F379364

General Info

Members Datasets Scaffolds Average Seq Length
273 177 546 331

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0052077|Ga0500622_0052077_166_1359
Length 397
Sequence MAKPRVLSGVQPTGNLHLGNYLGAIRNWVGLQDSHECLFMLADLHAITVPQNPADLTKNTRETAAAYIACGIDPEKSVIFPQSAVPMHSQLAWILNCHTPLGWLDRMTQFKEKSGTSSDNIFNSLLIAFSKQATKLVKFCEVSSKPTNPNASFDESGLGLHLELTRLKREIINLVEEANVIKNAKLGLYAYPVLMAADILGYHATHVPVGADQKQHLELTRDVAGAFNRAYGEEFFPLPQPIILPTAARVMSLTDGTKKMSKSDPSDYSRITLTDDADAIANKIKKAQTDSDPSLTFDEANRPSVANLLTIYAALSGSTPQKVVEQFATLKTGQFKAQLADLAVEKLSPITAKMRELMADSTTLDAILKRGAEAANSIAQPILSDTMKRVGFLQVHA

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
154 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
161 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
162 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
163 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
164 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
165 2831426010 Nostoc sp. 106C Isolate Unclassified
166 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
167 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
168 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
169 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
170 2849660919 Nostoc sp. T09 Isolate Unclassified
171 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
172 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
173 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
174 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
175 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
176 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
177 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 0
Isolates 6.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0.37
Rhizoplane 1.47
Rhizosphere 83.52
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0052077 3300053156 Bacteria 2106
2 SwRhRL2b_contig_196059 2162886007 Bacteria 1284
3 JGI25407J50210_10047764 3300003373 Bacteria 1088
4 Ga0055541_1005464 3300003841 Bacteria 2216
5 Ga0070658_10013821 3300005327 Bacteria 6477
6 Ga0070658_10117538 3300005327 Bacteria 2208
7 Ga0070680_100000520 3300005336 Bacteria 26276
8 Ga0070680_100002528 3300005336 Bacteria 13549
9 Ga0070680_100022679 3300005336 Bacteria 5003
10 Ga0070660_100066001 3300005339 Bacteria 2817
11 Ga0070667_100129637 3300005367 Bacteria 2200
12 Ga0070709_10046927 3300005434 Bacteria 2688
13 Ga0070709_10194891 3300005434 Bacteria 1431
14 Ga0070714_100019052 3300005435 Bacteria 5585
15 Ga0070714_100052708 3300005435 Bacteria 3470
16 Ga0070713_100090584 3300005436 Bacteria 2629
17 Ga0070713_100170523 3300005436 Bacteria 1949
18 Ga0070710_10006641 3300005437 Bacteria 5564
19 Ga0070710_10048058 3300005437 Bacteria 2382
20 Ga0070711_100305474 3300005439 Bacteria 1266
21 Ga0070708_100040273 3300005445 Bacteria 4091
22 Ga0070708_100056795 3300005445 Bacteria 3483
23 Ga0070662_100010559 3300005457 Bacteria 6068
24 Ga0070681_10000343 3300005458 Bacteria 37554
25 Ga0070681_10007334 3300005458 Bacteria 10772
26 Ga0070681_10038306 3300005458 Bacteria 4807
27 Ga0070681_10108014 3300005458 Bacteria 2723
28 Ga0070681_10212581 3300005458 Bacteria 1850
29 Ga0070681_10240842 3300005458 Bacteria 1723
30 Ga0070706_100232800 3300005467 Bacteria 1720
31 Ga0070706_100496209 3300005467 Bacteria 1136
32 Ga0070707_100020637 3300005468 Bacteria 6217
33 Ga0070698_100044661 3300005471 Bacteria 4536
34 Ga0070698_100118552 3300005471 Bacteria 2608
35 Ga0070699_100293242 3300005518 Bacteria 1459
36 Ga0070679_100000410 3300005530 Bacteria 36467
37 Ga0070679_100022688 3300005530 Bacteria 6137
38 Ga0070679_100033745 3300005530 Bacteria 5068
39 Ga0070679_100237521 3300005530 Bacteria 1781
40 Ga0070679_100248013 3300005530 Unclassified 1737
41 Ga0070697_100031134 3300005536 Bacteria 4289
42 Ga0068855_100006895 3300005563 Bacteria 13782
43 Ga0068855_100025632 3300005563 Bacteria 7053
44 Ga0068856_100012698 3300005614 Bacteria 8155
45 Ga0068856_100095432 3300005614 Bacteria 2962
46 Ga0068856_100181137 3300005614 Bacteria 2120
47 Ga0068852_100364509 3300005616 Bacteria 1414
48 Ga0081455_10152181 3300005937 Bacteria 1782
49 Ga0081538_10007890 3300005981 Bacteria 9121
50 Ga0081538_10012001 3300005981 Bacteria 6979
51 Ga0081538_10058544 3300005981 Bacteria 2233
52 Ga0081539_10000797 3300005985 Bacteria 61227
53 Ga0081539_10025389 3300005985 Bacteria 3817
54 Ga0070717_10081777 3300006028 Bacteria 2713
55 Ga0070717_10366450 3300006028 Bacteria 1290
56 Ga0070716_100040519 3300006173 Bacteria 2592
57 Ga0070712_100083864 3300006175 Bacteria 2315
58 Ga0070712_100202693 3300006175 Bacteria 1560
59 Ga0099795_10002290 3300007788 Bacteria 4464
60 Ga0105240_10002260 3300009093 Bacteria 31236
61 Ga0105240_10003139 3300009093 Bacteria 26001
62 Ga0105240_10004009 3300009093 Bacteria 22686
63 Ga0105240_10190132 3300009093 Bacteria 2415
64 Ga0105240_10260424 3300009093 Bacteria 2001
65 Ga0105240_10339213 3300009093 Bacteria 1708
66 Ga0105240_10423788 3300009093 Bacteria 1494
67 Ga0111539_10436560 3300009094 Bacteria 1525
68 Ga0105241_10355529 3300009174 Bacteria 1273
69 Ga0105248_10001632 3300009177 Bacteria 24933
70 Ga0105248_10075936 3300009177 Bacteria 3777
71 Ga0105237_10021927 3300009545 Bacteria 6560
72 Ga0105237_10237181 3300009545 Bacteria 1825
73 Ga0105238_10006514 3300009551 Bacteria 11619
74 Ga0105035_102166 3300009988 Bacteria 1427
75 Ga0099796_10000426 3300010159 Bacteria 6997
76 Ga0105239_10065732 3300010375 Bacteria 3984
77 Ga0157373_10206007 3300013100 Bacteria 1387
78 Ga0157370_10000944 3300013104 Bacteria 36878
79 Ga0157370_10000971 3300013104 Bacteria 36295
80 Ga0157370_10029653 3300013104 Bacteria 5366
81 Ga0157370_10074536 3300013104 Bacteria 3201
82 Ga0157369_10000788 3300013105 Bacteria 40686
83 Ga0182008_10011096 3300014497 Bacteria 4806
84 Ga0182008_10052379 3300014497 Bacteria 2023
85 Ga0157379_10413253 3300014968 Bacteria 1242
86 Ga0213872_10056978 3300021361 Bacteria 1770
87 Ga0213875_10000081 3300021388 Bacteria 114181
88 Ga0213875_10003026 3300021388 Bacteria 9755
89 Ga0213875_10015747 3300021388 Bacteria 3676
90 Ga0209566_100324 3300025225 Bacteria 43123
91 Ga0209675_1003858 3300025291 Bacteria 6896
92 Ga0209676_1000197 3300025292 Bacteria 135043
93 Ga0209025_1004209 3300025294 Bacteria 12686
94 Ga0207705_10019972 3300025909 Bacteria 4791
95 Ga0207705_10068952 3300025909 Bacteria 2561
96 Ga0207684_10029728 3300025910 Bacteria 4652
97 Ga0207707_10035553 3300025912 Bacteria 4356
98 Ga0207707_10077870 3300025912 Bacteria 2895
99 Ga0207707_10139425 3300025912 Bacteria 2120
100 Ga0207695_10001118 3300025913 Bacteria 46598
101 Ga0207695_10002040 3300025913 Bacteria 30959
102 Ga0207695_10002202 3300025913 Bacteria 29359
103 Ga0207695_10210294 3300025913 Bacteria 1856
104 Ga0207695_10295548 3300025913 Bacteria 1511
105 Ga0207693_10001699 3300025915 Bacteria 19392
106 Ga0207693_10028577 3300025915 Bacteria 4407
107 Ga0207693_10094130 3300025915 Bacteria 2348
108 Ga0207663_10310152 3300025916 Bacteria 1182
109 Ga0207660_10001882 3300025917 Bacteria 13991
110 Ga0207660_10013939 3300025917 Bacteria 5275
111 Ga0207657_10069725 3300025919 Bacteria 2982
112 Ga0207657_10070817 3300025919 Bacteria 2954
113 Ga0207652_10002885 3300025921 Bacteria 14366
114 Ga0207652_10008764 3300025921 Bacteria 8142
115 Ga0207652_10047130 3300025921 Unclassified 3681
116 Ga0207652_10113310 3300025921 Bacteria 2407
117 Ga0207652_10232223 3300025921 Bacteria 1662
118 Ga0207646_10003521 3300025922 Bacteria 17633
119 Ga0207700_10076154 3300025928 Bacteria 2602
120 Ga0207700_10253587 3300025928 Bacteria 1504
121 Ga0207664_10022471 3300025929 Bacteria 4710
122 Ga0207664_10044159 3300025929 Bacteria 3489
123 Ga0207664_10085381 3300025929 Bacteria 2576
124 Ga0207665_10017980 3300025939 Bacteria 4647
125 Ga0207665_10055752 3300025939 Bacteria 2667
126 Ga0207711_10001629 3300025941 Bacteria 20707
127 Ga0207667_10021819 3300025949 Bacteria 7087
128 Ga0207703_10226331 3300026035 Bacteria 1674
129 Ga0207702_10122392 3300026078 Bacteria 2330
130 Ga0268266_10000863 3300028379 Bacteria 39421
131 Ga0268264_10078363 3300028381 Bacteria 2817
132 Ga0265323_10002723 3300028653 Bacteria 7965
133 Ga0265336_10034606 3300028666 Bacteria 1561
134 Ga0265338_10004636 3300028800 Bacteria 18476
135 Ga0265338_10006444 3300028800 Bacteria 14962
136 Ga0265338_10016071 3300028800 Bacteria 8170
137 Ga0265338_10032676 3300028800 Bacteria 5066
138 Ga0265332_10003983 3300031238 Bacteria 7037
139 Ga0265328_10013590 3300031239 Bacteria 3221
140 Ga0265325_10019268 3300031241 Bacteria 3776
141 Ga0265329_10004513 3300031242 Bacteria 5775
142 Ga0265329_10041722 3300031242 Bacteria 1471
143 Ga0265340_10007784 3300031247 Bacteria 5809
144 Ga0265339_10008969 3300031249 Bacteria 6326
145 Ga0265331_10001101 3300031250 Bacteria 20817
146 Ga0265327_10000171 3300031251 Bacteria 139992
147 Ga0265327_10000620 3300031251 Bacteria 58447
148 Ga0265327_10036218 3300031251 Bacteria 2715
149 Ga0265316_10008234 3300031344 Bacteria 9702
150 Ga0265316_10024806 3300031344 Bacteria 5013
151 Ga0265316_10212268 3300031344 Bacteria 1431
152 Ga0265316_10308413 3300031344 Bacteria 1152
153 Ga0316578_10094341 3300031728 Bacteria 1790
154 Ga0307405_10104362 3300031731 Bacteria 1907
155 Ga0307410_10145246 3300031852 Bacteria 1760
156 Ga0373936_0090327 3300035113 Bacteria 1284
157 Ga0373956_0089131 3300035119 Bacteria 1422
158 Ga0373946_0092574 3300035171 Bacteria 1342
159 Ga0373955_0026563 3300035172 Bacteria 2984
160 Ga0316574_0015533 3300035398 Bacteria 4419
161 Ga0373931_0006904 3300035691 Bacteria 5340
162 Ga0373927_0121576 3300035695 Bacteria 1704
163 Ga0373927_0126067 3300035695 Bacteria 1671
164 Ga0373937_0004376 3300036401 Bacteria 11996
165 Ga0316582_0067971 3300036647 Unclassified 2300
166 Ga0316584_0005402 3300036712 Bacteria 8573
167 Ga0316584_0008244 3300036712 Bacteria 7173
168 Ga0373925_0123844 3300037068 Bacteria 2009
169 Ga0395899_0089635 3300037312 Bacteria 2230
170 Ga0395900_0028706 3300037418 Bacteria 5703
171 Ga0395900_0049728 3300037418 Bacteria 4319
172 Ga0395900_0230618 3300037418 Bacteria 1862
173 Ga0395898_0001274 3300037466 Bacteria 37171
174 Ga0395898_0010434 3300037466 Bacteria 9710
175 Ga0395898_0299055 3300037466 Bacteria 1535
176 Ga0395905_0032979 3300037471 Bacteria 4869
177 Ga0436364_0379966 3300037853 Bacteria 26006
178 Ga0436364_0545250 3300037853 Bacteria 4419
179 Ga0436364_0560002 3300037853 Bacteria 93566
180 Ga0436364_0564409 3300037853 Bacteria 26112
181 Ga0395901_0007221 3300038443 Bacteria 11203
182 Ga0395901_0024919 3300038443 Bacteria 6142
183 Ga0400483_035984 3300039062 Bacteria 3560
184 Ga0400483_074130 3300039062 Bacteria 34962
185 Ga0400483_265618 3300039062 Bacteria 6959
186 Ga0436365_0655288 3300039437 Bacteria 3119
187 Ga0436360_1030583 3300039438 Bacteria 1238
188 Ga0436361_0334982 3300039447 Bacteria 1965
189 Ga0436361_0759010 3300039447 Bacteria 4372
190 Ga0436362_0141315 3300039453 Bacteria 2013
191 Ga0436362_0415407 3300039453 Bacteria 2027
192 Ga0436362_1289379 3300039453 Bacteria 1539
193 Ga0439448_0042494 3300042005 Bacteria 1474
194 Ga0453683_0015001 3300044673 Bacteria 5029
195 Ga0466968_0062997 3300044735 Bacteria 1602
196 Ga0495592_0027008 3300046454 Bacteria 4352
197 Ga0495606_0152528 3300046507 Bacteria 1355
198 Ga0495630_0070142 3300046517 Unclassified 2637
199 Ga0495630_0114329 3300046517 Bacteria 2045
200 Ga0495667_0119748 3300046559 Bacteria 1700
201 Ga0495635_0092029 3300046663 Unclassified 2074
202 Ga0495613_0083543 3300046689 Unclassified 2319
203 Ga0495600_0102408 3300046809 Bacteria 1866
204 Ga0495674_0024742 3300047319 Bacteria 5512
205 Ga0495674_0198106 3300047319 Bacteria 1667
206 Ga0495675_0068925 3300047444 Unclassified 2234
207 Ga0495684_0013145 3300047471 Bacteria 6388
208 Ga0495626_0025423 3300048091 Bacteria 2897
209 Ga0496104_0491388 3300048907 Bacteria 1139
210 Ga0496110_0078853 3300048913 Bacteria 2932
211 Ga0496113_0248959 3300048916 Bacteria 1418
212 Ga0496115_0044630 3300048918 Bacteria 3537
213 Ga0501031_0047362 3300049568 Bacteria 2803
214 Ga0501033_0085961 3300049570 Bacteria 2303
215 Ga0501034_0099757 3300049571 Bacteria 2899
216 Ga0501036_0205666 3300049572 Bacteria 1655
217 Ga0501038_0000892 3300049574 Bacteria 26434
218 Ga0501038_0001572 3300049574 Bacteria 21145
219 Ga0501039_0089387 3300049575 Bacteria 2400
220 Ga0501039_0302636 3300049575 Bacteria 1257
221 Ga0501040_0067297 3300049576 Bacteria 2468
222 Ga0501041_0022000 3300049577 Bacteria 3818
223 Ga0501042_0022457 3300049578 Bacteria 4407
224 Ga0501043_0282378 3300049579 Bacteria 1272
225 Ga0501046_0128802 3300049580 Bacteria 1920
226 Ga0501046_0193492 3300049580 Bacteria 1516
227 Ga0501047_0164966 3300049581 Bacteria 2086
228 Ga0501048_0085691 3300049582 Bacteria 2222
229 Ga0501071_0006472 3300049587 Bacteria 7602
230 Ga0501072_0292474 3300049588 Bacteria 1295
231 Ga0501072_0432775 3300049588 Bacteria 1042
232 Ga0501075_0068740 3300049591 Bacteria 2677
233 Ga0501075_0104318 3300049591 Bacteria 2154
234 Ga0501076_0129477 3300049592 Bacteria 2046
235 Ga0501077_0036704 3300049593 Bacteria 3123
236 Ga0501077_0085434 3300049593 Bacteria 2000
237 Ga0501079_0012405 3300049741 Bacteria 6503
238 Ga0501079_0090383 3300049741 Bacteria 2372
239 Ga0501080_0041311 3300049742 Bacteria 4298
240 Ga0501080_0393881 3300049742 Bacteria 1247
241 Ga0501083_0030784 3300049744 Bacteria 3683
242 Ga0501035_0067181 3300049822 Bacteria 3182
243 Ga0501045_0108182 3300049824 Bacteria 2061
244 Ga0501045_0148546 3300049824 Bacteria 1743
245 nmdc:mga03n38_1619_c1 3300050490 Bacteria 6574
246 nmdc:mga08x19_20334_c1 3300050514 Bacteria 4087
247 Ga0495601_0010845 3300053077 Bacteria 5437
248 Ga0500647_0029604 3300053091 Bacteria 2598
249 Ga0500595_019150 3300053119 Bacteria 2489
250 Ga0500588_0000543 3300053146 Bacteria 6127
251 Ga0500616_0009157 3300053153 Bacteria 6047
252 Ga0500622_0065068 3300053156 Bacteria 1853
253 Ga0500552_003104 3300053733 Bacteria 1661
254 Ga0501084_0010369 3300054114 Bacteria 7709
255 Ga0530510_0007498 3300061734 Bacteria 7598
256 2512034854 2511231221 Bacteria 6846400
257 2523103431 2522572158 Bacteria 6514390
258 2524611650 2524023250 Bacteria 5457705
259 2599102725 2597490356 Bacteria 7030811
260 2617916806 2617270889 Bacteria 9064343
261 2831427550 2831426010 Bacteria 8662725
262 2842335580 2842333319 Bacteria 8899485
263 2846952599 2846952575 Bacteria 6587527
264 2848696347 2848694841 Bacteria 9205737
265 2848861089 2848858292 Bacteria 7391279
266 2849663132 2849660919 Bacteria 8251853
267 2886633455 2886627955 Bacteria 7618130
268 2897808766 2897803580 Bacteria 7000062
269 2913845385 2913844669 Bacteria 8381711
270 2913919982 2913912277 Bacteria 9037797
271 2913945038 2913939268 Bacteria 8559644
272 642604016 642555144 Bacteria 9059191
273 8054003702 8054002106 Bacteria 7987183
274 Ga0500622_0052077
275 SwRhRL2b_contig_196059
276 JGI25407J50210_10047764
277 Ga0055541_1005464
278 Ga0070658_10013821
279 Ga0070658_10117538
280 Ga0070680_100000520
281 Ga0070680_100002528
282 Ga0070680_100022679
283 Ga0070660_100066001
284 Ga0070667_100129637
285 Ga0070709_10046927
286 Ga0070709_10194891
287 Ga0070714_100019052
288 Ga0070714_100052708
289 Ga0070713_100090584
290 Ga0070713_100170523
291 Ga0070710_10006641
292 Ga0070710_10048058
293 Ga0070711_100305474
294 Ga0070708_100040273
295 Ga0070708_100056795
296 Ga0070662_100010559
297 Ga0070681_10000343
298 Ga0070681_10007334
299 Ga0070681_10038306
300 Ga0070681_10108014
301 Ga0070681_10212581
302 Ga0070681_10240842
303 Ga0070706_100232800
304 Ga0070706_100496209
305 Ga0070707_100020637
306 Ga0070698_100044661
307 Ga0070698_100118552
308 Ga0070699_100293242
309 Ga0070679_100000410
310 Ga0070679_100022688
311 Ga0070679_100033745
312 Ga0070679_100237521
313 Ga0070679_100248013
314 Ga0070697_100031134
315 Ga0068855_100006895
316 Ga0068855_100025632
317 Ga0068856_100012698
318 Ga0068856_100095432
319 Ga0068856_100181137
320 Ga0068852_100364509
321 Ga0081455_10152181
322 Ga0081538_10007890
323 Ga0081538_10012001
324 Ga0081538_10058544
325 Ga0081539_10000797
326 Ga0081539_10025389
327 Ga0070717_10081777
328 Ga0070717_10366450
329 Ga0070716_100040519
330 Ga0070712_100083864
331 Ga0070712_100202693
332 Ga0099795_10002290
333 Ga0105240_10002260
334 Ga0105240_10003139
335 Ga0105240_10004009
336 Ga0105240_10190132
337 Ga0105240_10260424
338 Ga0105240_10339213
339 Ga0105240_10423788
340 Ga0111539_10436560
341 Ga0105241_10355529
342 Ga0105248_10001632
343 Ga0105248_10075936
344 Ga0105237_10021927
345 Ga0105237_10237181
346 Ga0105238_10006514
347 Ga0105035_102166
348 Ga0099796_10000426
349 Ga0105239_10065732
350 Ga0157373_10206007
351 Ga0157370_10000944
352 Ga0157370_10000971
353 Ga0157370_10029653
354 Ga0157370_10074536
355 Ga0157369_10000788
356 Ga0182008_10011096
357 Ga0182008_10052379
358 Ga0157379_10413253
359 Ga0213872_10056978
360 Ga0213875_10000081
361 Ga0213875_10003026
362 Ga0213875_10015747
363 Ga0209566_100324
364 Ga0209675_1003858
365 Ga0209676_1000197
366 Ga0209025_1004209
367 Ga0207705_10019972
368 Ga0207705_10068952
369 Ga0207684_10029728
370 Ga0207707_10035553
371 Ga0207707_10077870
372 Ga0207707_10139425
373 Ga0207695_10001118
374 Ga0207695_10002040
375 Ga0207695_10002202
376 Ga0207695_10210294
377 Ga0207695_10295548
378 Ga0207693_10001699
379 Ga0207693_10028577
380 Ga0207693_10094130
381 Ga0207663_10310152
382 Ga0207660_10001882
383 Ga0207660_10013939
384 Ga0207657_10069725
385 Ga0207657_10070817
386 Ga0207652_10002885
387 Ga0207652_10008764
388 Ga0207652_10047130
389 Ga0207652_10113310
390 Ga0207652_10232223
391 Ga0207646_10003521
392 Ga0207700_10076154
393 Ga0207700_10253587
394 Ga0207664_10022471
395 Ga0207664_10044159
396 Ga0207664_10085381
397 Ga0207665_10017980
398 Ga0207665_10055752
399 Ga0207711_10001629
400 Ga0207667_10021819
401 Ga0207703_10226331
402 Ga0207702_10122392
403 Ga0268266_10000863
404 Ga0268264_10078363
405 Ga0265323_10002723
406 Ga0265336_10034606
407 Ga0265338_10004636
408 Ga0265338_10006444
409 Ga0265338_10016071
410 Ga0265338_10032676
411 Ga0265332_10003983
412 Ga0265328_10013590
413 Ga0265325_10019268
414 Ga0265329_10004513
415 Ga0265329_10041722
416 Ga0265340_10007784
417 Ga0265339_10008969
418 Ga0265331_10001101
419 Ga0265327_10000171
420 Ga0265327_10000620
421 Ga0265327_10036218
422 Ga0265316_10008234
423 Ga0265316_10024806
424 Ga0265316_10212268
425 Ga0265316_10308413
426 Ga0316578_10094341
427 Ga0307405_10104362
428 Ga0307410_10145246
429 Ga0373936_0090327
430 Ga0373956_0089131
431 Ga0373946_0092574
432 Ga0373955_0026563
433 Ga0316574_0015533
434 Ga0373931_0006904
435 Ga0373927_0121576
436 Ga0373927_0126067
437 Ga0373937_0004376
438 Ga0316582_0067971
439 Ga0316584_0005402
440 Ga0316584_0008244
441 Ga0373925_0123844
442 Ga0395899_0089635
443 Ga0395900_0028706
444 Ga0395900_0049728
445 Ga0395900_0230618
446 Ga0395898_0001274
447 Ga0395898_0010434
448 Ga0395898_0299055
449 Ga0395905_0032979
450 Ga0436364_0379966
451 Ga0436364_0545250
452 Ga0436364_0560002
453 Ga0436364_0564409
454 Ga0395901_0007221
455 Ga0395901_0024919
456 Ga0400483_035984
457 Ga0400483_074130
458 Ga0400483_265618
459 Ga0436365_0655288
460 Ga0436360_1030583
461 Ga0436361_0334982
462 Ga0436361_0759010
463 Ga0436362_0141315
464 Ga0436362_0415407
465 Ga0436362_1289379
466 Ga0439448_0042494
467 Ga0453683_0015001
468 Ga0466968_0062997
469 Ga0495592_0027008
470 Ga0495606_0152528
471 Ga0495630_0070142
472 Ga0495630_0114329
473 Ga0495667_0119748
474 Ga0495635_0092029
475 Ga0495613_0083543
476 Ga0495600_0102408
477 Ga0495674_0024742
478 Ga0495674_0198106
479 Ga0495675_0068925
480 Ga0495684_0013145
481 Ga0495626_0025423
482 Ga0496104_0491388
483 Ga0496110_0078853
484 Ga0496113_0248959
485 Ga0496115_0044630
486 Ga0501031_0047362
487 Ga0501033_0085961
488 Ga0501034_0099757
489 Ga0501036_0205666
490 Ga0501038_0000892
491 Ga0501038_0001572
492 Ga0501039_0089387
493 Ga0501039_0302636
494 Ga0501040_0067297
495 Ga0501041_0022000
496 Ga0501042_0022457
497 Ga0501043_0282378
498 Ga0501046_0128802
499 Ga0501046_0193492
500 Ga0501047_0164966
501 Ga0501048_0085691
502 Ga0501071_0006472
503 Ga0501072_0292474
504 Ga0501072_0432775
505 Ga0501075_0068740
506 Ga0501075_0104318
507 Ga0501076_0129477
508 Ga0501077_0036704
509 Ga0501077_0085434
510 Ga0501079_0012405
511 Ga0501079_0090383
512 Ga0501080_0041311
513 Ga0501080_0393881
514 Ga0501083_0030784
515 Ga0501035_0067181
516 Ga0501045_0108182
517 Ga0501045_0148546
518 nmdc:mga03n38_1619_c1
519 nmdc:mga08x19_20334_c1
520 Ga0495601_0010845
521 Ga0500647_0029604
522 Ga0500595_019150
523 Ga0500588_0000543
524 Ga0500616_0009157
525 Ga0500622_0065068
526 Ga0500552_003104
527 Ga0501084_0010369
528 Ga0530510_0007498
529 2512034854
530 2523103431
531 2524611650
532 2599102725
533 2617916806
534 2831427550
535 2842335580
536 2846952599
537 2848696347
538 2848861089
539 2849663132
540 2886633455
541 2897808766
542 2913845385
543 2913919982
544 2913945038
545 642604016
546 8054003702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

143

348

0.92

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

1

128

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3prh-assembly1.cif.gz_A tryptophanyl-trna synthetase val144pro mutant from b. subtilis 0.9532 1 331
3prh-assembly1.cif.gz_A tryptophanyl-trna synthetase val144pro mutant from b. subtilis 0.9503 1 331
3prh-assembly1.cif.gz_B tryptophanyl-trna synthetase val144pro mutant from b. subtilis 0.9465 1 331
3fi0-assembly5.cif.gz_K crystal structure analysis of b. stearothermophilus tryptophanyl-trna synthetase complexed with tryptophan, amp, and inorganic phosphate 0.9453 1 331
3prh-assembly1.cif.gz_B tryptophanyl-trna synthetase val144pro mutant from b. subtilis 0.9435 1 331
ID Description Score Start End Superfamily
af_Q86A90_13_226_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9657 1 177 3.40.50.620
5ekdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9532 2 180 3.40.50.620
3prhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9521 1 331 3.40.50.620
af_Q86A90_16_374_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9507 5 327 3.40.50.620
3prhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9474 1 331 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7C7WNF5-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9912 1 331 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A258JKG7-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9908 2 315 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A345QS70-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9905 2 331 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A7R7TAD0-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9895 2 332 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A840AP78-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9884 1 332 GO:0004830
GO:0005524
GO:0005829
GO:0006436

Map