F380149

General Info

Members Datasets Scaffolds Average Seq Length
275 201 246 505

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1000181|Ga0055524_10001817
Length 525
Sequence MSTESPGEGAAADPGTLPASALIVLHPDDNIAVARFALPAGARIARPHGPTLPVLAPIEAGHKVALRAIGRGELVLKYGQPIGLASAPIEPGAHVHGHNLEMAEVMPPRAAAQAADAAXXVMPVDSAATFEGYRRADGRVGTRNYIGVIASVNCSATVCKAIAQVFQGPGLPAGVDGVVAITHGSGCGMSAEGDGLVLLQRTLRGYAAHPNFAAVLLVGLGCEVNQIEPLVQALPAATRERLRLLTIQEAGGTREAVEQGQALVRELAEQAGLARRSTVPMSALVVGLQCGGSDGYSGISANPALGAAVDLLVRHGGTALLSETPEIHGAEHLLTARAASPEVARRLLDRLQWWEQYAARHGARLDNNPSPGNKAGGITTILEKSLGAVAKGGGSPLNDVIEYAEPVRARGLVFMDTPGYDPVSATGQVAGGATLICFTTGRGSTYGCKPTPSLKLATTTALFERMRLDMDFNAGGIVDGTQTVAEAGAALFELMRETASGRRTLSEEHGLGDNEFVPWQLGAVM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
4 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
5 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
6 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
7 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
8 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
9 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
10 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
11 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
16 2643221656 Pelomonas sp. Root405 Isolate Unclassified
17 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
18 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
19 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
20 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
21 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
22 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
23 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
24 2928058823 Ralstonia sp. 1138 Isolate Unclassified
25 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
26 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
27 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
28 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
29 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
35 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
36 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
37 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
38 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
141 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
146 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
147 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
148 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
149 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
150 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
151 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
157 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
201 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.36
Metatranscriptomes 1.09
Isolates 10.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20
Nodule 1.09
Rhizoplane 4
Rhizosphere 59.64
Stem 0
Stem Tuber 0
Unclassified 15.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1773400 2162886007 Bacteria 24667
2 JGI24741J21665_1001827 3300001915 Bacteria 5827
3 JGI24740J21852_10000445 3300001979 Bacteria 17693
4 JGI24740J21852_10003499 3300001979 Bacteria 6884
5 JGI25156J39149_1000026 3300002705 Bacteria 132099
6 JGI25154J39366_1001347 3300002738 Bacteria 9000
7 JGI25157J39369_1000008 3300002741 Bacteria 211083
8 Ga0055538_1001478 3300003751 Bacteria 4461
9 Ga0055538_1003509 3300003751 Bacteria 1976
10 Ga0055539_1000042 3300003752 Bacteria 199725
11 Ga0055539_1000100 3300003752 Bacteria 100406
12 Ga0055533_1000006 3300003756 Bacteria 635559
13 Ga0055532_1000127 3300003758 Bacteria 75964
14 Ga0055525_1000487 3300003759 Bacteria 20653
15 Ga0055525_1000550 3300003759 Bacteria 17404
16 Ga0055535_1000140 3300003761 Bacteria 75964
17 Ga0055542_1001414 3300003762 Bacteria 12084
18 Ga0055529_1000230 3300003763 Bacteria 71040
19 Ga0055524_1000181 3300003775 Bacteria 71026
20 Ga0055530_10000004 3300003791 Bacteria 231465
21 Ga0055540_1000017 3300003792 Bacteria 231465
22 Ga0055531_10003858 3300003794 Bacteria 9381
23 Ga0055531_10006314 3300003794 Bacteria 6748
24 Ga0055541_1000241 3300003841 Bacteria 20499
25 Ga0065714_10002302 3300005288 Bacteria 45300
26 Ga0065714_10079556 3300005288 Bacteria 2506
27 Ga0065704_10000374 3300005289 Bacteria 26179
28 Ga0070658_10127070 3300005327 Bacteria 2122
29 Ga0070690_100004103 3300005330 Bacteria 8061
30 Ga0070661_100000119 3300005344 Bacteria 65829
31 Ga0070714_100002607 3300005435 Bacteria 13283
32 Ga0070663_100000035 3300005455 Bacteria 66161
33 Ga0068855_100003075 3300005563 Bacteria 20410
34 Ga0070664_100000008 3300005564 Bacteria 173734
35 Ga0068857_100000565 3300005577 Bacteria 27000
36 Ga0068857_100025273 3300005577 Bacteria 5230
37 Ga0068854_100000187 3300005578 Bacteria 41578
38 Ga0068856_100000862 3300005614 Bacteria 32543
39 Ga0068856_100011040 3300005614 Bacteria 8772
40 Ga0068856_100011213 3300005614 Bacteria 8699
41 Ga0070717_10042381 3300006028 Bacteria 3712
42 Ga0070717_10164026 3300006028 Bacteria 1929
43 Ga0075432_10000187 3300006058 Bacteria 15933
44 Ga0075432_10010850 3300006058 Bacteria 3096
45 Ga0075370_10003328 3300006353 Bacteria 7630
46 Ga0075370_10018401 3300006353 Bacteria 3791
47 Ga0075370_10063857 3300006353 Bacteria 2099
48 Ga0068871_100054220 3300006358 Bacteria 3252
49 Ga0099823_1001212 3300006944 Bacteria 20620
50 Ga0105240_10035005 3300009093 Bacteria 6475
51 Ga0105240_10046322 3300009093 Bacteria 5511
52 Ga0105243_10078469 3300009148 Bacteria 2688
53 Ga0105238_10005835 3300009551 Bacteria 12188
54 Ga0105239_10005853 3300010375 Bacteria 14334
55 Ga0157319_1000048 3300012497 Bacteria 16986
56 Ga0157373_10001856 3300013100 Bacteria 16037
57 Ga0157371_10000413 3300013102 Bacteria 52929
58 Ga0157370_10000456 3300013104 Bacteria 51071
59 Ga0157369_10002006 3300013105 Bacteria 24529
60 Ga0157372_10000142 3300013307 Bacteria 79172
61 Ga0182008_10021462 3300014497 Bacteria 3315
62 Ga0157377_10000223 3300014745 Bacteria 29679
63 Ga0182006_1001828 3300015261 Bacteria 12217
64 Ga0182006_1008492 3300015261 Bacteria 4652
65 Ga0206351_10741817 3300020077 Bacteria 9588
66 Ga0206353_10143864 3300020082 Bacteria 1919
67 Ga0154015_1049643 3300020610 Bacteria 16414
68 Ga0213875_10000059 3300021388 Bacteria 135414
69 Ga0213875_10036448 3300021388 Bacteria 2319
70 Ga0213875_10036937 3300021388 Bacteria 2302
71 Ga0209784_100003 3300025224 Bacteria 1379451
72 Ga0209784_100160 3300025224 Bacteria 60798
73 Ga0209784_100941 3300025224 Bacteria 5647
74 Ga0209566_100002 3300025225 Bacteria 2614868
75 Ga0209566_100809 3300025225 Bacteria 16285
76 Ga0209674_100003 3300025226 Bacteria 2196646
77 Ga0209674_100008 3300025226 Bacteria 1076909
78 Ga0209674_100118 3300025226 Bacteria 135635
79 Ga0209674_101113 3300025226 Bacteria 7898
80 Ga0209672_100818 3300025228 Bacteria 14658
81 Ga0209147_100002 3300025229 Bacteria 2158988
82 Ga0209563_100004 3300025230 Bacteria 1814108
83 Ga0209563_100010 3300025230 Bacteria 1337457
84 Ga0207427_100892 3300025231 Bacteria 12972
85 Ga0209258_100002 3300025242 Bacteria 2158988
86 Ga0209646_1000039 3300025246 Bacteria 349637
87 Ga0209646_1000059 3300025246 Bacteria 256909
88 Ga0209026_1000006 3300025250 Bacteria 677225
89 Ga0209677_100009 3300025253 Bacteria 749530
90 Ga0209677_100026 3300025253 Bacteria 382520
91 Ga0209677_100131 3300025253 Bacteria 72722
92 Ga0209677_100730 3300025253 Bacteria 16741
93 Ga0209148_1000021 3300025254 Bacteria 714645
94 Ga0209759_1000020 3300025256 Bacteria 344904
95 Ga0209759_1001391 3300025256 Bacteria 13904
96 Ga0209759_1005256 3300025256 Bacteria 4592
97 Ga0209759_1009860 3300025256 Bacteria 2851
98 Ga0209455_1000021 3300025272 Bacteria 699993
99 Ga0209673_1003344 3300025273 Bacteria 9587
100 Ga0209676_1001065 3300025292 Bacteria 31352
101 Ga0209050_1000037 3300025298 Bacteria 415612
102 Ga0209050_1000951 3300025298 Bacteria 37656
103 Ga0209256_1000075 3300025299 Bacteria 236149
104 Ga0209256_1001772 3300025299 Bacteria 20504
105 Ga0209051_1000040 3300025303 Bacteria 315055
106 Ga0209051_1001665 3300025303 Bacteria 17946
107 Ga0209257_1000162 3300025304 Bacteria 175776
108 Ga0209257_1002069 3300025304 Bacteria 21175
109 Ga0207705_10112423 3300025909 Bacteria 2013
110 Ga0207695_10008164 3300025913 Bacteria 13158
111 Ga0207695_10042888 3300025913 Bacteria 4826
112 Ga0207649_10000992 3300025920 Bacteria 17580
113 Ga0207694_10014724 3300025924 Bacteria 5897
114 Ga0207700_10062328 3300025928 Bacteria 2832
115 Ga0207664_10000720 3300025929 Bacteria 22545
116 Ga0207709_10042760 3300025935 Bacteria 2727
117 Ga0207689_10012459 3300025942 Bacteria 7264
118 Ga0207679_10000001 3300025945 Bacteria 777444
119 Ga0207667_10006950 3300025949 Bacteria 13679
120 Ga0207640_10000703 3300025981 Bacteria 19446
121 Ga0207678_10002602 3300026067 Bacteria 16443
122 Ga0207702_10000024 3300026078 Bacteria 187719
123 Ga0207702_10001651 3300026078 Bacteria 22016
124 Ga0207648_10001151 3300026089 Bacteria 29631
125 Ga0207674_10000509 3300026116 Bacteria 50984
126 Ga0209389_1019976 3300027296 Bacteria 5992
127 Ga0207428_10003576 3300027907 Bacteria 15003
128 Ga0265336_10000003 3300028666 Bacteria 423158
129 Ga0307515_10000776 3300028794 Bacteria 73514
130 Ga0307515_10018594 3300028794 Bacteria 12556
131 Ga0307515_10049943 3300028794 Bacteria 6276
132 Ga0307515_10062507 3300028794 Bacteria 5255
133 Ga0265324_10001082 3300029957 Bacteria 16396
134 Ga0307512_10019883 3300030522 Bacteria 6100
135 Ga0265332_10003860 3300031238 Bacteria 7155
136 Ga0307408_100000087 3300031548 Bacteria 101616
137 Ga0307408_100014852 3300031548 Bacteria 5178
138 Ga0307516_10016213 3300031730 Bacteria 7803
139 Ga0307405_10012456 3300031731 Bacteria 4503
140 Ga0307405_10016734 3300031731 Bacteria 4006
141 Ga0307406_10026081 3300031901 Bacteria 3505
142 Ga0307412_10000644 3300031911 Bacteria 20250
143 Ga0307414_10068860 3300032004 Bacteria 2541
144 Ga0307411_10000153 3300032005 Bacteria 21856
145 Ga0307411_10045653 3300032005 Bacteria 2819
146 Ga0373939_0000137 3300035114 Bacteria 21265
147 Ga0373960_0000568 3300035121 Bacteria 7489
148 Ga0373961_0004428 3300035241 Bacteria 3396
149 Ga0373931_0000950 3300035691 Bacteria 12188
150 Ga0373931_0006914 3300035691 Bacteria 5337
151 Ga0395899_0097509 3300037312 Bacteria 2125
152 Ga0395900_0001932 3300037418 Bacteria 23486
153 Ga0395900_0031327 3300037418 Bacteria 5463
154 Ga0395898_0026013 3300037466 Bacteria 5893
155 Ga0395905_0001317 3300037471 Bacteria 30505
156 Ga0436364_0082088 3300037853 Bacteria 178031
157 Ga0436364_1097959 3300037853 Bacteria 7589
158 Ga0436364_1135218 3300037853 Bacteria 16974
159 Ga0395901_0006051 3300038443 Bacteria 12257
160 Ga0439438_000029 3300041405 Bacteria 82129
161 Ga0439438_000144 3300041405 Bacteria 32021
162 Ga0439447_005480 3300041407 Bacteria 4218
163 Ga0439432_006107 3300042006 Bacteria 4313
164 Ga0439451_000700 3300042009 Bacteria 6373
165 Ga0439452_009864 3300042010 Bacteria 2800
166 Ga0439463_002474 3300042016 Bacteria 4689
167 Ga0450917_000179 3300042120 Bacteria 4401
168 Ga0450888_000094 3300042126 Bacteria 6822
169 Ga0450891_002177 3300042129 Bacteria 1989
170 Ga0450892_000313 3300042130 Bacteria 5728
171 Ga0450889_000353 3300042144 Bacteria 5122
172 Ga0450906_002546 3300042145 Bacteria 3980
173 Ga0451577_0004106 3300042876 Bacteria 15614
174 Ga0451577_0005239 3300042876 Bacteria 13337
175 Ga0466986_0019949 3300044650 Bacteria 4403
176 Ga0466969_0001062 3300044656 Bacteria 14838
177 Ga0466972_0001390 3300044658 Bacteria 11735
178 Ga0466978_0027739 3300044671 Bacteria 3421
179 Ga0466982_0051650 3300044672 Bacteria 2518
180 Ga0466961_0000435 3300044693 Bacteria 26633
181 Ga0466963_0016064 3300044694 Bacteria 4649
182 Ga0466963_0043586 3300044694 Bacteria 2951
183 Ga0453684_0001074 3300044712 Bacteria 87079
184 Ga0453684_0001870 3300044712 Bacteria 54788
185 Ga0453684_0010684 3300044712 Bacteria 15614
186 Ga0453684_0091101 3300044712 Bacteria 3765
187 Ga0466971_0013779 3300044719 Bacteria 3554
188 Ga0466970_0000271 3300044765 Bacteria 25244
189 Ga0466970_0007223 3300044765 Bacteria 5563
190 Ga0466957_0009693 3300044842 Bacteria 5499
191 Ga0466959_0002792 3300045049 Bacteria 11241
192 Ga0466959_0017360 3300045049 Bacteria 5275
193 Ga0451576_0004858 3300045051 Bacteria 17221
194 Ga0451576_0065915 3300045051 Bacteria 3770
195 Ga0495590_0000885 3300046457 Bacteria 13429
196 Ga0495605_0000001 3300046474 Bacteria 614538
197 Ga0495605_0011974 3300046474 Bacteria 4822
198 Ga0495584_0001732 3300046491 Bacteria 12757
199 Ga0495584_0076035 3300046491 Bacteria 1689
200 Ga0495607_0000149 3300046501 Bacteria 73673
201 Ga0495607_0000298 3300046501 Bacteria 51955
202 Ga0495607_0047886 3300046501 Bacteria 2501
203 Ga0495583_0000034 3300046506 Bacteria 246856
204 Ga0495583_0002575 3300046506 Bacteria 15232
205 Ga0495606_0000199 3300046507 Bacteria 104847
206 Ga0495606_0008689 3300046507 Bacteria 8748
207 Ga0495606_0027463 3300046507 Bacteria 4035
208 Ga0495610_0009317 3300046512 Bacteria 6220
209 Ga0495620_0001169 3300046515 Bacteria 16084
210 Ga0495637_0001506 3300046520 Bacteria 13645
211 Ga0495643_0031828 3300046522 Bacteria 2932
212 Ga0495642_0032801 3300046528 Bacteria 2085
213 Ga0495654_0001956 3300046530 Bacteria 13608
214 Ga0495609_0000014 3300046538 Bacteria 326023
215 Ga0495597_0000183 3300046542 Bacteria 56126
216 Ga0495597_0007811 3300046542 Bacteria 5398
217 Ga0495668_0024784 3300046616 Bacteria 3411
218 Ga0495668_0050606 3300046616 Bacteria 2302
219 Ga0495625_0001208 3300046660 Bacteria 32802
220 Ga0495625_0004157 3300046660 Bacteria 13800
221 Ga0495625_0067587 3300046660 Bacteria 2515
222 Ga0495661_0007583 3300046665 Bacteria 7562
223 Ga0495661_0015006 3300046665 Bacteria 5178
224 Ga0495649_0000470 3300046694 Bacteria 34696
225 Ga0495649_0080713 3300046694 Bacteria 1739
226 Ga0495673_0001903 3300047469 Bacteria 15622
227 Ga0495673_0003076 3300047469 Bacteria 11218
228 Ga0495673_0007352 3300047469 Bacteria 6350
229 Ga0496108_0102161 3300048911 Bacteria 2446
230 Ga0496109_0046989 3300048912 Bacteria 3922
231 Ga0496111_0027414 3300048914 Bacteria 4030
232 Ga0496118_0036893 3300048921 Bacteria 3944
233 Ga0496124_0008005 3300048927 Bacteria 11121
234 Ga0496124_0028019 3300048927 Bacteria 5043
235 Ga0496125_0002526 3300048928 Bacteria 23616
236 Ga0495682_0000030 3300049460 Bacteria 139542
237 Ga0501221_001354 3300049704 Bacteria 4037
238 Ga0501083_0000372 3300049744 Bacteria 28362
239 Ga0501226_001626 3300049853 Bacteria 2848
240 nmdc:mga07m45_25695_c1 3300050496 Bacteria 3231
241 nmdc:mga07m45_73254_c1 3300050496 Bacteria 1950
242 nmdc:mga08y16_62334_c1 3300050511 Bacteria 3894
243 Ga0500595_000012 3300053119 Bacteria 255472
244 Ga0500636_0010703 3300053177 Bacteria 5355
245 Ga0466962_0009466 3300061719 Bacteria 4671
246 Ga0466962_0027206 3300061719 Bacteria 2746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0080713 Ga0495649_0080713_10_1281 423
2 3300021388 Ga0213875_10000059 Ga0213875_1000005982 453
3 3300025928 Ga0207700_10062328 Ga0207700_100623281 453
4 3300037853 Ga0436364_0082088 Ga0436364_0082088_135980_137566 453
5 3300061719 Ga0466962_0009466 Ga0466962_0009466_1440_2981 456
6 3300028666 Ga0265336_10000003 Ga0265336_1000000313 460
7 3300029957 Ga0265324_10001082 Ga0265324_1000108212 460
8 3300031548 Ga0307408_100000087 Ga0307408_10000008754 460
9 3300044712 Ga0453684_0091101 Ga0453684_0091101_1782_3290 462
10 3300053119 Ga0500595_000012 Ga0500595_000012_108956_110482 470
11 3300042876 Ga0451577_0004106 Ga0451577_0004106_12163_13695 472
12 3300044712 Ga0453684_0010684 Ga0453684_0010684_12163_13695 472
13 3300028794 Ga0307515_10062507 Ga0307515_100625072 474
14 3300046542 Ga0495597_0000183 Ga0495597_0000183_16694_18232 474
15 3300045051 Ga0451576_0065915 Ga0451576_0065915_306_1811 477
16 3300046491 Ga0495584_0076035 Ga0495584_0076035_32_1468 478
17 3300045051 Ga0451576_0004858 Ga0451576_0004858_2037_3569 482
18 3300046506 Ga0495583_0002575 Ga0495583_0002575_9518_11047 482
19 3300046538 Ga0495609_0000014 Ga0495609_0000014_32046_33575 482
20 3300047469 Ga0495673_0007352 Ga0495673_0007352_1426_2955 482
21 3300005563 Ga0068855_100003075 Ga0068855_10000307511 483
22 3300025949 Ga0207667_10006950 Ga0207667_1000695012 483
23 3300046474 Ga0495605_0000001 Ga0495605_0000001_578748_580277 485
24 3300049704 Ga0501221_001354 Ga0501221_001354_1669_3195 487
25 3300046528 Ga0495642_0032801 Ga0495642_0032801_82_1611 488
26 3300053177 Ga0500636_0010703 Ga0500636_0010703_676_2211 488
27 3300005435 Ga0070714_100002607 Ga0070714_1000026077 489
28 3300025929 Ga0207664_10000720 Ga0207664_100007208 489
29 3300006058 Ga0075432_10010850 Ga0075432_100108503 491
30 3300046660 Ga0495625_0067587 Ga0495625_0067587_1026_2501 491
31 3300005327 Ga0070658_10127070 Ga0070658_101270702 492
32 3300025909 Ga0207705_10112423 Ga0207705_101124232 492
33 3300006028 Ga0070717_10164026 Ga0070717_101640262 493
34 3300025253 Ga0209677_100730 Ga0209677_1007309 493
35 3300005614 Ga0068856_100011213 Ga0068856_1000112139 495
36 3300042009 Ga0439451_000700 Ga0439451_000700_33_1559 495
37 3300042145 Ga0450906_002546 Ga0450906_002546_2205_3731 495
38 3300041407 Ga0439447_005480 Ga0439447_005480_1640_3169 497
39 3300042006 Ga0439432_006107 Ga0439432_006107_1022_2551 497
40 3300031731 Ga0307405_10012456 Ga0307405_100124562 498
41 3300041405 Ga0439438_000144 Ga0439438_000144_17572_19101 498
42 3300020082 Ga0206353_10143864 Ga0206353_101438642 499
43 iso_pu_bacteria 2599185178 2599444495 499
44 iso_pu_bacteria 2643221585 2643933576 499
45 iso_pu_bacteria 2643221656 2644315076 499
46 iso_pu_bacteria 2928058823 2928063024 499
47 3300045049 Ga0466959_0017360 Ga0466959_0017360_1890_3488 500
48 3300048927 Ga0496124_0008005 Ga0496124_0008005_5752_7302 500
49 3300035114 Ga0373939_0000137 Ga0373939_0000137_3605_5113 501
50 3300035121 Ga0373960_0000568 Ga0373960_0000568_3285_4793 501
51 3300035241 Ga0373961_0004428 Ga0373961_0004428_587_2095 501
52 3300035691 Ga0373931_0006914 Ga0373931_0006914_3626_5134 501
53 3300037418 Ga0395900_0031327 Ga0395900_0031327_3495_5072 501
54 3300001915 JGI24741J21665_1001827 JGI24741J21665_10018272 502
55 3300001979 JGI24740J21852_10003499 JGI24740J21852_100034993 502
56 3300003751 Ga0055538_1001478 Ga0055538_10014784 502
57 3300003751 Ga0055538_1003509 Ga0055538_10035091 502
58 3300003752 Ga0055539_1000100 Ga0055539_100010083 502
59 3300003758 Ga0055532_1000127 Ga0055532_100012714 502
60 3300003759 Ga0055525_1000487 Ga0055525_100048714 502
61 3300003761 Ga0055535_1000140 Ga0055535_100014014 502
62 3300003762 Ga0055542_1001414 Ga0055542_100141412 502
63 3300003763 Ga0055529_1000230 Ga0055529_10002308 502
64 3300003841 Ga0055541_1000241 Ga0055541_100024112 502
65 3300005344 Ga0070661_100000119 Ga0070661_10000011950 502
66 3300005455 Ga0070663_100000035 Ga0070663_10000003544 502
67 3300005564 Ga0070664_100000008 Ga0070664_100000008162 502
68 3300005577 Ga0068857_100025273 Ga0068857_1000252732 502
69 3300005578 Ga0068854_100000187 Ga0068854_10000018741 502
70 3300005614 Ga0068856_100000862 Ga0068856_10000086222 502
71 3300006028 Ga0070717_10042381 Ga0070717_100423812 502
72 3300009093 Ga0105240_10046322 Ga0105240_100463222 502
73 3300013100 Ga0157373_10001856 Ga0157373_100018562 502
74 3300013102 Ga0157371_10000413 Ga0157371_1000041341 502
75 3300013104 Ga0157370_10000456 Ga0157370_1000045640 502
76 3300013105 Ga0157369_10002006 Ga0157369_1000200612 502
77 3300013307 Ga0157372_10000142 Ga0157372_1000014214 502
78 3300014497 Ga0182008_10021462 Ga0182008_100214622 502
79 3300015261 Ga0182006_1001828 Ga0182006_10018284 502
80 3300015261 Ga0182006_1008492 Ga0182006_10084923 502
81 3300020077 Ga0206351_10741817 Ga0206351_107418175 502
82 3300020610 Ga0154015_1049643 Ga0154015_10496434 502
83 3300021388 Ga0213875_10036448 Ga0213875_100364482 502
84 3300021388 Ga0213875_10036937 Ga0213875_100369372 502
85 3300025224 Ga0209784_100003 Ga0209784_100003988 502
86 3300025224 Ga0209784_100160 Ga0209784_10016056 502
87 3300025224 Ga0209784_100941 Ga0209784_1009412 502
88 3300025225 Ga0209566_100002 Ga0209566_1000021942 502
89 3300025225 Ga0209566_100809 Ga0209566_1008094 502
90 3300025226 Ga0209674_100008 Ga0209674_100008243 502
91 3300025226 Ga0209674_100118 Ga0209674_10011858 502
92 3300025226 Ga0209674_101113 Ga0209674_1011134 502
93 3300025228 Ga0209672_100818 Ga0209672_1008182 502
94 3300025229 Ga0209147_100002 Ga0209147_1000021427 502
95 3300025230 Ga0209563_100004 Ga0209563_1000041359 502
96 3300025242 Ga0209258_100002 Ga0209258_1000021427 502
97 3300025246 Ga0209646_1000059 Ga0209646_1000059224 502
98 3300025253 Ga0209677_100009 Ga0209677_100009273 502
99 3300025254 Ga0209148_1000021 Ga0209148_100002176 502
100 3300025256 Ga0209759_1001391 Ga0209759_10013914 502
101 3300025256 Ga0209759_1005256 Ga0209759_10052562 502
102 3300025256 Ga0209759_1009860 Ga0209759_10098602 502
103 3300025272 Ga0209455_1000021 Ga0209455_100002114 502
104 3300025913 Ga0207695_10008164 Ga0207695_100081645 502
105 3300025920 Ga0207649_10000992 Ga0207649_100009926 502
106 3300025945 Ga0207679_10000001 Ga0207679_1000000114 502
107 3300025981 Ga0207640_10000703 Ga0207640_100007033 502
108 3300026067 Ga0207678_10002602 Ga0207678_1000260214 502
109 3300026078 Ga0207702_10000024 Ga0207702_10000024108 502
110 3300031238 Ga0265332_10003860 Ga0265332_100038605 502
111 3300037312 Ga0395899_0097509 Ga0395899_0097509_261_1772 502
112 3300037418 Ga0395900_0001932 Ga0395900_0001932_16388_17899 502
113 3300037853 Ga0436364_1097959 Ga0436364_1097959_5502_7145 502
114 3300037853 Ga0436364_1135218 Ga0436364_1135218_5200_6777 502
115 3300044650 Ga0466986_0019949 Ga0466986_0019949_1261_2790 502
116 3300044658 Ga0466972_0001390 Ga0466972_0001390_1396_2925 502
117 3300044671 Ga0466978_0027739 Ga0466978_0027739_1783_3312 502
118 3300044672 Ga0466982_0051650 Ga0466982_0051650_671_2200 502
119 3300044693 Ga0466961_0000435 Ga0466961_0000435_12526_14055 502
120 3300044694 Ga0466963_0016064 Ga0466963_0016064_939_2468 502
121 3300044765 Ga0466970_0000271 Ga0466970_0000271_11275_12804 502
122 3300045049 Ga0466959_0002792 Ga0466959_0002792_1049_2578 502
123 3300048921 Ga0496118_0036893 Ga0496118_0036893_772_2283 502
124 3300048928 Ga0496125_0002526 Ga0496125_0002526_5458_6969 502
125 3300061719 Ga0466962_0027206 Ga0466962_0027206_280_1809 502
126 iso_pu_bacteria 2643221544 2643746765 502
127 3300006353 Ga0075370_10003328 Ga0075370_100033287 503
128 3300003794 Ga0055531_10003858 Ga0055531_100038583 504
129 3300006944 Ga0099823_1001212 Ga0099823_100121210 504
130 3300014745 Ga0157377_10000223 Ga0157377_100002231 504
131 3300025273 Ga0209673_1003344 Ga0209673_10033443 504
132 3300025298 Ga0209050_1000951 Ga0209050_100095112 504
133 3300025299 Ga0209256_1001772 Ga0209256_10017729 504
134 3300025304 Ga0209257_1002069 Ga0209257_100206910 504
135 3300027296 Ga0209389_1019976 Ga0209389_10199765 504
136 3300049744 Ga0501083_0000372 Ga0501083_0000372_15229_16764 504
137 3300050511 nmdc:mga08y16_62334_c1 nmdc:mga08y16_62334_c1_1232_2782 504
138 iso_pu_bacteria 2599185212 2599611834 504
139 iso_pu_bacteria 2599185306 2599963993 504
140 iso_pu_bacteria 2599185308 2599976716 504
141 iso_pu_bacteria 2599185311 2599992686 504
142 iso_pu_bacteria 2599185314 2600010885 504
143 iso_pu_bacteria 2599185318 2600033947 504
144 iso_pu_bacteria 2599185322 2600058686 504
145 iso_pu_bacteria 2675903515 2678263526 504
146 iso_pu_bacteria 2744054620 2745009857 504
147 iso_pu_bacteria 2825651385 2825652282 504
148 iso_pu_bacteria 2842854478 2842857920 504
149 iso_pu_bacteria 2913036834 2913040287 504
150 iso_pu_bacteria 2919481497 2919483322 504
151 iso_pu_bacteria 2929144301 2929146914 504
152 iso_pu_bacteria 2931369376 2931374879 504
153 iso_pu_bacteria 2945928738 2945933378 504
154 iso_pu_bacteria 3007866637 3007868878 504
155 iso_pu_bacteria 8054285046 8054291391 504
156 iso_pu_bacteria 8056143049 8056146471 504
157 3300001979 JGI24740J21852_10000445 JGI24740J21852_100004459 505
158 iso_pu_bacteria 2585428062 2587754410 505
159 iso_pu_bacteria 2643221644 2644245953 505
160 3300002705 JGI25156J39149_1000026 JGI25156J39149_100002642 506
161 3300002738 JGI25154J39366_1001347 JGI25154J39366_10013476 506
162 3300002741 JGI25157J39369_1000008 JGI25157J39369_100000853 506
163 3300003752 Ga0055539_1000042 Ga0055539_1000042111 506
164 3300003756 Ga0055533_1000006 Ga0055533_1000006283 506
165 3300003759 Ga0055525_1000550 Ga0055525_100055010 506
166 3300003775 Ga0055524_1000181 Ga0055524_10001817 506
167 3300003794 Ga0055531_10006314 Ga0055531_100063141 506
168 3300005330 Ga0070690_100004103 Ga0070690_1000041032 506
169 3300005577 Ga0068857_100000565 Ga0068857_10000056517 506
170 3300005614 Ga0068856_100011040 Ga0068856_1000110406 506
171 3300006353 Ga0075370_10018401 Ga0075370_100184012 506
172 3300006358 Ga0068871_100054220 Ga0068871_1000542203 506
173 3300009093 Ga0105240_10035005 Ga0105240_100350056 506
174 3300009551 Ga0105238_10005835 Ga0105238_100058356 506
175 3300010375 Ga0105239_10005853 Ga0105239_100058533 506
176 3300012497 Ga0157319_1000048 Ga0157319_10000488 506
177 3300025226 Ga0209674_100003 Ga0209674_1000031053 506
178 3300025230 Ga0209563_100010 Ga0209563_100010781 506
179 3300025231 Ga0207427_100892 Ga0207427_1008922 506
180 3300025246 Ga0209646_1000039 Ga0209646_1000039202 506
181 3300025250 Ga0209026_1000006 Ga0209026_1000006399 506
182 3300025253 Ga0209677_100026 Ga0209677_100026153 506
183 3300025253 Ga0209677_100131 Ga0209677_10013153 506
184 3300025256 Ga0209759_1000020 Ga0209759_100002054 506
185 3300025299 Ga0209256_1000075 Ga0209256_1000075177 506
186 3300025303 Ga0209051_1001665 Ga0209051_100166519 506
187 3300025304 Ga0209257_1000162 Ga0209257_100016279 506
188 3300025913 Ga0207695_10042888 Ga0207695_100428884 506
189 3300025924 Ga0207694_10014724 Ga0207694_100147244 506
190 3300025942 Ga0207689_10012459 Ga0207689_100124593 506
191 3300026078 Ga0207702_10001651 Ga0207702_100016512 506
192 3300026116 Ga0207674_10000509 Ga0207674_1000050924 506
193 3300037466 Ga0395898_0026013 Ga0395898_0026013_3836_5368 506
194 3300037471 Ga0395905_0001317 Ga0395905_0001317_5313_6851 506
195 3300038443 Ga0395901_0006051 Ga0395901_0006051_6785_8317 506
196 3300044712 Ga0453684_0001074 Ga0453684_0001074_53863_55482 506
197 3300044712 Ga0453684_0001870 Ga0453684_0001870_37049_38665 506
198 3300050496 nmdc:mga07m45_25695_c1 nmdc:mga07m45_25695_c1_1475_3010 506
199 iso_pu_bacteria 2643221639 2644218852 506
200 iso_pu_bacteria 2643221646 2644258180 506
201 3300035691 Ga0373931_0000950 Ga0373931_0000950_7349_8884 507
202 3300046506 Ga0495583_0000034 Ga0495583_0000034_89561_91096 507
203 3300046507 Ga0495606_0008689 Ga0495606_0008689_612_2147 507
204 3300046616 Ga0495668_0024784 Ga0495668_0024784_1212_2747 507
205 3300046660 Ga0495625_0004157 Ga0495625_0004157_9484_11019 507
206 3300046694 Ga0495649_0000470 Ga0495649_0000470_17533_19068 507
207 iso_pu_bacteria 2857576091 2857576387 507
208 2162886007 SwRhRL2b_contig_1773400 SwRhRL2b_0611.00006450 508
209 3300003791 Ga0055530_10000004 Ga0055530_1000000415 508
210 3300003792 Ga0055540_1000017 Ga0055540_1000017188 508
211 3300005288 Ga0065714_10002302 Ga0065714_100023024 508
212 3300005288 Ga0065714_10079556 Ga0065714_100795562 508
213 3300005289 Ga0065704_10000374 Ga0065704_1000037412 508
214 3300006058 Ga0075432_10000187 Ga0075432_100001878 508
215 3300006353 Ga0075370_10063857 Ga0075370_100638572 508
216 3300009148 Ga0105243_10078469 Ga0105243_100784691 508
217 3300025292 Ga0209676_1001065 Ga0209676_100106523 508
218 3300025298 Ga0209050_1000037 Ga0209050_100003714 508
219 3300025303 Ga0209051_1000040 Ga0209051_100004015 508
220 3300025935 Ga0207709_10042760 Ga0207709_100427603 508
221 3300026089 Ga0207648_10001151 Ga0207648_1000115132 508
222 3300027907 Ga0207428_10003576 Ga0207428_100035767 508
223 3300028794 Ga0307515_10000776 Ga0307515_1000077660 508
224 3300028794 Ga0307515_10018594 Ga0307515_100185949 508
225 3300028794 Ga0307515_10049943 Ga0307515_100499436 508
226 3300030522 Ga0307512_10019883 Ga0307512_100198834 508
227 3300031548 Ga0307408_100014852 Ga0307408_1000148523 508
228 3300031730 Ga0307516_10016213 Ga0307516_100162136 508
229 3300031731 Ga0307405_10016734 Ga0307405_100167342 508
230 3300031901 Ga0307406_10026081 Ga0307406_100260813 508
231 3300031911 Ga0307412_10000644 Ga0307412_1000064414 508
232 3300032004 Ga0307414_10068860 Ga0307414_100688602 508
233 3300032005 Ga0307411_10000153 Ga0307411_100001538 508
234 3300032005 Ga0307411_10045653 Ga0307411_100456533 508
235 3300041405 Ga0439438_000029 Ga0439438_000029_13006_14535 508
236 3300042010 Ga0439452_009864 Ga0439452_009864_469_1998 508
237 3300042016 Ga0439463_002474 Ga0439463_002474_1360_2886 508
238 3300042120 Ga0450917_000179 Ga0450917_000179_2257_3792 508
239 3300042126 Ga0450888_000094 Ga0450888_000094_319_1854 508
240 3300042129 Ga0450891_002177 Ga0450891_002177_136_1671 508
241 3300042130 Ga0450892_000313 Ga0450892_000313_2877_4412 508
242 3300042144 Ga0450889_000353 Ga0450889_000353_196_1731 508
243 3300042876 Ga0451577_0005239 Ga0451577_0005239_11634_13175 508
244 3300044656 Ga0466969_0001062 Ga0466969_0001062_8339_9883 508
245 3300044694 Ga0466963_0043586 Ga0466963_0043586_843_2387 508
246 3300044719 Ga0466971_0013779 Ga0466971_0013779_1954_3498 508
247 3300044765 Ga0466970_0007223 Ga0466970_0007223_1165_2709 508
248 3300044842 Ga0466957_0009693 Ga0466957_0009693_2161_3705 508
249 3300046457 Ga0495590_0000885 Ga0495590_0000885_10239_11765 508
250 3300046474 Ga0495605_0011974 Ga0495605_0011974_1626_3152 508
251 3300046491 Ga0495584_0001732 Ga0495584_0001732_9745_11271 508
252 3300046501 Ga0495607_0000149 Ga0495607_0000149_9166_10695 508
253 3300046501 Ga0495607_0000298 Ga0495607_0000298_7943_9481 508
254 3300046501 Ga0495607_0047886 Ga0495607_0047886_814_2343 508
255 3300046507 Ga0495606_0000199 Ga0495606_0000199_2507_4036 508
256 3300046507 Ga0495606_0027463 Ga0495606_0027463_758_2284 508
257 3300046512 Ga0495610_0009317 Ga0495610_0009317_903_2432 508
258 3300046515 Ga0495620_0001169 Ga0495620_0001169_8993_10522 508
259 3300046520 Ga0495637_0001506 Ga0495637_0001506_10239_11765 508
260 3300046522 Ga0495643_0031828 Ga0495643_0031828_390_1919 508
261 3300046530 Ga0495654_0001956 Ga0495654_0001956_1767_3293 508
262 3300046542 Ga0495597_0007811 Ga0495597_0007811_3327_4856 508
263 3300046616 Ga0495668_0050606 Ga0495668_0050606_66_1595 508
264 3300046660 Ga0495625_0001208 Ga0495625_0001208_9493_11022 508
265 3300046665 Ga0495661_0007583 Ga0495661_0007583_5218_6747 508
266 3300046665 Ga0495661_0015006 Ga0495661_0015006_1274_2803 508
267 3300047469 Ga0495673_0001903 Ga0495673_0001903_305_1834 508
268 3300047469 Ga0495673_0003076 Ga0495673_0003076_4181_5710 508
269 3300048911 Ga0496108_0102161 Ga0496108_0102161_825_2387 508
270 3300048912 Ga0496109_0046989 Ga0496109_0046989_1607_3169 508
271 3300048914 Ga0496111_0027414 Ga0496111_0027414_743_2305 508
272 3300048927 Ga0496124_0028019 Ga0496124_0028019_1349_2878 508
273 3300049460 Ga0495682_0000030 Ga0495682_0000030_121505_123034 508
274 3300049853 Ga0501226_001626 Ga0501226_001626_181_1707 508
275 3300050496 nmdc:mga07m45_73254_c1 nmdc:mga07m45_73254_c1_408_1937 508

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20629

GD_AH_C

D-galactarate/Altronate dehydratase, C-terminal

281

524

0.98

PF04295

GD_AH_second

D-galactarate dehydratase/Altronate hydrolase, second domain

132

272

0.97

PF08666

SAF

SAF domain

29

101

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.9627 5 87
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.93 5 87
6u7l-assembly2.cif.gz_D 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.9013 5 508
6u7l-assembly2.cif.gz_D 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8975 5 508
6u7l-assembly2.cif.gz_C 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8945 2 508
ID Description Score Start End Superfamily
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.9624 7 87 2.30.130.110
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.929 7 87 2.30.130.110
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.881 7 84 2.30.130.110
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8495 7 84 2.30.130.110
af_Q8UVX0_482_608_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6226 123 252 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q5ZXI8-F1-model_v4 Altronate dehydratase 0.9776 6 83 GO:0016829
GO:0019698
AF-A0A7M2RJ31-F1-model_v4 UxaA family hydrolase 0.9775 5 86 GO:0016787
GO:0016829
GO:0019698
AF-U2SXA8-F1-model_v4 deleted 0.9761 7 88
AF-A0A5D0IZY4-F1-model_v4 UxaA family hydrolase 0.9753 1 86 GO:0016787
GO:0016829
GO:0019698
AF-V7D4U5-F1-model_v4 D-galactarate/Altronate dehydratase C-terminal domain-containing protein 0.9747 384 506 GO:0019698

Feature Viewer

pLDDT pTM Quality
88.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map