F379603

General Info

Members Datasets Scaffolds Average Seq Length
274 185 548 208

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100527049|Ga0068864_1005270492
Length 198
Sequence LKPPSDVDRDATVFVVDDDAAVRSALKLLLHTVGLKASCHETAAGFLEQFDPRVAGCAVLDVRMPGMSGLELQQELNLRGAVLPVIFITGHGDVPMAVEALQHGAFDFLQKPFRDQELIDRIQRALEKDREVRAARFDSLTPREREVLELMTRGRPNKLMAADLSLSQRTVEIHRARVMEKMQAPSLAQLVRMTLELE

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
180 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
183 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 5.11
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100527049 3300005618 Bacteria 1139
2 Ga0065704_10167163 3300005289 Bacteria 1315
3 Ga0065707_10082960 3300005295 Bacteria 11169
4 Ga0070676_10171545 3300005328 Bacteria 1403
5 Ga0070683_100022654 3300005329 Bacteria 5617
6 Ga0070690_100044954 3300005330 Bacteria 2804
7 Ga0070670_100048931 3300005331 Bacteria 3637
8 Ga0070677_10000891 3300005333 Bacteria 9821
9 Ga0068869_100342941 3300005334 Bacteria 1216
10 Ga0068869_100732869 3300005334 Bacteria 845
11 Ga0070666_10004731 3300005335 Bacteria 8324
12 Ga0070666_10165997 3300005335 Bacteria 1544
13 Ga0068868_100914427 3300005338 Bacteria 798
14 Ga0070669_100167203 3300005353 Bacteria 1713
15 Ga0070669_100250633 3300005353 Bacteria 1410
16 Ga0070671_100109726 3300005355 Bacteria 2317
17 Ga0070674_100020142 3300005356 Bacteria 4254
18 Ga0070674_100038019 3300005356 Bacteria 3240
19 Ga0070673_100028345 3300005364 Bacteria 4163
20 Ga0070673_100163278 3300005364 Bacteria 1896
21 Ga0070688_100112178 3300005365 Bacteria 1815
22 Ga0070667_100000486 3300005367 Bacteria 40306
23 Ga0070709_10013660 3300005434 Bacteria 4572
24 Ga0070713_100072922 3300005436 Bacteria 2905
25 Ga0070713_100264533 3300005436 Bacteria 1573
26 Ga0070711_100083800 3300005439 Bacteria 2279
27 Ga0070711_100168839 3300005439 Bacteria 1666
28 Ga0070700_100037540 3300005441 Bacteria 2947
29 Ga0070700_100159359 3300005441 Bacteria 1552
30 Ga0070700_100513569 3300005441 Bacteria 924
31 Ga0070663_100386632 3300005455 Bacteria 1141
32 Ga0070678_100076566 3300005456 Bacteria 2520
33 Ga0070662_100315280 3300005457 Bacteria 1274
34 Ga0070681_10188301 3300005458 Bacteria 1983
35 Ga0070685_10124967 3300005466 Bacteria 1601
36 Ga0070684_100192614 3300005535 Bacteria 1856
37 Ga0070684_100288595 3300005535 Bacteria 1504
38 Ga0070672_100002291 3300005543 Bacteria 12074
39 Ga0070686_100016957 3300005544 Bacteria 4246
40 Ga0070665_100010305 3300005548 Bacteria 9457
41 Ga0070665_100015888 3300005548 Bacteria 7554
42 Ga0070665_100016827 3300005548 Bacteria 7332
43 Ga0070665_100215183 3300005548 Bacteria 1922
44 Ga0070665_100388619 3300005548 Bacteria 1403
45 Ga0068855_100206152 3300005563 Bacteria 2212
46 Ga0070664_100053194 3300005564 Bacteria 3431
47 Ga0068859_100248763 3300005617 Bacteria 1868
48 Ga0068859_100280425 3300005617 Bacteria 1759
49 Ga0068859_100283569 3300005617 Bacteria 1749
50 Ga0068864_100601302 3300005618 Bacteria 1067
51 Ga0068864_100668136 3300005618 Bacteria 1013
52 Ga0068866_10219812 3300005718 Bacteria 1145
53 Ga0068861_100147002 3300005719 Bacteria 1930
54 Ga0068870_10001147 3300005840 Bacteria 10592
55 Ga0068870_10275379 3300005840 Bacteria 1053
56 Ga0068870_10289974 3300005840 Bacteria 1029
57 Ga0068863_100348915 3300005841 Bacteria 1441
58 Ga0068862_100027166 3300005844 Bacteria 4817
59 Ga0068862_100412447 3300005844 Bacteria 1266
60 Ga0081455_10004596 3300005937 Bacteria 15410
61 Ga0070716_100066076 3300006173 Bacteria 2108
62 Ga0070716_100129323 3300006173 Bacteria 1594
63 Ga0070712_100219506 3300006175 Bacteria 1504
64 Ga0097621_100013248 3300006237 Bacteria 6138
65 Ga0097621_100229451 3300006237 Bacteria 1620
66 Ga0097621_100888215 3300006237 Bacteria 829
67 Ga0068871_100032530 3300006358 Bacteria 4122
68 Ga0068871_100242803 3300006358 Bacteria 1566
69 Ga0068865_100036803 3300006881 Bacteria 3302
70 Ga0068865_100062755 3300006881 Bacteria 2609
71 Ga0097620_100248757 3300006931 Bacteria 1868
72 Ga0097620_100280435 3300006931 Bacteria 1759
73 Ga0097620_100283577 3300006931 Bacteria 1749
74 Ga0099794_10085037 3300007265 Bacteria 1564
75 Ga0105240_10004760 3300009093 Bacteria 20491
76 Ga0105240_10203587 3300009093 Bacteria 2318
77 Ga0111539_11683016 3300009094 Bacteria 736
78 Ga0105245_10022338 3300009098 Bacteria 5553
79 Ga0105245_10805233 3300009098 Bacteria 978
80 Ga0105247_10063207 3300009101 Bacteria 2297
81 Ga0105241_10158641 3300009174 Bacteria 1857
82 Ga0105242_10102330 3300009176 Bacteria 2429
83 Ga0105242_10613486 3300009176 Bacteria 1053
84 Ga0105248_10200120 3300009177 Bacteria 2251
85 Ga0105248_11079365 3300009177 Bacteria 907
86 Ga0105237_10018384 3300009545 Bacteria 7232
87 Ga0105237_10169595 3300009545 Bacteria 2182
88 Ga0105237_10198030 3300009545 Bacteria 2008
89 Ga0105237_10218935 3300009545 Bacteria 1904
90 Ga0105238_10037205 3300009551 Bacteria 4948
91 Ga0105238_10091980 3300009551 Bacteria 3020
92 Ga0105238_10147868 3300009551 Bacteria 2325
93 Ga0105238_10273660 3300009551 Bacteria 1669
94 Ga0105238_10552121 3300009551 Unclassified 1156
95 Ga0105238_11032104 3300009551 Bacteria 844
96 Ga0105239_10016741 3300010375 Bacteria 8104
97 Ga0157369_10404605 3300013105 Bacteria 1416
98 Ga0163162_10148571 3300013306 Bacteria 2460
99 Ga0157372_10282000 3300013307 Bacteria 1931
100 Ga0157375_10277433 3300013308 Bacteria 1839
101 Ga0157375_10644016 3300013308 Bacteria 1216
102 Ga0163163_10024587 3300014325 Bacteria 5733
103 Ga0163163_10153206 3300014325 Bacteria 2348
104 Ga0163163_10323588 3300014325 Bacteria 1595
105 Ga0163163_10350953 3300014325 Bacteria 1531
106 Ga0157380_10012088 3300014326 Bacteria 6247
107 Ga0157380_10049541 3300014326 Bacteria 3314
108 Ga0157379_10186094 3300014968 Bacteria 1877
109 Ga0157379_10260630 3300014968 Bacteria 1575
110 Ga0163161_10806999 3300017792 Bacteria 789
111 Ga0213872_10213820 3300021361 Bacteria 823
112 Ga0213871_10008424 3300021441 Bacteria 2275
113 Ga0213871_10012842 3300021441 Bacteria 1956
114 Ga0228598_1030782 3300024227 Bacteria 1056
115 Ga0207697_10056844 3300025315 Bacteria 1624
116 Ga0207682_10001952 3300025893 Bacteria 9367
117 Ga0207642_10024504 3300025899 Bacteria 2426
118 Ga0207710_10060823 3300025900 Bacteria 1713
119 Ga0207680_10020245 3300025903 Bacteria 3576
120 Ga0207680_10120313 3300025903 Bacteria 1716
121 Ga0207699_10006182 3300025906 Bacteria 5775
122 Ga0207645_10148534 3300025907 Bacteria 1529
123 Ga0207645_10362352 3300025907 Bacteria 971
124 Ga0207643_10026829 3300025908 Bacteria 3191
125 Ga0207643_10293288 3300025908 Bacteria 1011
126 Ga0207695_10086933 3300025913 Bacteria 3151
127 Ga0207695_10158378 3300025913 Bacteria 2197
128 Ga0207671_10140647 3300025914 Bacteria 1859
129 Ga0207671_10234573 3300025914 Bacteria 1440
130 Ga0207671_10464170 3300025914 Bacteria 1009
131 Ga0207662_10069772 3300025918 Bacteria 2124
132 Ga0207657_10181439 3300025919 Bacteria 1701
133 Ga0207681_10664978 3300025923 Bacteria 864
134 Ga0207694_10046250 3300025924 Bacteria 3364
135 Ga0207694_10396595 3300025924 Bacteria 1147
136 Ga0207694_10456935 3300025924 Bacteria 1066
137 Ga0207687_10089011 3300025927 Bacteria 2247
138 Ga0207700_10209957 3300025928 Bacteria 1645
139 Ga0207664_10379106 3300025929 Bacteria 1255
140 Ga0207706_10827448 3300025933 Bacteria 785
141 Ga0207686_10126825 3300025934 Bacteria 1745
142 Ga0207669_10018885 3300025937 Bacteria 3577
143 Ga0207704_10071808 3300025938 Bacteria 2198
144 Ga0207704_10140805 3300025938 Bacteria 1687
145 Ga0207704_10253851 3300025938 Bacteria 1322
146 Ga0207689_10007204 3300025942 Bacteria 9770
147 Ga0207689_10151580 3300025942 Bacteria 1911
148 Ga0207689_10167733 3300025942 Bacteria 1809
149 Ga0207651_10021232 3300025960 Bacteria 3941
150 Ga0207658_10001349 3300025986 Bacteria 19209
151 Ga0207677_10131131 3300026023 Bacteria 1903
152 Ga0207678_10201651 3300026067 Bacteria 1701
153 Ga0207708_10064545 3300026075 Bacteria 2797
154 Ga0207708_10158492 3300026075 Bacteria 1786
155 Ga0207708_10201617 3300026075 Bacteria 1587
156 Ga0207702_10248462 3300026078 Bacteria 1669
157 Ga0207648_10305211 3300026089 Bacteria 1428
158 Ga0207676_10800884 3300026095 Bacteria 919
159 Ga0207674_10155360 3300026116 Bacteria 2243
160 Ga0207674_10471864 3300026116 Bacteria 1213
161 Ga0207675_100060590 3300026118 Bacteria 3533
162 Ga0207683_10034640 3300026121 Bacteria 4388
163 Ga0207683_10222065 3300026121 Bacteria 1722
164 Ga0268266_10002673 3300028379 Bacteria 18753
165 Ga0268266_10006898 3300028379 Bacteria 10339
166 Ga0268266_10369200 3300028379 Bacteria 1351
167 Ga0268266_10448793 3300028379 Bacteria 1226
168 Ga0268265_10295118 3300028380 Bacteria 1457
169 Ga0265336_10051397 3300028666 Bacteria 1245
170 Ga0307515_10288264 3300028794 Bacteria 1341
171 Ga0265338_10081586 3300028800 Bacteria 2711
172 Ga0307511_10035789 3300030521 Bacteria 4329
173 Ga0265760_10030204 3300031090 Bacteria 1595
174 Ga0265328_10004814 3300031239 Bacteria 5826
175 Ga0265331_10022890 3300031250 Bacteria 3182
176 Ga0265316_10086512 3300031344 Bacteria 2396
177 Ga0307405_10091028 3300031731 Bacteria 2020
178 Ga0307405_10462735 3300031731 Bacteria 1008
179 Ga0307413_10035775 3300031824 Bacteria 2852
180 Ga0307413_10158352 3300031824 Bacteria 1588
181 Ga0307410_10295884 3300031852 Bacteria 1275
182 Ga0307410_10314906 3300031852 Bacteria 1240
183 Ga0307410_10368862 3300031852 Bacteria 1152
184 Ga0307406_11033688 3300031901 Bacteria 706
185 Ga0307407_10609888 3300031903 Bacteria 813
186 Ga0307412_10939919 3300031911 Bacteria 760
187 Ga0307409_100009638 3300031995 Bacteria 5948
188 Ga0307409_100020305 3300031995 Bacteria 4524
189 Ga0307416_100192779 3300032002 Bacteria 1924
190 Ga0307414_10169711 3300032004 Bacteria 1743
191 Ga0307411_10009674 3300032005 Bacteria 5087
192 Ga0307415_100993868 3300032126 Bacteria 779
193 Ga0307510_10001852 3300033180 Bacteria 23701
194 Ga0373927_0002341 3300035695 Bacteria 13812
195 Ga0436365_1156017 3300039437 Bacteria 973
196 Ga0436360_0071064 3300039438 Bacteria 3418
197 Ga0436360_0440630 3300039438 Bacteria 1361
198 Ga0436360_1273087 3300039438 Bacteria 7310
199 Ga0436360_1316112 3300039438 Bacteria 1527
200 Ga0436361_0877563 3300039447 Bacteria 1551
201 Ga0436361_1081092 3300039447 Bacteria 2483
202 Ga0436362_1238187 3300039453 Bacteria 3228
203 Ga0451789_1238978 3300041443 Bacteria 643
204 Ga0451802_1432906 3300041460 Bacteria 1251
205 Ga0451807_2551487 3300041486 Bacteria 2626
206 Ga0451807_2573373 3300041486 Bacteria 860
207 Ga0451833_1143571 3300041491 Bacteria 1190
208 Ga0466959_0011052 3300045049 Bacteria 6479
209 Ga0495617_091237 3300046452 Bacteria 994
210 Ga0495638_0001431 3300046460 Bacteria 21611
211 Ga0495638_0010939 3300046460 Bacteria 6275
212 Ga0495580_0001923 3300046472 Bacteria 18268
213 Ga0495618_0151891 3300046514 Bacteria 1479
214 Ga0495630_0071116 3300046517 Bacteria 2618
215 Ga0495665_0093238 3300046531 Bacteria 1583
216 Ga0495587_0266784 3300046536 Bacteria 961
217 Ga0495656_0389904 3300046615 Bacteria 727
218 Ga0495599_0057082 3300046678 Bacteria 2443
219 Ga0495671_0010913 3300046692 Bacteria 5020
220 Ga0496102_0000838 3300048905 Bacteria 29555
221 Ga0496102_0060429 3300048905 Bacteria 3466
222 Ga0496105_0046938 3300048908 Bacteria 3564
223 Ga0496106_0584661 3300048909 Bacteria 895
224 Ga0496107_0062590 3300048910 Bacteria 2696
225 Ga0496108_0151113 3300048911 Bacteria 2004
226 Ga0496108_0329239 3300048911 Bacteria 1332
227 Ga0496109_0192018 3300048912 Bacteria 1919
228 Ga0496112_0344189 3300048915 Bacteria 1434
229 Ga0496115_0058660 3300048918 Bacteria 3098
230 Ga0496116_0017732 3300048919 Bacteria 5516
231 Ga0496117_0000044 3300048920 Bacteria 301076
232 Ga0496118_0000025 3300048921 Bacteria 379363
233 Ga0496119_0001121 3300048922 Bacteria 33781
234 Ga0496119_0012571 3300048922 Bacteria 6860
235 Ga0496120_0000014 3300048923 Bacteria 323163
236 Ga0496120_0006443 3300048923 Bacteria 9015
237 Ga0496124_0026543 3300048927 Bacteria 5219
238 Ga0496126_0014101 3300048929 Bacteria 8093
239 Ga0496126_0800889 3300048929 Bacteria 723
240 Ga0501033_0150982 3300049570 Bacteria 1676
241 Ga0501046_0339055 3300049580 Bacteria 1093
242 Ga0501048_0698935 3300049582 Bacteria 728
243 Ga0501067_0014964 3300049583 Bacteria 4293
244 Ga0501068_0002302 3300049584 Bacteria 10168
245 Ga0501068_0200443 3300049584 Bacteria 1266
246 Ga0501068_0320390 3300049584 Bacteria 994
247 Ga0501069_0050780 3300049585 Bacteria 2306
248 Ga0501070_0008040 3300049586 Bacteria 8929
249 Ga0501071_0026410 3300049587 Bacteria 4075
250 Ga0501072_0022036 3300049588 Bacteria 4943
251 Ga0501073_0001686 3300049589 Bacteria 16379
252 Ga0501073_0089142 3300049589 Bacteria 2145
253 Ga0501074_0000768 3300049590 Bacteria 20209
254 Ga0501076_0013183 3300049592 Bacteria 6192
255 Ga0501077_0003134 3300049593 Bacteria 9943
256 Ga0501079_0000385 3300049741 Bacteria 28427
257 Ga0501079_0054342 3300049741 Bacteria 3089
258 Ga0501080_0000663 3300049742 Bacteria 27344
259 Ga0501080_0497104 3300049742 Bacteria 1090
260 Ga0501081_0011917 3300049743 Bacteria 5697
261 Ga0501083_0010212 3300049744 Bacteria 6617
262 nmdc:mga0qj67_1024405_c1 3300050509 Unclassified 647
263 nmdc:mga08x19_521872_c1 3300050514 Bacteria 839
264 Ga0500648_285542 3300053097 Bacteria 739
265 Ga0500556_0000841 3300053104 Bacteria 17615
266 Ga0500558_233096 3300053106 Bacteria 617
267 Ga0500617_056806 3300053124 Bacteria 1738
268 Ga0500559_0065167 3300053136 Bacteria 1632
269 Ga0500588_0024625 3300053146 Bacteria 1663
270 Ga0500639_061291 3300053163 Bacteria 1938
271 Ga0501084_0001297 3300054114 Bacteria 19660
272 Ga0501082_0109409 3300060353 Bacteria 2392
273 Ga0501082_0160360 3300060353 Bacteria 1954
274 Ga0501082_0343478 3300060353 Bacteria 1301
275 Ga0068864_100527049
276 Ga0065704_10167163
277 Ga0065707_10082960
278 Ga0070676_10171545
279 Ga0070683_100022654
280 Ga0070690_100044954
281 Ga0070670_100048931
282 Ga0070677_10000891
283 Ga0068869_100342941
284 Ga0068869_100732869
285 Ga0070666_10004731
286 Ga0070666_10165997
287 Ga0068868_100914427
288 Ga0070669_100167203
289 Ga0070669_100250633
290 Ga0070671_100109726
291 Ga0070674_100020142
292 Ga0070674_100038019
293 Ga0070673_100028345
294 Ga0070673_100163278
295 Ga0070688_100112178
296 Ga0070667_100000486
297 Ga0070709_10013660
298 Ga0070713_100072922
299 Ga0070713_100264533
300 Ga0070711_100083800
301 Ga0070711_100168839
302 Ga0070700_100037540
303 Ga0070700_100159359
304 Ga0070700_100513569
305 Ga0070663_100386632
306 Ga0070678_100076566
307 Ga0070662_100315280
308 Ga0070681_10188301
309 Ga0070685_10124967
310 Ga0070684_100192614
311 Ga0070684_100288595
312 Ga0070672_100002291
313 Ga0070686_100016957
314 Ga0070665_100010305
315 Ga0070665_100015888
316 Ga0070665_100016827
317 Ga0070665_100215183
318 Ga0070665_100388619
319 Ga0068855_100206152
320 Ga0070664_100053194
321 Ga0068859_100248763
322 Ga0068859_100280425
323 Ga0068859_100283569
324 Ga0068864_100601302
325 Ga0068864_100668136
326 Ga0068866_10219812
327 Ga0068861_100147002
328 Ga0068870_10001147
329 Ga0068870_10275379
330 Ga0068870_10289974
331 Ga0068863_100348915
332 Ga0068862_100027166
333 Ga0068862_100412447
334 Ga0081455_10004596
335 Ga0070716_100066076
336 Ga0070716_100129323
337 Ga0070712_100219506
338 Ga0097621_100013248
339 Ga0097621_100229451
340 Ga0097621_100888215
341 Ga0068871_100032530
342 Ga0068871_100242803
343 Ga0068865_100036803
344 Ga0068865_100062755
345 Ga0097620_100248757
346 Ga0097620_100280435
347 Ga0097620_100283577
348 Ga0099794_10085037
349 Ga0105240_10004760
350 Ga0105240_10203587
351 Ga0111539_11683016
352 Ga0105245_10022338
353 Ga0105245_10805233
354 Ga0105247_10063207
355 Ga0105241_10158641
356 Ga0105242_10102330
357 Ga0105242_10613486
358 Ga0105248_10200120
359 Ga0105248_11079365
360 Ga0105237_10018384
361 Ga0105237_10169595
362 Ga0105237_10198030
363 Ga0105237_10218935
364 Ga0105238_10037205
365 Ga0105238_10091980
366 Ga0105238_10147868
367 Ga0105238_10273660
368 Ga0105238_10552121
369 Ga0105238_11032104
370 Ga0105239_10016741
371 Ga0157369_10404605
372 Ga0163162_10148571
373 Ga0157372_10282000
374 Ga0157375_10277433
375 Ga0157375_10644016
376 Ga0163163_10024587
377 Ga0163163_10153206
378 Ga0163163_10323588
379 Ga0163163_10350953
380 Ga0157380_10012088
381 Ga0157380_10049541
382 Ga0157379_10186094
383 Ga0157379_10260630
384 Ga0163161_10806999
385 Ga0213872_10213820
386 Ga0213871_10008424
387 Ga0213871_10012842
388 Ga0228598_1030782
389 Ga0207697_10056844
390 Ga0207682_10001952
391 Ga0207642_10024504
392 Ga0207710_10060823
393 Ga0207680_10020245
394 Ga0207680_10120313
395 Ga0207699_10006182
396 Ga0207645_10148534
397 Ga0207645_10362352
398 Ga0207643_10026829
399 Ga0207643_10293288
400 Ga0207695_10086933
401 Ga0207695_10158378
402 Ga0207671_10140647
403 Ga0207671_10234573
404 Ga0207671_10464170
405 Ga0207662_10069772
406 Ga0207657_10181439
407 Ga0207681_10664978
408 Ga0207694_10046250
409 Ga0207694_10396595
410 Ga0207694_10456935
411 Ga0207687_10089011
412 Ga0207700_10209957
413 Ga0207664_10379106
414 Ga0207706_10827448
415 Ga0207686_10126825
416 Ga0207669_10018885
417 Ga0207704_10071808
418 Ga0207704_10140805
419 Ga0207704_10253851
420 Ga0207689_10007204
421 Ga0207689_10151580
422 Ga0207689_10167733
423 Ga0207651_10021232
424 Ga0207658_10001349
425 Ga0207677_10131131
426 Ga0207678_10201651
427 Ga0207708_10064545
428 Ga0207708_10158492
429 Ga0207708_10201617
430 Ga0207702_10248462
431 Ga0207648_10305211
432 Ga0207676_10800884
433 Ga0207674_10155360
434 Ga0207674_10471864
435 Ga0207675_100060590
436 Ga0207683_10034640
437 Ga0207683_10222065
438 Ga0268266_10002673
439 Ga0268266_10006898
440 Ga0268266_10369200
441 Ga0268266_10448793
442 Ga0268265_10295118
443 Ga0265336_10051397
444 Ga0307515_10288264
445 Ga0265338_10081586
446 Ga0307511_10035789
447 Ga0265760_10030204
448 Ga0265328_10004814
449 Ga0265331_10022890
450 Ga0265316_10086512
451 Ga0307405_10091028
452 Ga0307405_10462735
453 Ga0307413_10035775
454 Ga0307413_10158352
455 Ga0307410_10295884
456 Ga0307410_10314906
457 Ga0307410_10368862
458 Ga0307406_11033688
459 Ga0307407_10609888
460 Ga0307412_10939919
461 Ga0307409_100009638
462 Ga0307409_100020305
463 Ga0307416_100192779
464 Ga0307414_10169711
465 Ga0307411_10009674
466 Ga0307415_100993868
467 Ga0307510_10001852
468 Ga0373927_0002341
469 Ga0436365_1156017
470 Ga0436360_0071064
471 Ga0436360_0440630
472 Ga0436360_1273087
473 Ga0436360_1316112
474 Ga0436361_0877563
475 Ga0436361_1081092
476 Ga0436362_1238187
477 Ga0451789_1238978
478 Ga0451802_1432906
479 Ga0451807_2551487
480 Ga0451807_2573373
481 Ga0451833_1143571
482 Ga0466959_0011052
483 Ga0495617_091237
484 Ga0495638_0001431
485 Ga0495638_0010939
486 Ga0495580_0001923
487 Ga0495618_0151891
488 Ga0495630_0071116
489 Ga0495665_0093238
490 Ga0495587_0266784
491 Ga0495656_0389904
492 Ga0495599_0057082
493 Ga0495671_0010913
494 Ga0496102_0000838
495 Ga0496102_0060429
496 Ga0496105_0046938
497 Ga0496106_0584661
498 Ga0496107_0062590
499 Ga0496108_0151113
500 Ga0496108_0329239
501 Ga0496109_0192018
502 Ga0496112_0344189
503 Ga0496115_0058660
504 Ga0496116_0017732
505 Ga0496117_0000044
506 Ga0496118_0000025
507 Ga0496119_0001121
508 Ga0496119_0012571
509 Ga0496120_0000014
510 Ga0496120_0006443
511 Ga0496124_0026543
512 Ga0496126_0014101
513 Ga0496126_0800889
514 Ga0501033_0150982
515 Ga0501046_0339055
516 Ga0501048_0698935
517 Ga0501067_0014964
518 Ga0501068_0002302
519 Ga0501068_0200443
520 Ga0501068_0320390
521 Ga0501069_0050780
522 Ga0501070_0008040
523 Ga0501071_0026410
524 Ga0501072_0022036
525 Ga0501073_0001686
526 Ga0501073_0089142
527 Ga0501074_0000768
528 Ga0501076_0013183
529 Ga0501077_0003134
530 Ga0501079_0000385
531 Ga0501079_0054342
532 Ga0501080_0000663
533 Ga0501080_0497104
534 Ga0501081_0011917
535 Ga0501083_0010212
536 nmdc:mga0qj67_1024405_c1
537 nmdc:mga08x19_521872_c1
538 Ga0500648_285542
539 Ga0500556_0000841
540 Ga0500558_233096
541 Ga0500617_056806
542 Ga0500559_0065167
543 Ga0500588_0024625
544 Ga0500639_061291
545 Ga0501084_0001297
546 Ga0501082_0109409
547 Ga0501082_0160360
548 Ga0501082_0343478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

13

123

0.99

PF00196

GerE

Bacterial regulatory proteins, luxR family

138

194

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dck-assembly1.cif.gz_A structure of unphosphorylated fixj-n complexed with mn2+ 0.9424 8 125
1ys6-assembly1.cif.gz_B crystal structure of the response regulatory protein prra from mycobacterium tuberculosis 0.9344 8 125
1ys7-assembly1.cif.gz_B crystal structure of the response regulator protein prra complexed with mg2+ 0.9333 8 125
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9311 143 206
1d5w-assembly1.cif.gz_A phosphorylated fixj receiver domain 0.923 8 125
ID Description Score Start End Superfamily
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9919 146 202 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9898 146 202 1.10.10.10
5f64B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 140 205 1.10.10.10
af_P0DMC9_101_196_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.952 146 202 1.10.10.10
1a04B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9464 145 205 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N2V6P5-F1-model_v4 DNA-binding response regulator 0.9769 8 204 GO:0000160
GO:0003677
GO:0006355
AF-A0A4R8IHT5-F1-model_v4 LuxR family two component transcriptional regulator 0.9762 8 205 GO:0000160
GO:0003677
GO:0006355
AF-A0A2N6CJ68-F1-model_v4 DNA-binding response regulator 0.9707 1 205 GO:0000160
GO:0003677
GO:0006355
AF-A0A2A2XU91-F1-model_v4 DNA-binding response regulator 0.9699 8 206 GO:0000160
GO:0003677
GO:0006355
AF-A0A366EVN1-F1-model_v4 LuxR family two component transcriptional regulator 0.9686 6 205 GO:0000160
GO:0006355

Map