F380761

General Info

Members Datasets Scaffolds Average Seq Length
275 203 550 194

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0099247|Ga0500622_0099247_537_1250
Length 237
Sequence MPLPGSSIAISMRCSKRPRRNAPRLEQEETMRFEKGHKAATRRHIIDVASKHFRRDGVSAAGIAGIMSEAGLTNGAFYPHFNSKDALVREVLASALADQQHSLDDERRAGLDLEGAIRRYLNPAHLRNAAEGCPSAALLPEIARQPQPTRRIYEEGLRRYVSTLAAFLPDAGSAASRRHAIAIFGLMVGTLQLARAVPDAAEAEQILEGGVEAALRLAKARSRGPADRRRQKPQARP

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
65 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
104 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
178 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
182 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
183 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
184 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
185 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
186 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
187 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
188 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
189 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
190 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
191 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
192 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
193 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
194 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
195 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
196 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
197 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
198 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
199 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
200 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
201 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
202 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
203 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.64
Metatranscriptomes 0
Isolates 8.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.82
Nodule 9.82
Rhizoplane 9.45
Rhizosphere 47.27
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0099247 3300053156 Bacteria 1436
2 JGI24735J21928_10019333 3300002067 Bacteria 2094
3 JGI25165J46597_1003127 3300003214 Plasmid 4418
4 JGI25153J46596_10002936 3300003215 Bacteria 9652
5 rootH1_10025037 3300003316 Bacteria 3691
6 rootH2_10153306 3300003320 Bacteria 2612
7 rootH2_10227951 3300003320 Bacteria 1763
8 rootH1_10061973 3300003323 Bacteria 6330
9 rootH1_10348772 3300003323 Bacteria 1148
10 Ga0055539_1004093 3300003752 Bacteria 1965
11 Ga0055532_1000166 3300003758 Bacteria 57297
12 Ga0055527_1000102 3300003760 Bacteria 62010
13 Ga0055535_1000208 3300003761 Bacteria 62010
14 Ga0055542_1000248 3300003762 Bacteria 62010
15 Ga0055529_1000267 3300003763 Bacteria 62010
16 Ga0068869_100161756 3300005334 Bacteria 1743
17 Ga0070682_100481092 3300005337 Bacteria 958
18 Ga0070668_100011646 3300005347 Bacteria 6546
19 Ga0070674_100081614 3300005356 Bacteria 2311
20 Ga0070659_101042826 3300005366 Bacteria 719
21 Ga0070711_100041308 3300005439 Bacteria 3114
22 Ga0070700_100815814 3300005441 Bacteria 753
23 Ga0070662_100257493 3300005457 Bacteria 1405
24 Ga0068867_100327485 3300005459 Bacteria 1271
25 Ga0068853_100694594 3300005539 Bacteria 970
26 Ga0070665_100030619 3300005548 Bacteria 5414
27 Ga0070665_100347737 3300005548 Bacteria 1488
28 Ga0068857_100114541 3300005577 Bacteria 2425
29 Ga0068854_100744198 3300005578 Bacteria 850
30 Ga0068852_100134551 3300005616 Bacteria 2281
31 Ga0068864_100439618 3300005618 Bacteria 1246
32 Ga0068866_10259693 3300005718 Bacteria 1067
33 Ga0068861_100384709 3300005719 Bacteria 1241
34 Ga0068863_100620680 3300005841 Bacteria 1071
35 Ga0068860_100461115 3300005843 Bacteria 1264
36 Ga0081540_1007181 3300005983 Bacteria 7992
37 Ga0081540_1022627 3300005983 Bacteria 3708
38 Ga0075365_10011891 3300006038 Bacteria 5139
39 Ga0075365_10017842 3300006038 Bacteria 4353
40 Ga0075365_10340920 3300006038 Bacteria 1056
41 Ga0070715_10136694 3300006163 Bacteria 1186
42 Ga0070712_100093591 3300006175 Bacteria 2206
43 Ga0075367_10008970 3300006178 Bacteria 5206
44 Ga0075367_10365475 3300006178 Bacteria 911
45 Ga0075369_10006084 3300006186 Bacteria 4549
46 Ga0075369_10013618 3300006186 Bacteria 3234
47 Ga0075366_10113461 3300006195 Bacteria 1631
48 Ga0068865_100146423 3300006881 Bacteria 1787
49 Ga0099824_1023049 3300006942 Bacteria 3954
50 Ga0099794_10017876 3300007265 Bacteria 3169
51 Ga0105240_10014501 3300009093 Bacteria 10760
52 Ga0105240_10590500 3300009093 Bacteria 1224
53 Ga0105245_10707484 3300009098 Bacteria 1041
54 Ga0105242_10093072 3300009176 Bacteria 2540
55 Ga0105237_10304668 3300009545 Bacteria 1596
56 Ga0105237_10602386 3300009545 Bacteria 1106
57 Ga0105238_10015732 3300009551 Bacteria 7660
58 Ga0105238_10553288 3300009551 Bacteria 1155
59 Ga0105249_10344445 3300009553 Bacteria 1508
60 Ga0105239_10944142 3300010375 Bacteria 990
61 Ga0105246_10256667 3300011119 Bacteria 1390
62 Ga0157370_10725235 3300013104 Bacteria 906
63 Ga0157369_10012060 3300013105 Bacteria 9816
64 Ga0157369_10086946 3300013105 Bacteria 3338
65 Ga0157374_10949529 3300013296 Bacteria 878
66 Ga0157378_10051944 3300013297 Bacteria 3647
67 Ga0163162_10000759 3300013306 Bacteria 30033
68 Ga0163162_10031142 3300013306 Bacteria 5289
69 Ga0157372_10476671 3300013307 Bacteria 1455
70 Ga0157375_10061918 3300013308 Bacteria 3717
71 Ga0157375_10692596 3300013308 Bacteria 1173
72 Ga0163163_11202338 3300014325 Unclassified 821
73 Ga0157380_10946699 3300014326 Bacteria 891
74 Ga0182008_10297648 3300014497 Bacteria 843
75 Ga0157379_10085002 3300014968 Bacteria 2835
76 Ga0157379_10227579 3300014968 Bacteria 1690
77 Ga0157379_10663266 3300014968 Bacteria 977
78 Ga0157379_11098362 3300014968 Bacteria 762
79 Ga0157376_10141076 3300014969 Bacteria 2162
80 Ga0163161_10089505 3300017792 Bacteria 2277
81 Ga0214544_1003520 3300021320 Bacteria 32265
82 Ga0214543_1007274 3300021327 Bacteria 19127
83 Ga0209672_100021 3300025228 Bacteria 428473
84 Ga0209147_100025 3300025229 Bacteria 428473
85 Ga0209563_102322 3300025230 Bacteria 4362
86 Ga0207427_101116 3300025231 Bacteria 10732
87 Ga0209258_100037 3300025242 Bacteria 428473
88 Ga0209677_103048 3300025253 Bacteria 5739
89 Ga0209677_113750 3300025253 Bacteria 1136
90 Ga0209148_1000049 3300025254 Bacteria 428473
91 Ga0209233_1000569 3300025261 Bacteria 19778
92 Ga0209455_1000041 3300025272 Bacteria 428473
93 Ga0209564_1005935 3300025295 Bacteria 6764
94 Ga0209758_1020669 3300025297 Bacteria 3102
95 Ga0207697_10129837 3300025315 Bacteria 1088
96 Ga0207692_10239760 3300025898 Bacteria 1082
97 Ga0207642_10117067 3300025899 Bacteria 1368
98 Ga0207647_10001985 3300025904 Bacteria 15642
99 Ga0207647_10088533 3300025904 Bacteria 1849
100 Ga0207695_10053279 3300025913 Bacteria 4232
101 Ga0207695_10867454 3300025913 Bacteria 782
102 Ga0207671_10231653 3300025914 Bacteria 1449
103 Ga0207693_10041943 3300025915 Bacteria 3601
104 Ga0207663_10439656 3300025916 Bacteria 1004
105 Ga0207694_10019466 3300025924 Bacteria 5131
106 Ga0207709_10143942 3300025935 Bacteria 1642
107 Ga0207704_10517635 3300025938 Bacteria 964
108 Ga0207661_10504349 3300025944 Bacteria 1106
109 Ga0207667_11308265 3300025949 Bacteria 701
110 Ga0207651_10578176 3300025960 Bacteria 980
111 Ga0207712_10042522 3300025961 Bacteria 3129
112 Ga0207668_10052912 3300025972 Bacteria 2811
113 Ga0207668_10457380 3300025972 Bacteria 1091
114 Ga0207640_10590385 3300025981 Bacteria 939
115 Ga0207658_10082422 3300025986 Bacteria 2470
116 Ga0207658_11172562 3300025986 Bacteria 702
117 Ga0207639_10657591 3300026041 Bacteria 970
118 Ga0207639_10934573 3300026041 Bacteria 811
119 Ga0207678_10003302 3300026067 Bacteria 14538
120 Ga0207678_11024184 3300026067 Bacteria 731
121 Ga0207702_10184451 3300026078 Bacteria 1924
122 Ga0207641_10264526 3300026088 Bacteria 1612
123 Ga0207648_10351475 3300026089 Bacteria 1329
124 Ga0207676_10248704 3300026095 Bacteria 1599
125 Ga0207674_10696328 3300026116 Bacteria 981
126 Ga0207675_100186397 3300026118 Bacteria 1989
127 Ga0209589_1019649 3300027357 Bacteria 6591
128 Ga0209489_109778 3300027361 Bacteria 11546
129 Ga0209588_1038424 3300027671 Bacteria 1542
130 Ga0268266_10206377 3300028379 Bacteria 1800
131 Ga0268266_10299878 3300028379 Bacteria 1499
132 Ga0268266_10555671 3300028379 Bacteria 1100
133 Ga0307513_10582643 3300031456 Bacteria 829
134 Ga0307408_100221154 3300031548 Bacteria 1545
135 Ga0307405_10379940 3300031731 Bacteria 1099
136 Ga0307406_10092571 3300031901 Bacteria 2039
137 Ga0307409_100138144 3300031995 Bacteria 2095
138 Ga0307409_100649045 3300031995 Bacteria 1049
139 Ga0307414_10246313 3300032004 Unclassified 1483
140 Ga0307510_10020561 3300033180 Bacteria 7711
141 Ga0315911_1000025 3300033442 Bacteria 93084
142 Ga0395899_0537506 3300037312 Bacteria 753
143 Ga0395900_0270129 3300037418 Bacteria 1695
144 Ga0395898_0014854 3300037466 Bacteria 7994
145 Ga0395905_0227829 3300037471 Bacteria 1743
146 Ga0439431_0026435 3300041997 Bacteria 1422
147 Ga0450906_001034 3300042145 Bacteria 6124
148 Ga0466957_0221562 3300044842 Bacteria 1249
149 Ga0451576_0268885 3300045051 Bacteria 1782
150 Ga0495590_0113767 3300046457 Bacteria 967
151 Ga0495650_0000064 3300046471 Bacteria 275412
152 Ga0495650_0014377 3300046471 Bacteria 4122
153 Ga0495580_0129136 3300046472 Bacteria 1753
154 Ga0495605_0132034 3300046474 Bacteria 1126
155 Ga0495620_0177880 3300046515 Bacteria 823
156 Ga0495632_0008386 3300046519 Bacteria 6348
157 Ga0495648_0104247 3300046524 Bacteria 1558
158 Ga0495654_0296022 3300046530 Bacteria 662
159 Ga0495668_0002995 3300046616 Bacteria 13190
160 Ga0495661_0138747 3300046665 Bacteria 1325
161 Ga0495588_0025037 3300046674 Bacteria 2970
162 Ga0495624_0017236 3300046690 Bacteria 4854
163 Ga0495649_0021650 3300046694 Bacteria 3601
164 Ga0495649_0259999 3300046694 Bacteria 890
165 Ga0495674_0001260 3300047319 Bacteria 24584
166 Ga0495674_0045805 3300047319 Bacteria 3884
167 Ga0495676_0002927 3300047321 Bacteria 15423
168 Ga0495687_036778 3300047443 Bacteria 2187
169 Ga0495687_114484 3300047443 Bacteria 984
170 Ga0495673_0052002 3300047469 Bacteria 1792
171 Ga0496100_0037708 3300048903 Bacteria 3058
172 Ga0496100_0069799 3300048903 Bacteria 2341
173 Ga0496100_0110576 3300048903 Bacteria 1908
174 Ga0496101_0010518 3300048904 Bacteria 6111
175 Ga0496101_0114431 3300048904 Bacteria 2034
176 Ga0496101_0417049 3300048904 Bacteria 1058
177 Ga0496102_0093320 3300048905 Bacteria 2788
178 Ga0496104_0007463 3300048907 Bacteria 9665
179 Ga0496104_0014678 3300048907 Bacteria 7076
180 Ga0496105_0024606 3300048908 Bacteria 4893
181 Ga0496105_0028315 3300048908 Bacteria 4582
182 Ga0496106_0032543 3300048909 Bacteria 3889
183 Ga0496106_0184819 3300048909 Bacteria 1656
184 Ga0496106_0508963 3300048909 Bacteria 967
185 Ga0496107_0039729 3300048910 Bacteria 3376
186 Ga0496107_0457549 3300048910 Bacteria 948
187 Ga0496109_0735082 3300048912 Bacteria 925
188 Ga0496110_0728544 3300048913 Bacteria 894
189 Ga0496111_0036760 3300048914 Bacteria 3503
190 Ga0496112_0009986 3300048915 Bacteria 8591
191 Ga0496112_0028722 3300048915 Bacteria 5372
192 Ga0496113_0003601 3300048916 Bacteria 9306
193 Ga0496113_0212678 3300048916 Bacteria 1540
194 Ga0496114_0336084 3300048917 Bacteria 1335
195 Ga0496115_0030972 3300048918 Bacteria 4213
196 Ga0496115_1084609 3300048918 Bacteria 608
197 Ga0496117_0087263 3300048920 Bacteria 2023
198 Ga0496118_0000260 3300048921 Bacteria 92249
199 Ga0496118_0108360 3300048921 Bacteria 1852
200 Ga0496118_0131293 3300048921 Bacteria 1608
201 Ga0496119_0027396 3300048922 Bacteria 3917
202 Ga0496119_0046200 3300048922 Bacteria 2722
203 Ga0496121_0001887 3300048924 Bacteria 33578
204 Ga0496121_0002728 3300048924 Bacteria 26312
205 Ga0496121_0004728 3300048924 Bacteria 17988
206 Ga0496121_0005812 3300048924 Bacteria 15639
207 Ga0496121_0064810 3300048924 Bacteria 2977
208 Ga0496121_0149751 3300048924 Bacteria 1719
209 Ga0496121_0454461 3300048924 Bacteria 824
210 Ga0496122_0043967 3300048925 Bacteria 3493
211 Ga0496122_0137279 3300048925 Bacteria 1538
212 Ga0496123_0018792 3300048926 Bacteria 5477
213 Ga0496123_0149955 3300048926 Bacteria 1260
214 Ga0496123_0190003 3300048926 Bacteria 1063
215 Ga0496124_0065998 3300048927 Bacteria 3016
216 Ga0496125_0002043 3300048928 Bacteria 27304
217 Ga0496126_0000320 3300048929 Bacteria 102586
218 Ga0496126_0001707 3300048929 Bacteria 32618
219 Ga0496126_0011839 3300048929 Bacteria 8976
220 Ga0496126_0014900 3300048929 Bacteria 7841
221 Ga0496126_0016596 3300048929 Bacteria 7360
222 Ga0496126_0019776 3300048929 Bacteria 6624
223 Ga0496126_0040871 3300048929 Bacteria 4296
224 Ga0496126_0064594 3300048929 Plasmid 3278
225 Ga0496126_0141160 3300048929 Bacteria 2073
226 Ga0496126_0240586 3300048929 Unclassified 1512
227 Ga0496126_0398307 3300048929 Bacteria 1117
228 Ga0496126_0417758 3300048929 Bacteria 1085
229 Ga0496126_0656938 3300048929 Bacteria 820
230 Ga0496126_0744458 3300048929 Bacteria 757
231 Ga0495678_001371 3300049459 Bacteria 19414
232 nmdc:mga0yw44_22093_c1 3300050492 Bacteria 3561
233 nmdc:mga0yw44_423970_c1 3300050492 Bacteria 901
234 nmdc:mga06z11_13898_c1 3300050494 Bacteria 3549
235 nmdc:mga06z11_37866_c1 3300050494 Bacteria 2391
236 nmdc:mga07m45_21648_c1 3300050496 Bacteria 3502
237 nmdc:mga0sz30_23797_c1 3300050516 Bacteria 2495
238 nmdc:mga0sz30_41016_c2 3300050516 Bacteria 1436
239 Ga0500578_0059329 3300053086 Bacteria 2445
240 Ga0500651_0032973 3300053093 Bacteria 3266
241 Ga0500566_0143718 3300053094 Bacteria 1263
242 Ga0500650_0000054 3300053098 Bacteria 37455
243 Ga0500594_0183155 3300053118 Bacteria 684
244 Ga0500595_028548 3300053119 Bacteria 1902
245 Ga0500614_012590 3300053123 Bacteria 1849
246 Ga0500642_0067819 3300053130 Bacteria 1617
247 Ga0500577_0038028 3300053142 Bacteria 1735
248 Ga0500588_0062799 3300053146 Bacteria 1196
249 Ga0500620_004905 3300053155 Bacteria 3041
250 Ga0500620_019375 3300053155 Bacteria 1999
251 Ga0500636_0000061 3300053177 Bacteria 52521
252 Ga0466962_0083643 3300061719 Bacteria 1527
253 2509142553 2508501127 Bacteria 7037543
254 2513611846 2513237090 Bacteria 7096802
255 2513680105 2513237098 Bacteria 9902361
256 2515630207 2515154112 Bacteria 8294334
257 2692318433 2690316117 Bacteria 6800650
258 2841738751 2841734538 Bacteria 6784580
259 2841942988 2841941048 Bacteria 8688029
260 2847423065 2847417321 Bacteria 6913799
261 2871476745 2871474448 Bacteria 6806570
262 2874126564 2874123672 Bacteria 7238285
263 2878793234 2878788777 Bacteria 6567085
264 2924759217 2924754689 Bacteria 6774424
265 2937839693 2937836603 Bacteria 6811263
266 2958071644 2958071322 Bacteria 6815895
267 2970528193 2970524798 Bacteria 6840927
268 8004403137 8004395343 Bacteria 6620908
269 8004639762 8004633249 Bacteria 6723080
270 8019621483 8019619141 Bacteria 9218857
271 8019636565 8019629233 Bacteria 8687553
272 8019643061 8019638758 Bacteria 9062356
273 8019673946 8019668869 Bacteria 8791617
274 8019682181 8019678201 Bacteria 8863603
275 8055620324 8055617313 Bacteria 7548464
276 Ga0500622_0099247
277 JGI24735J21928_10019333
278 JGI25165J46597_1003127
279 JGI25153J46596_10002936
280 rootH1_10025037
281 rootH2_10153306
282 rootH2_10227951
283 rootH1_10061973
284 rootH1_10348772
285 Ga0055539_1004093
286 Ga0055532_1000166
287 Ga0055527_1000102
288 Ga0055535_1000208
289 Ga0055542_1000248
290 Ga0055529_1000267
291 Ga0068869_100161756
292 Ga0070682_100481092
293 Ga0070668_100011646
294 Ga0070674_100081614
295 Ga0070659_101042826
296 Ga0070711_100041308
297 Ga0070700_100815814
298 Ga0070662_100257493
299 Ga0068867_100327485
300 Ga0068853_100694594
301 Ga0070665_100030619
302 Ga0070665_100347737
303 Ga0068857_100114541
304 Ga0068854_100744198
305 Ga0068852_100134551
306 Ga0068864_100439618
307 Ga0068866_10259693
308 Ga0068861_100384709
309 Ga0068863_100620680
310 Ga0068860_100461115
311 Ga0081540_1007181
312 Ga0081540_1022627
313 Ga0075365_10011891
314 Ga0075365_10017842
315 Ga0075365_10340920
316 Ga0070715_10136694
317 Ga0070712_100093591
318 Ga0075367_10008970
319 Ga0075367_10365475
320 Ga0075369_10006084
321 Ga0075369_10013618
322 Ga0075366_10113461
323 Ga0068865_100146423
324 Ga0099824_1023049
325 Ga0099794_10017876
326 Ga0105240_10014501
327 Ga0105240_10590500
328 Ga0105245_10707484
329 Ga0105242_10093072
330 Ga0105237_10304668
331 Ga0105237_10602386
332 Ga0105238_10015732
333 Ga0105238_10553288
334 Ga0105249_10344445
335 Ga0105239_10944142
336 Ga0105246_10256667
337 Ga0157370_10725235
338 Ga0157369_10012060
339 Ga0157369_10086946
340 Ga0157374_10949529
341 Ga0157378_10051944
342 Ga0163162_10000759
343 Ga0163162_10031142
344 Ga0157372_10476671
345 Ga0157375_10061918
346 Ga0157375_10692596
347 Ga0163163_11202338
348 Ga0157380_10946699
349 Ga0182008_10297648
350 Ga0157379_10085002
351 Ga0157379_10227579
352 Ga0157379_10663266
353 Ga0157379_11098362
354 Ga0157376_10141076
355 Ga0163161_10089505
356 Ga0214544_1003520
357 Ga0214543_1007274
358 Ga0209672_100021
359 Ga0209147_100025
360 Ga0209563_102322
361 Ga0207427_101116
362 Ga0209258_100037
363 Ga0209677_103048
364 Ga0209677_113750
365 Ga0209148_1000049
366 Ga0209233_1000569
367 Ga0209455_1000041
368 Ga0209564_1005935
369 Ga0209758_1020669
370 Ga0207697_10129837
371 Ga0207692_10239760
372 Ga0207642_10117067
373 Ga0207647_10001985
374 Ga0207647_10088533
375 Ga0207695_10053279
376 Ga0207695_10867454
377 Ga0207671_10231653
378 Ga0207693_10041943
379 Ga0207663_10439656
380 Ga0207694_10019466
381 Ga0207709_10143942
382 Ga0207704_10517635
383 Ga0207661_10504349
384 Ga0207667_11308265
385 Ga0207651_10578176
386 Ga0207712_10042522
387 Ga0207668_10052912
388 Ga0207668_10457380
389 Ga0207640_10590385
390 Ga0207658_10082422
391 Ga0207658_11172562
392 Ga0207639_10657591
393 Ga0207639_10934573
394 Ga0207678_10003302
395 Ga0207678_11024184
396 Ga0207702_10184451
397 Ga0207641_10264526
398 Ga0207648_10351475
399 Ga0207676_10248704
400 Ga0207674_10696328
401 Ga0207675_100186397
402 Ga0209589_1019649
403 Ga0209489_109778
404 Ga0209588_1038424
405 Ga0268266_10206377
406 Ga0268266_10299878
407 Ga0268266_10555671
408 Ga0307513_10582643
409 Ga0307408_100221154
410 Ga0307405_10379940
411 Ga0307406_10092571
412 Ga0307409_100138144
413 Ga0307409_100649045
414 Ga0307414_10246313
415 Ga0307510_10020561
416 Ga0315911_1000025
417 Ga0395899_0537506
418 Ga0395900_0270129
419 Ga0395898_0014854
420 Ga0395905_0227829
421 Ga0439431_0026435
422 Ga0450906_001034
423 Ga0466957_0221562
424 Ga0451576_0268885
425 Ga0495590_0113767
426 Ga0495650_0000064
427 Ga0495650_0014377
428 Ga0495580_0129136
429 Ga0495605_0132034
430 Ga0495620_0177880
431 Ga0495632_0008386
432 Ga0495648_0104247
433 Ga0495654_0296022
434 Ga0495668_0002995
435 Ga0495661_0138747
436 Ga0495588_0025037
437 Ga0495624_0017236
438 Ga0495649_0021650
439 Ga0495649_0259999
440 Ga0495674_0001260
441 Ga0495674_0045805
442 Ga0495676_0002927
443 Ga0495687_036778
444 Ga0495687_114484
445 Ga0495673_0052002
446 Ga0496100_0037708
447 Ga0496100_0069799
448 Ga0496100_0110576
449 Ga0496101_0010518
450 Ga0496101_0114431
451 Ga0496101_0417049
452 Ga0496102_0093320
453 Ga0496104_0007463
454 Ga0496104_0014678
455 Ga0496105_0024606
456 Ga0496105_0028315
457 Ga0496106_0032543
458 Ga0496106_0184819
459 Ga0496106_0508963
460 Ga0496107_0039729
461 Ga0496107_0457549
462 Ga0496109_0735082
463 Ga0496110_0728544
464 Ga0496111_0036760
465 Ga0496112_0009986
466 Ga0496112_0028722
467 Ga0496113_0003601
468 Ga0496113_0212678
469 Ga0496114_0336084
470 Ga0496115_0030972
471 Ga0496115_1084609
472 Ga0496117_0087263
473 Ga0496118_0000260
474 Ga0496118_0108360
475 Ga0496118_0131293
476 Ga0496119_0027396
477 Ga0496119_0046200
478 Ga0496121_0001887
479 Ga0496121_0002728
480 Ga0496121_0004728
481 Ga0496121_0005812
482 Ga0496121_0064810
483 Ga0496121_0149751
484 Ga0496121_0454461
485 Ga0496122_0043967
486 Ga0496122_0137279
487 Ga0496123_0018792
488 Ga0496123_0149955
489 Ga0496123_0190003
490 Ga0496124_0065998
491 Ga0496125_0002043
492 Ga0496126_0000320
493 Ga0496126_0001707
494 Ga0496126_0011839
495 Ga0496126_0014900
496 Ga0496126_0016596
497 Ga0496126_0019776
498 Ga0496126_0040871
499 Ga0496126_0064594
500 Ga0496126_0141160
501 Ga0496126_0240586
502 Ga0496126_0398307
503 Ga0496126_0417758
504 Ga0496126_0656938
505 Ga0496126_0744458
506 Ga0495678_001371
507 nmdc:mga0yw44_22093_c1
508 nmdc:mga0yw44_423970_c1
509 nmdc:mga06z11_13898_c1
510 nmdc:mga06z11_37866_c1
511 nmdc:mga07m45_21648_c1
512 nmdc:mga0sz30_23797_c1
513 nmdc:mga0sz30_41016_c2
514 Ga0500578_0059329
515 Ga0500651_0032973
516 Ga0500566_0143718
517 Ga0500650_0000054
518 Ga0500594_0183155
519 Ga0500595_028548
520 Ga0500614_012590
521 Ga0500642_0067819
522 Ga0500577_0038028
523 Ga0500588_0062799
524 Ga0500620_004905
525 Ga0500620_019375
526 Ga0500636_0000061
527 Ga0466962_0083643
528 2509142553
529 2513611846
530 2513680105
531 2515630207
532 2692318433
533 2841738751
534 2841942988
535 2847423065
536 2871476745
537 2874126564
538 2878793234
539 2924759217
540 2937839693
541 2958071644
542 2970528193
543 8004403137
544 8004639762
545 8019621483
546 8019636565
547 8019643061
548 8019673946
549 8019682181
550 8055620324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

45

91

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.8715 7 184
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8591 8 187
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.8489 7 184
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8387 11 93
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8251 8 183
ID Description Score Start End Superfamily
2fd5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9767 7 51 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9719 10 53 1.10.10.60
3mvpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9681 7 51 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9678 11 53 1.10.10.60
5gpcA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9664 11 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7X6FLZ0-F1-model_v4 AcrR family transcriptional regulator 0.9791 1 191 GO:0003677
GO:0006355
AF-A0A534YRQ5-F1-model_v4 TetR family transcriptional regulator 0.9742 5 186 GO:0003677
GO:0006355
AF-A0A7X6FLZ0-F1-model_v4 AcrR family transcriptional regulator 0.974 1 191 GO:0003677
GO:0006355
AF-A0A5F2I1C9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9707 1 188 GO:0003677
GO:0006355
AF-A0A345P345-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9689 8 185 GO:0003677
GO:0006355

Map