F380576

General Info

Members Datasets Scaffolds Average Seq Length
275 211 550 114

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0594649|Ga0436363_0594649_23_421
Length 132
Sequence VFEIIAEPNRRAILGLLVSSQQSVGDIERQLRMPQPTVSKHLRVLREAGFVESMVDAQRRLYRLKPEPLQEVDDWLAPFRRFWSAHVDALERHLDRIHDPFKPRTTGAKRPVRSSTGTKRKKQKTARPKPQT

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
148 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
168 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
169 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
170 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
171 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
172 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
173 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
176 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
177 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
178 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
179 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
182 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
183 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
184 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
185 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
188 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
191 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
192 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
197 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
198 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
204 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
210 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 2.55
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 8.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0594649 3300039450 Bacteria 536
2 MBSR1b_contig_11415314 2162886012 Unclassified 1022
3 MBSR1b_contig_5834115 2162886012 Unclassified 865
4 Ga0058862_12523854 3300004803 Bacteria 810
5 Ga0070658_10570570 3300005327 Bacteria 980
6 Ga0070676_10001467 3300005328 Bacteria 11937
7 Ga0070683_101695394 3300005329 Bacteria 608
8 Ga0068869_100528697 3300005334 Bacteria 988
9 Ga0070666_10871841 3300005335 Bacteria 665
10 Ga0068868_100950466 3300005338 Unclassified 784
11 Ga0070660_100157697 3300005339 Bacteria 1828
12 Ga0070691_10008839 3300005341 Bacteria 4612
13 Ga0070669_100111329 3300005353 Bacteria 2078
14 Ga0070671_100004627 3300005355 Bacteria 10909
15 Ga0070671_100253471 3300005355 Bacteria 1495
16 Ga0070674_100116418 3300005356 Bacteria 1972
17 Ga0070673_100017713 3300005364 Bacteria 5074
18 Ga0070673_100097955 3300005364 Bacteria 2409
19 Ga0070667_100000129 3300005367 Bacteria 95291
20 Ga0070667_100132566 3300005367 Bacteria 2176
21 Ga0070667_100863349 3300005367 Bacteria 842
22 Ga0070667_101413994 3300005367 Bacteria 653
23 Ga0070714_100050771 3300005435 Bacteria 3535
24 Ga0070714_100178359 3300005435 Bacteria 1932
25 Ga0070701_10010640 3300005438 Bacteria 4078
26 Ga0070705_100010543 3300005440 Bacteria 4631
27 Ga0070700_100001944 3300005441 Bacteria 10474
28 Ga0070694_100014427 3300005444 Bacteria 4946
29 Ga0070708_100382799 3300005445 Bacteria 1326
30 Ga0070678_100258551 3300005456 Bacteria 1463
31 Ga0070662_100293266 3300005457 Bacteria 1319
32 Ga0070681_10686989 3300005458 Bacteria 939
33 Ga0068867_100038919 3300005459 Bacteria 3464
34 Ga0068867_100219049 3300005459 Bacteria 1533
35 Ga0068867_100931570 3300005459 Bacteria 784
36 Ga0070679_100100143 3300005530 Unclassified 2885
37 Ga0070679_100493140 3300005530 Unclassified 1169
38 Ga0070684_100000013 3300005535 Bacteria 167281
39 Ga0070697_100028934 3300005536 Bacteria 4440
40 Ga0070697_100107119 3300005536 Bacteria 2326
41 Ga0070672_100832197 3300005543 Unclassified 813
42 Ga0070695_100005501 3300005545 Bacteria 7462
43 Ga0070696_100004289 3300005546 Bacteria 9501
44 Ga0068855_100011368 3300005563 Bacteria 10747
45 Ga0068855_100027700 3300005563 Bacteria 6779
46 Ga0068854_100100965 3300005578 Bacteria 2163
47 Ga0068856_100812954 3300005614 Bacteria 954
48 Ga0068856_101429083 3300005614 Unclassified 706
49 Ga0070702_100001633 3300005615 Bacteria 9285
50 Ga0068852_100057493 3300005616 Bacteria 3366
51 Ga0068852_100875295 3300005616 Unclassified 915
52 Ga0068866_10074400 3300005718 Bacteria 1806
53 Ga0068861_100003061 3300005719 Bacteria 11043
54 Ga0068863_100020528 3300005841 Bacteria 6315
55 Ga0068863_101123432 3300005841 Bacteria 791
56 Ga0068863_101192748 3300005841 Bacteria 767
57 Ga0068858_100089249 3300005842 Bacteria 2868
58 Ga0068860_100074408 3300005843 Bacteria 3230
59 Ga0070716_100519523 3300006173 Bacteria 882
60 Ga0097621_100140740 3300006237 Bacteria 2061
61 Ga0068871_100004515 3300006358 Bacteria 9697
62 Ga0075433_10251937 3300006852 Unclassified 1566
63 Ga0075433_10912406 3300006852 Bacteria 766
64 Ga0075434_100009621 3300006871 Bacteria 9027
65 Ga0075429_100695349 3300006880 Bacteria 891
66 Ga0068865_100001754 3300006881 Bacteria 12723
67 Ga0075435_100828765 3300007076 Bacteria 806
68 Ga0099795_10011947 3300007788 Bacteria 2616
69 Ga0099795_10210440 3300007788 Bacteria 824
70 Ga0105240_10148808 3300009093 Bacteria 2791
71 Ga0105240_10783665 3300009093 Bacteria 1034
72 Ga0105240_11339302 3300009093 Bacteria 754
73 Ga0105245_10964824 3300009098 Bacteria 896
74 Ga0105245_11969752 3300009098 Bacteria 637
75 Ga0105247_10002912 3300009101 Bacteria 11391
76 Ga0105247_10327325 3300009101 Bacteria 1071
77 Ga0114129_11595433 3300009147 Bacteria 799
78 Ga0105243_10064032 3300009148 Bacteria 2949
79 Ga0105243_10491765 3300009148 Bacteria 1160
80 Ga0105243_11394737 3300009148 Bacteria 721
81 Ga0105242_10095366 3300009176 Bacteria 2511
82 Ga0105242_11484372 3300009176 Bacteria 708
83 Ga0105248_10053715 3300009177 Bacteria 4520
84 Ga0105248_10096266 3300009177 Bacteria 3334
85 Ga0105248_10176640 3300009177 Bacteria 2406
86 Ga0105248_12372882 3300009177 Unclassified 604
87 Ga0105238_10067874 3300009551 Bacteria 3567
88 Ga0105249_10006669 3300009553 Bacteria 10052
89 Ga0105249_10463570 3300009553 Bacteria 1307
90 Ga0099796_10042830 3300010159 Bacteria 1540
91 Ga0105246_12442501 3300011119 Bacteria 513
92 Ga0157370_10361977 3300013104 Bacteria 1337
93 Ga0157369_10324980 3300013105 Bacteria 1599
94 Ga0157374_10728562 3300013296 Bacteria 1006
95 Ga0157378_10177352 3300013297 Bacteria 2002
96 Ga0157378_10445056 3300013297 Bacteria 1285
97 Ga0157378_11677774 3300013297 Bacteria 682
98 Ga0163162_10185132 3300013306 Bacteria 2209
99 Ga0163162_10651111 3300013306 Bacteria 1177
100 Ga0157372_10054604 3300013307 Bacteria 4457
101 Ga0157372_11722749 3300013307 Bacteria 721
102 Ga0157375_10266173 3300013308 Bacteria 1876
103 Ga0163163_10000025 3300014325 Bacteria 182686
104 Ga0163163_10066886 3300014325 Bacteria 3571
105 Ga0163163_10109779 3300014325 Bacteria 2786
106 Ga0157380_11590338 3300014326 Bacteria 709
107 Ga0157377_10729225 3300014745 Unclassified 723
108 Ga0157379_10011151 3300014968 Bacteria 7835
109 Ga0157379_10248132 3300014968 Bacteria 1616
110 Ga0157379_10785229 3300014968 Bacteria 898
111 Ga0157376_10063664 3300014969 Bacteria 3108
112 Ga0157376_10812734 3300014969 Bacteria 948
113 Ga0163161_10209900 3300017792 Unclassified 1504
114 Ga0163161_10432347 3300017792 Bacteria 1061
115 Ga0213875_10298266 3300021388 Unclassified 762
116 Ga0207642_10418707 3300025899 Bacteria 805
117 Ga0207710_10112747 3300025900 Bacteria 1292
118 Ga0207680_10016026 3300025903 Bacteria 3925
119 Ga0207680_10533577 3300025903 Bacteria 837
120 Ga0207645_10005656 3300025907 Bacteria 9031
121 Ga0207705_10056528 3300025909 Bacteria 2829
122 Ga0207707_10248274 3300025912 Bacteria 1546
123 Ga0207693_11401128 3300025915 Bacteria 519
124 Ga0207662_10838298 3300025918 Bacteria 649
125 Ga0207657_10436605 3300025919 Unclassified 1028
126 Ga0207652_10150777 3300025921 Bacteria 2082
127 Ga0207652_10882135 3300025921 Bacteria 791
128 Ga0207681_10224373 3300025923 Bacteria 1455
129 Ga0207694_10197542 3300025924 Bacteria 1636
130 Ga0207650_10255176 3300025925 Bacteria 1421
131 Ga0207664_10066610 3300025929 Unclassified 2887
132 Ga0207644_10023851 3300025931 Bacteria 4195
133 Ga0207644_10937777 3300025931 Bacteria 726
134 Ga0207686_10221487 3300025934 Bacteria 1366
135 Ga0207709_10133283 3300025935 Bacteria 1696
136 Ga0207669_10461386 3300025937 Bacteria 1009
137 Ga0207704_10045695 3300025938 Bacteria 2603
138 Ga0207704_11441940 3300025938 Bacteria 590
139 Ga0207711_10057494 3300025941 Bacteria 3344
140 Ga0207711_10297817 3300025941 Bacteria 1487
141 Ga0207711_10573366 3300025941 Bacteria 1053
142 Ga0207711_11500592 3300025941 Bacteria 617
143 Ga0207689_10393536 3300025942 Bacteria 1155
144 Ga0207667_10063340 3300025949 Bacteria 3863
145 Ga0207667_10342472 3300025949 Bacteria 1526
146 Ga0207651_10073034 3300025960 Bacteria 2438
147 Ga0207651_10394581 3300025960 Bacteria 1176
148 Ga0207651_10646104 3300025960 Bacteria 928
149 Ga0207712_10009352 3300025961 Bacteria 6200
150 Ga0207712_10677225 3300025961 Bacteria 898
151 Ga0207668_10550159 3300025972 Bacteria 1000
152 Ga0207640_10542796 3300025981 Bacteria 975
153 Ga0207658_10000126 3300025986 Bacteria 83451
154 Ga0207677_10249528 3300026023 Bacteria 1441
155 Ga0207703_10031220 3300026035 Bacteria 4211
156 Ga0207678_10317670 3300026067 Bacteria 1340
157 Ga0207708_10006637 3300026075 Bacteria 8566
158 Ga0207702_10694653 3300026078 Bacteria 1002
159 Ga0207702_11624338 3300026078 Bacteria 640
160 Ga0207702_11700486 3300026078 Unclassified 624
161 Ga0207641_10079647 3300026088 Bacteria 2840
162 Ga0207641_10191557 3300026088 Bacteria 1880
163 Ga0207648_10002220 3300026089 Bacteria 21052
164 Ga0207648_10172419 3300026089 Bacteria 1913
165 Ga0207648_10237952 3300026089 Bacteria 1620
166 Ga0207648_10458639 3300026089 Bacteria 1161
167 Ga0207675_100000371 3300026118 Bacteria 43068
168 Ga0207683_10876995 3300026121 Bacteria 833
169 Ga0207698_10244721 3300026142 Bacteria 1637
170 Ga0207698_10257976 3300026142 Unclassified 1600
171 Ga0207698_10384480 3300026142 Bacteria 1336
172 Ga0209179_1056746 3300027512 Unclassified 846
173 Ga0268266_10070048 3300028379 Bacteria 3040
174 Ga0268264_10062935 3300028381 Bacteria 3117
175 Ga0307513_10007080 3300031456 Bacteria 14580
176 Ga0307408_100148296 3300031548 Bacteria 1849
177 Ga0307508_10073164 3300031616 Bacteria 3003
178 Ga0307405_10018831 3300031731 Bacteria 3818
179 Ga0307410_10132607 3300031852 Bacteria 1832
180 Ga0307406_10017722 3300031901 Bacteria 4151
181 Ga0307407_10025970 3300031903 Bacteria 3096
182 Ga0307412_10383816 3300031911 Bacteria 1138
183 Ga0307409_100015935 3300031995 Bacteria 4953
184 Ga0307416_100120759 3300032002 Bacteria 2334
185 Ga0307414_10399606 3300032004 Bacteria 1193
186 Ga0373941_0055085 3300035115 Bacteria 1277
187 Ga0373941_0128300 3300035115 Bacteria 911
188 Ga0373954_0033172 3300035118 Bacteria 2389
189 Ga0373956_0022605 3300035119 Bacteria 2692
190 Ga0373943_0105136 3300035170 Bacteria 1482
191 Ga0373943_0268256 3300035170 Bacteria 962
192 Ga0373955_0010680 3300035172 Bacteria 4347
193 Ga0373931_1301166 3300035691 Bacteria 500
194 Ga0373935_0678957 3300035692 Bacteria 757
195 Ga0373933_0005592 3300035724 Bacteria 6848
196 Ga0373937_0020221 3300036401 Bacteria 5967
197 Ga0395898_0969311 3300037466 Bacteria 787
198 Ga0436364_1217329 3300037853 Unclassified 906
199 Ga0395901_1223460 3300038443 Unclassified 716
200 Ga0242420_069454 3300038996 Bacteria 714
201 Ga0436365_1255419 3300039437 Bacteria 1408
202 Ga0436363_0291787 3300039450 Bacteria 817
203 Ga0451807_1526745 3300041486 Bacteria 635
204 Ga0439433_0024960 3300041999 Bacteria 1348
205 Ga0439449_0051229 3300042007 Bacteria 1527
206 Ga0439446_0016419 3300042156 Unclassified 2062
207 Ga0439435_0025605 3300042436 Bacteria 1565
208 Ga0439444_0004663 3300042437 Bacteria 2003
209 Ga0450893_0022880 3300042532 Bacteria 1084
210 Ga0451577_0333865 3300042876 Bacteria 1375
211 Ga0453683_0311479 3300044673 Bacteria 1008
212 Ga0466959_0941441 3300045049 Unclassified 576
213 Ga0451576_1246480 3300045051 Bacteria 776
214 Ga0495641_0098326 3300046461 Bacteria 1306
215 Ga0495586_0116891 3300046535 Bacteria 1488
216 Ga0495667_1024053 3300046559 Bacteria 503
217 Ga0495635_0324502 3300046663 Bacteria 1030
218 Ga0495581_0419823 3300047315 Bacteria 780
219 Ga0495680_0379823 3300047322 Bacteria 979
220 Ga0496102_0124711 3300048905 Bacteria 2407
221 Ga0496102_0283437 3300048905 Bacteria 1562
222 Ga0496110_1841314 3300048913 Bacteria 515
223 Ga0496112_0180856 3300048915 Bacteria 2073
224 Ga0496112_0378588 3300048915 Bacteria 1356
225 Ga0496114_0155601 3300048917 Bacteria 1985
226 Ga0496121_0039228 3300048924 Bacteria 4178
227 Ga0496125_0046008 3300048928 Bacteria 3666
228 Ga0501298_044146 3300049521 Bacteria 910
229 Ga0501299_006373 3300049522 Bacteria 1850
230 Ga0501202_001342 3300049652 Bacteria 3919
231 Ga0501207_000349 3300049654 Bacteria 4989
232 Ga0501216_005177 3300049660 Bacteria 1955
233 Ga0501217_003466 3300049661 Bacteria 3186
234 Ga0501227_090695 3300049665 Bacteria 807
235 Ga0501228_012828 3300049666 Bacteria 866
236 Ga0501230_007794 3300049667 Bacteria 1599
237 Ga0501235_000580 3300049669 Bacteria 7358
238 Ga0501236_012041 3300049670 Bacteria 1159
239 Ga0501239_001170 3300049672 Bacteria 2210
240 Ga0501242_000413 3300049674 Bacteria 3662
241 Ga0501243_001182 3300049675 Bacteria 3727
242 Ga0501247_004684 3300049677 Bacteria 1505
243 Ga0501249_004894 3300049679 Bacteria 2732
244 Ga0501252_008845 3300049682 Bacteria 1164
245 Ga0501253_001237 3300049683 Bacteria 2539
246 Ga0501257_018405 3300049686 Bacteria 1629
247 Ga0501258_009328 3300049687 Bacteria 1023
248 Ga0501261_002241 3300049690 Bacteria 2374
249 Ga0501221_001803 3300049704 Bacteria 3578
250 Ga0501234_002288 3300049707 Bacteria 3023
251 Ga0501245_049830 3300049708 Bacteria 740
252 Ga0501083_0201998 3300049744 Bacteria 1296
253 Ga0501241_025312 3300049758 Bacteria 1105
254 Ga0501265_012654 3300049762 Bacteria 1054
255 Ga0501266_001622 3300049763 Bacteria 2866
256 Ga0501268_000157 3300049765 Bacteria 6188
257 Ga0501270_025478 3300049767 Bacteria 937
258 Ga0501272_000523 3300049769 Bacteria 3414
259 Ga0501274_008335 3300049771 Bacteria 928
260 Ga0501279_047434 3300049775 Bacteria 673
261 Ga0501212_085009 3300049851 Bacteria 577
262 nmdc:mga0n895_12675_c1 3300050512 Bacteria 7569
263 nmdc:mga0rr50_19234_c1 3300050513 Bacteria 4604
264 nmdc:mga0rr50_55090_c1 3300050513 Unclassified 2965
265 nmdc:mga0a205_1077653_c1 3300050515 Bacteria 651
266 Ga0495619_0869811 3300053085 Bacteria 607
267 Ga0500640_000888 3300053095 Bacteria 8330
268 Ga0500554_002554 3300053102 Bacteria 3595
269 Ga0500572_004787 3300053111 Bacteria 3068
270 Ga0500595_000263 3300053119 Bacteria 34751
271 Ga0500614_001098 3300053123 Bacteria 6683
272 Ga0500559_0007848 3300053136 Bacteria 4714
273 Ga0500637_0624881 3300053178 Bacteria 505
274 Ga0500601_009003 3300053737 Bacteria 1112
275 Ga0501082_1522686 3300060353 Unclassified 584
276 Ga0436363_0594649
277 MBSR1b_contig_11415314
278 MBSR1b_contig_5834115
279 Ga0058862_12523854
280 Ga0070658_10570570
281 Ga0070676_10001467
282 Ga0070683_101695394
283 Ga0068869_100528697
284 Ga0070666_10871841
285 Ga0068868_100950466
286 Ga0070660_100157697
287 Ga0070691_10008839
288 Ga0070669_100111329
289 Ga0070671_100004627
290 Ga0070671_100253471
291 Ga0070674_100116418
292 Ga0070673_100017713
293 Ga0070673_100097955
294 Ga0070667_100000129
295 Ga0070667_100132566
296 Ga0070667_100863349
297 Ga0070667_101413994
298 Ga0070714_100050771
299 Ga0070714_100178359
300 Ga0070701_10010640
301 Ga0070705_100010543
302 Ga0070700_100001944
303 Ga0070694_100014427
304 Ga0070708_100382799
305 Ga0070678_100258551
306 Ga0070662_100293266
307 Ga0070681_10686989
308 Ga0068867_100038919
309 Ga0068867_100219049
310 Ga0068867_100931570
311 Ga0070679_100100143
312 Ga0070679_100493140
313 Ga0070684_100000013
314 Ga0070697_100028934
315 Ga0070697_100107119
316 Ga0070672_100832197
317 Ga0070695_100005501
318 Ga0070696_100004289
319 Ga0068855_100011368
320 Ga0068855_100027700
321 Ga0068854_100100965
322 Ga0068856_100812954
323 Ga0068856_101429083
324 Ga0070702_100001633
325 Ga0068852_100057493
326 Ga0068852_100875295
327 Ga0068866_10074400
328 Ga0068861_100003061
329 Ga0068863_100020528
330 Ga0068863_101123432
331 Ga0068863_101192748
332 Ga0068858_100089249
333 Ga0068860_100074408
334 Ga0070716_100519523
335 Ga0097621_100140740
336 Ga0068871_100004515
337 Ga0075433_10251937
338 Ga0075433_10912406
339 Ga0075434_100009621
340 Ga0075429_100695349
341 Ga0068865_100001754
342 Ga0075435_100828765
343 Ga0099795_10011947
344 Ga0099795_10210440
345 Ga0105240_10148808
346 Ga0105240_10783665
347 Ga0105240_11339302
348 Ga0105245_10964824
349 Ga0105245_11969752
350 Ga0105247_10002912
351 Ga0105247_10327325
352 Ga0114129_11595433
353 Ga0105243_10064032
354 Ga0105243_10491765
355 Ga0105243_11394737
356 Ga0105242_10095366
357 Ga0105242_11484372
358 Ga0105248_10053715
359 Ga0105248_10096266
360 Ga0105248_10176640
361 Ga0105248_12372882
362 Ga0105238_10067874
363 Ga0105249_10006669
364 Ga0105249_10463570
365 Ga0099796_10042830
366 Ga0105246_12442501
367 Ga0157370_10361977
368 Ga0157369_10324980
369 Ga0157374_10728562
370 Ga0157378_10177352
371 Ga0157378_10445056
372 Ga0157378_11677774
373 Ga0163162_10185132
374 Ga0163162_10651111
375 Ga0157372_10054604
376 Ga0157372_11722749
377 Ga0157375_10266173
378 Ga0163163_10000025
379 Ga0163163_10066886
380 Ga0163163_10109779
381 Ga0157380_11590338
382 Ga0157377_10729225
383 Ga0157379_10011151
384 Ga0157379_10248132
385 Ga0157379_10785229
386 Ga0157376_10063664
387 Ga0157376_10812734
388 Ga0163161_10209900
389 Ga0163161_10432347
390 Ga0213875_10298266
391 Ga0207642_10418707
392 Ga0207710_10112747
393 Ga0207680_10016026
394 Ga0207680_10533577
395 Ga0207645_10005656
396 Ga0207705_10056528
397 Ga0207707_10248274
398 Ga0207693_11401128
399 Ga0207662_10838298
400 Ga0207657_10436605
401 Ga0207652_10150777
402 Ga0207652_10882135
403 Ga0207681_10224373
404 Ga0207694_10197542
405 Ga0207650_10255176
406 Ga0207664_10066610
407 Ga0207644_10023851
408 Ga0207644_10937777
409 Ga0207686_10221487
410 Ga0207709_10133283
411 Ga0207669_10461386
412 Ga0207704_10045695
413 Ga0207704_11441940
414 Ga0207711_10057494
415 Ga0207711_10297817
416 Ga0207711_10573366
417 Ga0207711_11500592
418 Ga0207689_10393536
419 Ga0207667_10063340
420 Ga0207667_10342472
421 Ga0207651_10073034
422 Ga0207651_10394581
423 Ga0207651_10646104
424 Ga0207712_10009352
425 Ga0207712_10677225
426 Ga0207668_10550159
427 Ga0207640_10542796
428 Ga0207658_10000126
429 Ga0207677_10249528
430 Ga0207703_10031220
431 Ga0207678_10317670
432 Ga0207708_10006637
433 Ga0207702_10694653
434 Ga0207702_11624338
435 Ga0207702_11700486
436 Ga0207641_10079647
437 Ga0207641_10191557
438 Ga0207648_10002220
439 Ga0207648_10172419
440 Ga0207648_10237952
441 Ga0207648_10458639
442 Ga0207675_100000371
443 Ga0207683_10876995
444 Ga0207698_10244721
445 Ga0207698_10257976
446 Ga0207698_10384480
447 Ga0209179_1056746
448 Ga0268266_10070048
449 Ga0268264_10062935
450 Ga0307513_10007080
451 Ga0307408_100148296
452 Ga0307508_10073164
453 Ga0307405_10018831
454 Ga0307410_10132607
455 Ga0307406_10017722
456 Ga0307407_10025970
457 Ga0307412_10383816
458 Ga0307409_100015935
459 Ga0307416_100120759
460 Ga0307414_10399606
461 Ga0373941_0055085
462 Ga0373941_0128300
463 Ga0373954_0033172
464 Ga0373956_0022605
465 Ga0373943_0105136
466 Ga0373943_0268256
467 Ga0373955_0010680
468 Ga0373931_1301166
469 Ga0373935_0678957
470 Ga0373933_0005592
471 Ga0373937_0020221
472 Ga0395898_0969311
473 Ga0436364_1217329
474 Ga0395901_1223460
475 Ga0242420_069454
476 Ga0436365_1255419
477 Ga0436363_0291787
478 Ga0451807_1526745
479 Ga0439433_0024960
480 Ga0439449_0051229
481 Ga0439446_0016419
482 Ga0439435_0025605
483 Ga0439444_0004663
484 Ga0450893_0022880
485 Ga0451577_0333865
486 Ga0453683_0311479
487 Ga0466959_0941441
488 Ga0451576_1246480
489 Ga0495641_0098326
490 Ga0495586_0116891
491 Ga0495667_1024053
492 Ga0495635_0324502
493 Ga0495581_0419823
494 Ga0495680_0379823
495 Ga0496102_0124711
496 Ga0496102_0283437
497 Ga0496110_1841314
498 Ga0496112_0180856
499 Ga0496112_0378588
500 Ga0496114_0155601
501 Ga0496121_0039228
502 Ga0496125_0046008
503 Ga0501298_044146
504 Ga0501299_006373
505 Ga0501202_001342
506 Ga0501207_000349
507 Ga0501216_005177
508 Ga0501217_003466
509 Ga0501227_090695
510 Ga0501228_012828
511 Ga0501230_007794
512 Ga0501235_000580
513 Ga0501236_012041
514 Ga0501239_001170
515 Ga0501242_000413
516 Ga0501243_001182
517 Ga0501247_004684
518 Ga0501249_004894
519 Ga0501252_008845
520 Ga0501253_001237
521 Ga0501257_018405
522 Ga0501258_009328
523 Ga0501261_002241
524 Ga0501221_001803
525 Ga0501234_002288
526 Ga0501245_049830
527 Ga0501083_0201998
528 Ga0501241_025312
529 Ga0501265_012654
530 Ga0501266_001622
531 Ga0501268_000157
532 Ga0501270_025478
533 Ga0501272_000523
534 Ga0501274_008335
535 Ga0501279_047434
536 Ga0501212_085009
537 nmdc:mga0n895_12675_c1
538 nmdc:mga0rr50_19234_c1
539 nmdc:mga0rr50_55090_c1
540 nmdc:mga0a205_1077653_c1
541 Ga0495619_0869811
542 Ga0500640_000888
543 Ga0500554_002554
544 Ga0500572_004787
545 Ga0500595_000263
546 Ga0500614_001098
547 Ga0500559_0007848
548 Ga0500637_0624881
549 Ga0500601_009003
550 Ga0501082_1522686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

7

53

0.98

PF12840

HTH_20

Helix-turn-helix domain

5

53

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9487 13 68
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9458 5 76
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9353 5 79
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9345 25 67
2quf-assembly1.cif.gz_A crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus 0.931 5 68
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9783 10 66 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9694 10 70 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9605 6 67 1.10.10.10
2ia2D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9512 25 55 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9487 13 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N2JJR8-F1-model_v4 ArsR family transcriptional regulator 0.9996 5 67 GO:0003700
AF-A0A2V7U777-F1-model_v4 Transcriptional regulator 0.9887 1 75 GO:0003700
AF-I3DVN6-F1-model_v4 ArsR family transcriptional regulator 0.9863 3 84 GO:0003677
GO:0003700
AF-A0A2V5DNL0-F1-model_v4 deleted 0.9839 3 82
AF-A0A378H3B4-F1-model_v4 deleted 0.9833 2 82

Map