Bacteria 2664
93 Ga0373925_0461294 3300037068 Bacteria 1041
94 Ga0395900_0000010 3300037418 Bacteria 461364
95 Ga0395900_0434176 3300037418 Bacteria 1272
96 Ga0395898_0011688 3300037466 Bacteria 9105
97 Ga0395898_0434202 3300037466 Bacteria 1251
98 Ga0395905_0006685 3300037471 Bacteria 11554
99 Ga0436364_1216618 3300037853 Bacteria 1031
100 Ga0395901_0000007 3300038443 Bacteria 497408
101 Ga0395901_1152999 3300038443 Bacteria 743
102 Ga0436365_1503777 3300039437 Bacteria 2821
103 Ga0436365_1579030 3300039437 Bacteria 3293
104 Ga0436361_0628237 3300039447 Bacteria 6305
105 Ga0436363_0413420 3300039450 Bacteria 1335
106 Ga0451807_1487576 3300041486 Bacteria 606
107 Ga0451853_2682339 3300041512 Bacteria 1190
108 Ga0466972_0404811 3300044658 Bacteria 640
109 Ga0466957_0634163 3300044842 Bacteria 750
110 Ga0495644_0051540 3300046523 Bacteria 1545
111 Ga0495587_0103766 3300046536 Bacteria 1637
112 Ga0495633_0045132 3300046558 Bacteria 2088
113 Ga0495667_0080186 3300046559 Bacteria 2122
114 Ga0495656_0476300 3300046615 Bacteria 660
115 Ga0495659_0254307 3300046664 Bacteria 733
116 Ga0495661_0049598 3300046665 Bacteria 2545
117 Ga0495669_0004140 3300046684 Bacteria 5962
118 Ga0495581_0277040 3300047315 Bacteria 981
119 Ga0495674_0385307 3300047319 Bacteria 1134
120 Ga0495674_0467401 3300047319 Bacteria 1012
121 Ga0495672_0272451 3300047320 Bacteria 812
122 Ga0495680_0046948 3300047322 Bacteria 3402
123 Ga0495683_0219943 3300047323 Bacteria 847
124 Ga0496101_0193010 3300048904 Bacteria 1572
125 Ga0496101_0226293 3300048904 Bacteria 1453
126 Ga0496106_0127734 3300048909 Bacteria 1992
127 Ga0496107_0207706 3300048910 Bacteria 1456
128 Ga0496108_0134033 3300048911 Bacteria 2130
129 Ga0496111_0521311 3300048914 Bacteria 874
130 Ga0501031_0061858 3300049568 Bacteria 2439
131 Ga0501032_0014122 3300049569 Bacteria 5663
132 Ga0501033_0097741 3300049570 Bacteria 2144
133 Ga0501034_0136119 3300049571 Bacteria 2437
134 Ga0501034_0453026 3300049571 Bacteria 1201
135 Ga0501036_0090845 3300049572 Bacteria 2579
136 Ga0501036_0325387 3300049572 Bacteria 1284
137 Ga0501036_0664590 3300049572 Bacteria 862
138 Ga0501037_0012614 3300049573 Bacteria 6227
139 Ga0501038_0016045 3300049574 Bacteria 6802
140 Ga0501038_0118754 3300049574 Bacteria 2183
141 Ga0501038_0483810 3300049574 Bacteria 948
142 Ga0501040_0445378 3300049576 Bacteria 932
143 Ga0501042_0055991 3300049578 Bacteria 2814
144 Ga0501042_0187029 3300049578 Bacteria 1494
145 Ga0501043_0010467 3300049579 Bacteria 7265
146 Ga0501043_0022618 3300049579 Bacteria 4928
147 Ga0501043_0359822 3300049579 Bacteria 1105
148 Ga0501046_0029406 3300049580 Bacteria 4466
149 Ga0501046_0563094 3300049580 Bacteria 811
150 Ga0501047_0010553 3300049581 Bacteria 8736
151 Ga0501047_0044044 3300049581 Bacteria 4310
152 Ga0501047_0127955 3300049581 Bacteria 2420
153 Ga0501047_0234558 3300049581 Bacteria 1687
154 Ga0501047_0365368 3300049581 Bacteria 1278
155 Ga0501047_0424931 3300049581 Bacteria 1160
156 Ga0501048_0013747 3300049582 Bacteria 6005
157 Ga0501067_0000128 3300049583 Bacteria 41277
158 Ga0501067_0087039 3300049583 Bacteria 1733
159 Ga0501068_0000598 3300049584 Bacteria 18342
160 Ga0501068_0001863 3300049584 Bacteria 11208
161 Ga0501068_0637657 3300049584 Bacteria 695
162 Ga0501068_0862037 3300049584 Bacteria 595
163 Ga0501069_0058925 3300049585 Bacteria 2142
164 Ga0501070_0117217 3300049586 Bacteria 2199
165 Ga0501071_0014705 3300049587 Bacteria 5356
166 Ga0501071_0592137 3300049587 Bacteria 852
167 Ga0501072_0000697 3300049588 Bacteria 24310
168 Ga0501072_0029485 3300049588 Bacteria 4286
169 Ga0501072_0668262 3300049588 Bacteria 817
170 Ga0501073_0000018 3300049589 Bacteria 155244
171 Ga0501073_0012939 3300049589 Bacteria 6083
172 Ga0501073_0862553 3300049589 Bacteria 624
173 Ga0501074_0063524 3300049590 Bacteria 2659
174 Ga0501075_0442064 3300049591 Bacteria 992
175 Ga0501076_0020342 3300049592 Bacteria 5080
176 Ga0501076_0143031 3300049592 Bacteria 1944
177 Ga0501077_0000277 3300049593 Bacteria 30398
178 Ga0501077_0024444 3300049593 Bacteria 3838
179 Ga0501077_0148030 3300049593 Bacteria 1490
180 Ga0501079_0009886 3300049741 Bacteria 7237
181 Ga0501080_0012795 3300049742 Bacteria 7697
182 Ga0501080_0035319 3300049742 Bacteria 4665
183 Ga0501080_0482492 3300049742 Bacteria 1109
184 Ga0501083_0257460 3300049744 Bacteria 1135
185 Ga0501083_1077721 3300049744 Bacteria 523
186 Ga0501035_0122648 3300049822 Bacteria 2270
187 Ga0501035_0289624 3300049822 Bacteria 1382
188 Ga0501035_0326268 3300049822 Bacteria 1289
189 Ga0501044_0004058 3300049823 Bacteria 16427
190 Ga0501044_0039919 3300049823 Bacteria 4893
191 Ga0501044_0048533 3300049823 Bacteria 4384
192 Ga0501045_0014994 3300049824 Bacteria 5500
193 nmdc:mga05p37_110653_c1 3300050507 Bacteria 3379
194 nmdc:mga09592_297139_c1 3300050508 Bacteria 1400
195 nmdc:mga09592_575775_c1 3300050508 Bacteria 966
196 nmdc:mga0qj67_149136_c1 3300050509 Bacteria 1897
197 nmdc:mga0qj67_410847_c1 3300050509 Bacteria 1092
198 nmdc:mga0qj67_945876_c1 3300050509 Bacteria 678
199 nmdc:mga06r32_208391_c1 3300050510 Bacteria 1943
200 nmdc:mga06r32_796691_c1 3300050510 Bacteria 906
201 nmdc:mga0n895_861378_c1 3300050512 Bacteria 893
202 Ga0495601_0008155 3300053077 Bacteria 6177
203 Ga0495612_0081494 3300053078 Bacteria 1360
204 Ga0495595_0068702 3300053084 Bacteria 1672
205 Ga0495595_0100765 3300053084 Bacteria 1394
206 Ga0495619_0044855 3300053085 Bacteria 2903
207 Ga0495619_0056165 3300053085 Bacteria 2609
208 Ga0500562_038387 3300053108 Bacteria 1272
209 Ga0500616_0006079 3300053153 Bacteria 8006
210 Ga0500611_037613 3300053727 Bacteria 1043
211 Ga0501084_0031782 3300054114 Bacteria 4414
212 Ga0501082_0160053 3300060353 Bacteria 1956
213 Ga0530510_0025850 3300061734 Bacteria 4199
214 2513654499 2513237096 Bacteria 8722461
215 2513692018 2513237101 Bacteria 7952346
216 2513859301 2513237137 Bacteria 9558895
217 2513915322 2513237145 Bacteria 8979722
218 2517892623 2517572143 Bacteria 9484767
219 2585153223 2582581280 Bacteria 5994497
220 2585393728 2582581866 Bacteria 6859583
221 2644288470 2643221651 Bacteria 4798932
222 2644342904 2643221661 Bacteria 4267604
223 2644366204 2643221666 Bacteria 4265935
224 2644494439 2643221688 Bacteria 5260751
225 2644509558 2643221691 Bacteria 5093099
226 2671122274 2667528175 Bacteria 7532676
227 2671587639 2671180115 Bacteria 5353919
228 2728750533 2728368998 Bacteria 8720350
229 2776262059 2775506901 Bacteria 9631051
230 2793068544 2791355197 Bacteria 8420563
231 2819540432 2818991435 Bacteria 5433759
232 2819648504 2818991454 Bacteria 5563326
233 2851155053 2851153111 Bacteria 5542585
234 2874609800 2874604998 Bacteria 7834745
235 2874631251 2874628541 Bacteria 8630250
236 2881666289 2881665667 Bacteria 8175609
237 2885382098 2885374607 Bacteria 8927485
238 2885388258 2885383462 Bacteria 9473874
239 2903759316 2903748898 Bacteria 9972761
240 2904695975 2904690495 Bacteria 9412302
241 2904702732
242 2906618377
243 2906632191 2906626472 Bacteria 8826946
244 2908742953 2908739725 Bacteria 8628932
245 2908760607 2908756301 Bacteria 8864324
246 2922429722
247 2935633355 2935630451 Bacteria 8169952
248 2935772565 2935769743 Bacteria 7878163
249 2935783117 2935777560 Bacteria 8077691
250 2935793381 2935785616 Bacteria 7962367
251 2935799442 2935793552 Bacteria 8012592
252 2939670913 2939669807 Bacteria 5028511
253 2941510246 2941507105 Bacteria 8166816
254 2941518017 2941515067 Bacteria 8166720
255 2941526033 2941523033 Bacteria 8169134
256 3005479973 3005474847 Bacteria 9259049
257 8006972692 8006964411 Bacteria 8966052
258 8006981780 8006973647 Bacteria 10679141
259 8006997453 8006994254 Bacteria 8309700
260 8016530164 8016522445 Bacteria 8156687
261 8016535414 8016530956 Bacteria 8155261
262 8016548616 8016539877 Bacteria 8155419
263 8016553515 8016548790 Bacteria 8155074
264 8016561898 8016557553 Bacteria 8154380
265 8016573746 8016566248 Bacteria 8158151
266 8016577871 8016575299 Bacteria 8154085
267 8016599725 8016595262 Bacteria 8149947
268 8016611117 8016603502 Bacteria 8731218
269 8016622515 8016613128 Bacteria 8794220
270 8016627270 8016622563 Bacteria 7999408
271 8019535155 8019530166 Bacteria 8155624
272 8019544329 8019538911 Bacteria 7872763
273 8019554369 8019547302 Bacteria 7996444
274 8019557034 8019555841 Bacteria 9642137
275 8019568266 8019565922 Bacteria 9639779
276 8056683238 8056681323 Bacteria 8472857
277 8056690002 8056689827 Bacteria 6712655
278 Ga0079104_1000402
279 rootH2_10265971
280 Ga0070683_100566867
281 Ga0070677_10322989
282 Ga0070682_101338827
283 Ga0070709_10583043
284 Ga0070714_100055059
285 Ga0070714_100316234
286 Ga0070700_100059177
287 Ga0070708_100018255
288 Ga0070678_101064814
289 Ga0068867_100229559
290 Ga0068867_100960259
291 Ga0070707_101110940
292 Ga0070699_100011071
293 Ga0068854_100100114
294 Ga0070702_100121219
295 Ga0081538_10178282
296 Ga0081540_1010917
297 Ga0081540_1017788
298 Ga0075363_100077022
299 Ga0075363_100441238
300 Ga0075364_10173754
301 Ga0075364_10317357
302 Ga0075428_100180949
303 Ga0075430_100057562
304 Ga0075430_100124616
305 Ga0075431_100020742
306 Ga0075431_100155192
307 Ga0075431_100691796
308 Ga0075429_100547169
309 Ga0075429_101153260
310 Ga0099824_1018619
311 Ga0111539_10604142
312 Ga0105245_10406512
313 Ga0114129_10119850
314 Ga0099796_10006903
315 Ga0105246_10082120
316 Ga0157369_10591642
317 Ga0157378_10022454
318 Ga0163162_10112772
319 Ga0157380_10039410
320 Ga0157376_10540736
321 Ga0182005_1014454
322 Ga0163161_11058893
323 Ga0213872_10057237
324 Ga0213876_10051232
325 Ga0209758_1000681
326 Ga0209050_1042838
327 Ga0207688_10079813
328 Ga0207699_10084507
329 Ga0207684_10948418
330 Ga0207695_10372356
331 Ga0207693_10082017
332 Ga0207649_10797863
333 Ga0207646_11339651
334 Ga0207709_10197462
335 Ga0207689_11461266
336 Ga0207640_10103566
337 Ga0207708_10090424
338 Ga0207648_10909329
339 Ga0207648_11507000
340 Ga0207674_10003422
341 Ga0209281_1000100
342 Ga0268265_10014330
343 Ga0268265_10267565
344 Ga0265318_10142891
345 Ga0265322_10000106
346 Ga0265336_10041925
347 Ga0265338_10001392
348 Ga0265316_10356214
349 Ga0307408_100245475
350 Ga0316579_10142600
351 Ga0316579_10338533
352 Ga0316576_10220954
353 Ga0316578_10475410
354 Ga0316577_10301027
355 Ga0316585_10067063
356 Ga0316580_10012322
357 Ga0316593_10143646
358 Ga0316588_1003910
359 Ga0316596_1085490
360 Ga0316214_1004537
361 Ga0373936_0360449
362 Ga0373955_0608796
363 Ga0316574_0011685
364 Ga0316574_0495550
365 Ga0373927_0595459
366 Ga0373947_0768207
367 Ga0373937_0977274
368 Ga0316582_0153536
369 Ga0316584_0068270
370 Ga0373925_0461294
371 Ga0395900_0000010
372 Ga0395900_0434176
373 Ga0395898_0011688
374 Ga0395898_0434202
375 Ga0395905_0006685
376 Ga0436364_1216618
377 Ga0395901_0000007
378 Ga0395901_1152999
379 Ga0436365_1503777
380 Ga0436365_1579030
381 Ga0436361_0628237
382 Ga0436363_0413420
383 Ga0451807_1487576
384 Ga0451853_2682339
385 Ga0466972_0404811
386 Ga0466957_0634163
387 Ga0495644_0051540
388 Ga0495587_0103766
389 Ga0495633_0045132
390 Ga0495667_0080186
391 Ga0495656_0476300
392 Ga0495659_0254307
393 Ga0495661_0049598
394 Ga0495669_0004140
395 Ga0495581_0277040
396 Ga0495674_0385307
397 Ga0495674_0467401
398 Ga0495672_0272451
399 Ga0495680_0046948
400 Ga0495683_0219943
401 Ga0496101_0193010
402 Ga0496101_0226293
403 Ga0496106_0127734
404 Ga0496107_0207706
405 Ga0496108_0134033
406 Ga0496111_0521311
407 Ga0501031_0061858
408 Ga0501032_0014122
409 Ga0501033_0097741
410 Ga0501034_0136119
411 Ga0501034_0453026
412 Ga0501036_0090845
413 Ga0501036_0325387
414 Ga0501036_0664590
415 Ga0501037_0012614
416 Ga0501038_0016045
417 Ga0501038_0118754
418 Ga0501038_0483810
419 Ga0501040_0445378
420 Ga0501042_0055991
421 Ga0501042_0187029
422 Ga0501043_0010467
423 Ga0501043_0022618
424 Ga0501043_0359822
425 Ga0501046_0029406
426 Ga0501046_0563094
427 Ga0501047_0010553
428 Ga0501047_0044044
429 Ga0501047_0127955
430 Ga0501047_0234558
431 Ga0501047_0365368
432 Ga0501047_0424931
433 Ga0501048_0013747
434 Ga0501067_0000128
435 Ga0501067_0087039
436 Ga0501068_0000598
437 Ga0501068_0001863
438 Ga0501068_0637657
439 Ga0501068_0862037
440 Ga0501069_0058925
441 Ga0501070_0117217
442 Ga0501071_0014705
443 Ga0501071_0592137
444 Ga0501072_0000697
445 Ga0501072_0029485
446 Ga0501072_0668262
447 Ga0501073_0000018
448 Ga0501073_0012939
449 Ga0501073_0862553
450 Ga0501074_0063524
451 Ga0501075_0442064
452 Ga0501076_0020342
453 Ga0501076_0143031
454 Ga0501077_0000277
455 Ga0501077_0024444
456 Ga0501077_0148030
457 Ga0501079_0009886
458 Ga0501080_0012795
459 Ga0501080_0035319
460 Ga0501080_0482492
461 Ga0501083_0257460
462 Ga0501083_1077721
463 Ga0501035_0122648
464 Ga0501035_0289624
465 Ga0501035_0326268
466 Ga0501044_0004058
467 Ga0501044_0039919
468 Ga0501044_0048533
469 Ga0501045_0014994
470 nmdc:mga05p37_110653_c1
471 nmdc:mga09592_297139_c1
472 nmdc:mga09592_575775_c1
473 nmdc:mga0qj67_149136_c1
474 nmdc:mga0qj67_410847_c1
475 nmdc:mga0qj67_945876_c1
476 nmdc:mga06r32_208391_c1
477 nmdc:mga06r32_796691_c1
478 nmdc:mga0n895_861378_c1
479 Ga0495601_0008155
480 Ga0495612_0081494
481 Ga0495595_0068702
482 Ga0495595_0100765
483 Ga0495619_0044855
484 Ga0495619_0056165
485 Ga0500562_038387
486 Ga0500616_0006079
487 Ga0500611_037613
488 Ga0501084_0031782
489 Ga0501082_0160053
490 Ga0530510_0025850
491 2513654499
492 2513692018
493 2513859301
494 2513915322
495 2517892623
496 2585153223
497 2585393728
498 2644288470
499 2644342904
500 2644366204
501 2644494439
502 2644509558
503 2671122274
504 2671587639
505 2728750533
506 2776262059
507 2793068544
508 2819540432
509 2819648504
510 2851155053
511 2874609800
512 2874631251
513 2881666289
514 2885382098
515 2885388258
516 2903759316
517 2904695975
518 2904702732
519 2906618377
520 2906632191
521 2908742953
522 2908760607
523 2922429722
524 2935633355
525 2935772565
526 2935783117
527 2935793381
528 2935799442
529 2939670913
530 2941510246
531 2941518017
532 2941526033
533 3005479973
534 8006972692
535 8006981780
536 8006997453
537 8016530164
538 8016535414
539 8016548616
540 8016553515
541 8016561898
542 8016573746
543 8016577871
544 8016599725
545 8016611117
546 8016622515
547 8016627270
548 8019535155
549 8019544329
550 8019554369
551 8019557034
552 8019568266
553 8056683238
554 8056690002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

6

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pgz-assembly1.cif.gz_A crystal structure of a single strand binding protein (ssb) from bartonella henselae 0.9739 2 115
3pgz-assembly1.cif.gz_B crystal structure of a single strand binding protein (ssb) from bartonella henselae 0.9678 2 115
3pgz-assembly1.cif.gz_A crystal structure of a single strand binding protein (ssb) from bartonella henselae 0.9652 2 115
3pgz-assembly1.cif.gz_B crystal structure of a single strand binding protein (ssb) from bartonella henselae 0.9595 2 115
6jdg-assembly1.cif.gz_A complexed crystal structure of passb with ssdna dt20 at 2.39 angstrom resolution 0.9515 4 114
ID Description Score Start End Superfamily
3lgjA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9451 2 115 2.40.50.140
3ulpC00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9342 1 115 2.40.50.140
3lgjA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9259 2 115 2.40.50.140
3ulpC00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.919 1 115 2.40.50.140
1eygD00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9124 1 117 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0F9C4Z3-F1-model_v4 Single-stranded DNA-binding protein 0.9659 1 112 GO:0003697
GO:0006260
GO:0009295
AF-A0A436A888-F1-model_v4 deleted 0.963 1 85
AF-A0A529NSL3-F1-model_v4 Single-stranded DNA-binding protein 0.9623 1 85 GO:0003697
GO:0006260
GO:0006310
GO:0009295
AF-J1KG79-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9622 5 88 GO:0003697
GO:0006260
GO:0006310
GO:0009295
AF-A0A7C5RVI8-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9613 5 114 GO:0003697
GO:0006260
GO:0009295

Map