F378711

General Info

Members Datasets Scaffolds Average Seq Length
272 199 544 222

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2527291627|2528205331
Length 250
Sequence VLGTLSRVSRSRAAKARIGQDGRVASTDRVRPDVPALTIGILGGSGPQGGGLGLRFAAAGHLVLIGSRSTERGQQAAAALARPGLRIEGAGNATVAERADVVIIAVPWEGHRQTLAALREPLAGKIVIDCVNPLGFDKGGAFALAVPEGSAAQQAAAVLPDSTIVAAFHHVSAVLLADDAVTKIDTDVLVLGDDRAATDLVAALAERIPGMRGIYAGALRNAGQVEALTANLISVNRRYKSHAGLRVTDV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
76 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
86 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 2527291627 Frankia casuarinae Thr Isolate Nodule
175 2508501039 Frankia saprophytica CN3 Isolate Nodule
176 2517572101 Frankia sp. DC12 Isolate Nodule
177 2527291629 Frankia sp. BMG5.23 Isolate Nodule
178 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
179 2576861822 Frankia sp. CeD Isolate Nodule
180 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
181 2619618881 Frankia sp. ACN1ag Isolate Unclassified
182 2619619003 Frankia sp. CpI1-P Isolate Nodule
183 2626541554 Frankia sp. AvcI.1 Isolate Nodule
184 2671180195 Frankia sp. CcI49 Isolate Nodule
185 2684623036 Frankia sp. CgIM4 Isolate Nodule
186 2687453737 Frankia sp. BMG5.36 Isolate Nodule
187 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
188 2710264753 Frankia sp. KB5 Isolate Nodule
189 2773857922 Frankia sp. CcI49 Isolate Nodule
190 2773857924 Frankia sp. CgIS1 Isolate Nodule
191 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
192 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
193 2891562705 Microbispora tritici MT50 Isolate Unclassified
194 637000116 Frankia casuarinae CcI3 Isolate Nodule
195 8002784119 Frankia sp. AgB1.9 Isolate Nodule
196 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
197 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
198 8054920844 Frankia tisae Agncl-8 Isolate Nodule
199 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.97
Metatranscriptomes 1.47
Isolates 9.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 6.99
Rhizoplane 1.1
Rhizosphere 83.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10019508 3300005327 Bacteria 5429
2 Ga0070658_10086805 3300005327 Bacteria 2574
3 Ga0070683_100012733 3300005329 Bacteria 7315
4 Ga0070680_100000358 3300005336 Bacteria 30709
5 Ga0070682_100115568 3300005337 Bacteria 1794
6 Ga0070714_100370088 3300005435 Bacteria 1349
7 Ga0070708_100005430 3300005445 Bacteria 10102
8 Ga0070708_100205238 3300005445 Bacteria 1846
9 Ga0070681_10000093 3300005458 Bacteria 65471
10 Ga0070681_10023228 3300005458 Bacteria 6235
11 Ga0070706_100001244 3300005467 Bacteria 27276
12 Ga0070707_100007765 3300005468 Bacteria 9966
13 Ga0070707_100048779 3300005468 Bacteria 4057
14 Ga0070698_100000309 3300005471 Bacteria 49509
15 Ga0070679_100000086 3300005530 Bacteria 69864
16 Ga0070679_100134983 3300005530 Bacteria 2449
17 Ga0070679_100262715 3300005530 Bacteria 1681
18 Ga0070679_100487912 3300005530 Bacteria 1176
19 Ga0070684_100859726 3300005535 Bacteria 849
20 Ga0070697_100315591 3300005536 Bacteria 1345
21 Ga0068859_100001483 3300005617 Bacteria 23879
22 Ga0068859_100001588 3300005617 Bacteria 23180
23 Ga0068863_100000757 3300005841 Bacteria 32349
24 Ga0068858_100000004 3300005842 Bacteria 336234
25 Ga0068858_100000084 3300005842 Bacteria 98433
26 Ga0068858_100020739 3300005842 Bacteria 6140
27 Ga0068862_100001306 3300005844 Bacteria 23208
28 Ga0081455_10003009 3300005937 Bacteria 19661
29 Ga0081538_10053693 3300005981 Bacteria 2393
30 Ga0081540_1000120 3300005983 Bacteria 83032
31 Ga0070717_10005803 3300006028 Bacteria 9042
32 Ga0075428_100157555 3300006844 Bacteria 2466
33 Ga0075430_100266867 3300006846 Bacteria 1417
34 Ga0075431_100056732 3300006847 Bacteria 4039
35 Ga0075433_10414738 3300006852 Bacteria 1188
36 Ga0075434_100114300 3300006871 Bacteria 2712
37 Ga0075434_100288327 3300006871 Bacteria 1661
38 Ga0075436_100320490 3300006914 Bacteria 1113
39 Ga0097620_100001483 3300006931 Bacteria 23879
40 Ga0097620_100001588 3300006931 Bacteria 23180
41 Ga0075435_100006831 3300007076 Bacteria 8096
42 Ga0111539_10648235 3300009094 Bacteria 1230
43 Ga0105247_10000013 3300009101 Bacteria 287863
44 Ga0105247_10000759 3300009101 Bacteria 24894
45 Ga0114129_10341810 3300009147 Bacteria 1985
46 Ga0105248_10000241 3300009177 Bacteria 63198
47 Ga0105248_10000486 3300009177 Bacteria 45289
48 Ga0105248_10004048 3300009177 Bacteria 16200
49 Ga0105237_10634312 3300009545 Bacteria 1075
50 Ga0105249_10017077 3300009553 Bacteria 6440
51 Ga0105239_10092601 3300010375 Bacteria 3337
52 Ga0157345_1017176 3300012498 Bacteria 702
53 Ga0157369_10018462 3300013105 Bacteria 7819
54 Ga0163163_10002966 3300014325 Bacteria 14357
55 Ga0163163_10173894 3300014325 Bacteria 2200
56 Ga0157379_10000001 3300014968 Bacteria 180484
57 Ga0157379_10000076 3300014968 Bacteria 63779
58 Ga0157379_10474335 3300014968 Bacteria 1157
59 Ga0206354_11228806 3300020081 Bacteria 2000
60 Ga0206353_10241958 3300020082 Bacteria 6663
61 Ga0206353_10707918 3300020082 Bacteria 1315
62 Ga0213875_10124303 3300021388 Bacteria 1206
63 Ga0224712_10029442 3300022467 Bacteria 1972
64 Ga0207710_10000023 3300025900 Bacteria 329909
65 Ga0207710_10000030 3300025900 Bacteria 287870
66 Ga0207685_10114794 3300025905 Bacteria 1173
67 Ga0207705_10094215 3300025909 Bacteria 2196
68 Ga0207684_10001995 3300025910 Bacteria 21035
69 Ga0207707_10000164 3300025912 Bacteria 69878
70 Ga0207707_10203223 3300025912 Bacteria 1727
71 Ga0207693_10144390 3300025915 Bacteria 1871
72 Ga0207660_10002372 3300025917 Bacteria 12391
73 Ga0207657_10029113 3300025919 Bacteria 5032
74 Ga0207652_10000172 3300025921 Bacteria 69878
75 Ga0207652_10021125 3300025921 Bacteria 5370
76 Ga0207652_10282016 3300025921 Bacteria 1499
77 Ga0207646_10000647 3300025922 Bacteria 45144
78 Ga0207646_10089532 3300025922 Bacteria 2754
79 Ga0207664_11114011 3300025929 Bacteria 705
80 Ga0207711_10000282 3300025941 Bacteria 54527
81 Ga0207711_10001427 3300025941 Bacteria 22381
82 Ga0207711_10218341 3300025941 Bacteria 1743
83 Ga0207661_10004263 3300025944 Bacteria 10012
84 Ga0207661_10047435 3300025944 Bacteria 3410
85 Ga0207661_10155238 3300025944 Bacteria 1982
86 Ga0207703_10000003 3300026035 Bacteria 532213
87 Ga0207703_10000011 3300026035 Bacteria 336248
88 Ga0207641_10003599 3300026088 Bacteria 13679
89 Ga0268265_10000024 3300028380 Bacteria 266266
90 Ga0307513_10040215 3300031456 Bacteria 5172
91 Ga0307513_10354756 3300031456 Bacteria 1213
92 Ga0316576_10002939 3300031727 Bacteria 9870
93 Ga0316576_10013814 3300031727 Bacteria 5381
94 Ga0316576_10137754 3300031727 Bacteria 1837
95 Ga0316578_10038821 3300031728 Bacteria 2748
96 Ga0307405_10000566 3300031731 Bacteria 14100
97 Ga0316577_10076358 3300031733 Bacteria 1870
98 Ga0307413_10249558 3300031824 Bacteria 1316
99 Ga0307410_10054979 3300031852 Bacteria 2701
100 Ga0307406_10018601 3300031901 Bacteria 4062
101 Ga0307406_10197880 3300031901 Bacteria 1477
102 Ga0307407_10041627 3300031903 Bacteria 2570
103 Ga0307409_100010750 3300031995 Bacteria 5716
104 Ga0307409_100240925 3300031995 Bacteria 1646
105 Ga0307409_101288097 3300031995 Bacteria 756
106 Ga0307416_100011672 3300032002 Bacteria 5877
107 Ga0307416_100143509 3300032002 Bacteria 2175
108 Ga0307416_100365172 3300032002 Bacteria 1467
109 Ga0307414_10453897 3300032004 Bacteria 1125
110 Ga0307414_11082387 3300032004 Bacteria 740
111 Ga0307411_10126679 3300032005 Bacteria 1859
112 Ga0307411_10170609 3300032005 Bacteria 1640
113 Ga0307415_100000006 3300032126 Bacteria 107919
114 Ga0307415_100069116 3300032126 Bacteria 2475
115 Ga0316583_10023897 3300032133 Bacteria 2182
116 Ga0316580_10060986 3300032139 Bacteria 1158
117 Ga0373936_0055895 3300035113 Bacteria 1603
118 Ga0373953_0007141 3300035117 Bacteria 3724
119 Ga0373946_0298540 3300035171 Bacteria 796
120 Ga0316574_0030945 3300035398 Bacteria 3244
121 Ga0316574_0094518 3300035398 Bacteria 1909
122 Ga0373924_0008378 3300035410 Bacteria 3753
123 Ga0373931_0368821 3300035691 Bacteria 902
124 Ga0373935_0002664 3300035692 Bacteria 10270
125 Ga0373933_0079128 3300035724 Bacteria 2012
126 Ga0316582_0299158 3300036647 Bacteria 1105
127 Ga0316584_0069075 3300036712 Bacteria 2648
128 Ga0373925_0018150 3300037068 Bacteria 5111
129 Ga0395899_0517121 3300037312 Bacteria 772
130 Ga0395900_0099621 3300037418 Bacteria 2985
131 Ga0395900_0125522 3300037418 Bacteria 2632
132 Ga0395900_0162161 3300037418 Bacteria 2280
133 Ga0395898_0016228 3300037466 Bacteria 7625
134 Ga0436364_1546834 3300037853 Bacteria 4511
135 Ga0395901_0001731 3300038443 Bacteria 22539
136 Ga0395901_0070464 3300038443 Bacteria 3642
137 Ga0436365_1473848 3300039437 Bacteria 56626
138 Ga0466972_0078038 3300044658 Bacteria 1577
139 Ga0466966_0026541 3300044684 Bacteria 3781
140 Ga0466961_0223211 3300044693 Bacteria 1161
141 Ga0466963_0031639 3300044694 Bacteria 3421
142 Ga0466963_0291537 3300044694 Bacteria 1147
143 Ga0466960_0023927 3300044901 Bacteria 2749
144 Ga0466959_0052145 3300045049 Bacteria 2997
145 Ga0466967_0111767 3300045976 Bacteria 2511
146 Ga0466967_0196900 3300045976 Bacteria 1907
147 Ga0466967_0202511 3300045976 Bacteria 1880
148 Ga0466967_0263669 3300045976 Bacteria 1649
149 Ga0495629_0003903 3300046459 Bacteria 11218
150 Ga0495641_0011344 3300046461 Bacteria 5085
151 Ga0495653_0014071 3300046463 Bacteria 6524
152 Ga0495582_0034761 3300046473 Bacteria 2770
153 Ga0495662_0002303 3300046476 Bacteria 9626
154 Ga0495664_0015869 3300046477 Bacteria 4285
155 Ga0495608_0087690 3300046511 Bacteria 2015
156 Ga0495618_0046587 3300046514 Bacteria 2736
157 Ga0495630_0025534 3300046517 Bacteria 4370
158 Ga0495652_0262784 3300046529 Bacteria 1273
159 Ga0495665_0006255 3300046531 Bacteria 6423
160 Ga0495640_0147756 3300046533 Bacteria 1511
161 Ga0495587_0008240 3300046536 Bacteria 6709
162 Ga0495645_0070989 3300046543 Bacteria 2512
163 Ga0495667_0053362 3300046559 Bacteria 2662
164 Ga0495668_0013284 3300046616 Bacteria 4864
165 Ga0495634_0038760 3300046642 Bacteria 3247
166 Ga0495625_0050464 3300046660 Bacteria 2986
167 Ga0495635_0112093 3300046663 Bacteria 1863
168 Ga0495623_0085089 3300046679 Bacteria 1951
169 Ga0495646_0025430 3300046680 Bacteria 3723
170 Ga0495669_0001523 3300046684 Bacteria 9548
171 Ga0495613_0006096 3300046689 Bacteria 9020
172 Ga0495624_0004025 3300046690 Bacteria 10817
173 Ga0495581_0008751 3300047315 Bacteria 5860
174 Ga0495581_0067976 3300047315 Bacteria 2060
175 Ga0495675_0001492 3300047444 Bacteria 14171
176 Ga0495675_0017693 3300047444 Bacteria 4518
177 Ga0495593_0017129 3300047673 Bacteria 4078
178 Ga0496102_0025445 3300048905 Bacteria 5269
179 Ga0496109_0030771 3300048912 Bacteria 4811
180 Ga0496116_0000430 3300048919 Bacteria 58902
181 Ga0496117_0007890 3300048920 Bacteria 10233
182 Ga0496117_0333360 3300048920 Bacteria 790
183 Ga0496118_0002122 3300048921 Bacteria 27753
184 Ga0496118_0021853 3300048921 Bacteria 5614
185 Ga0496119_0001843 3300048922 Bacteria 24501
186 Ga0496119_0007833 3300048922 Bacteria 9520
187 Ga0496120_0000103 3300048923 Bacteria 141601
188 Ga0496120_0030296 3300048923 Bacteria 3291
189 Ga0496121_0026745 3300048924 Bacteria 5422
190 Ga0501031_0000070 3300049568 Bacteria 55223
191 Ga0501032_0002042 3300049569 Bacteria 15935
192 Ga0501032_0012563 3300049569 Bacteria 6047
193 Ga0501032_0014266 3300049569 Bacteria 5629
194 Ga0501033_0009644 3300049570 Bacteria 7428
195 Ga0501033_0104641 3300049570 Bacteria 2063
196 Ga0501034_0042202 3300049571 Bacteria 4617
197 Ga0501036_0002970 3300049572 Bacteria 13473
198 Ga0501036_0006292 3300049572 Bacteria 9635
199 Ga0501036_0166615 3300049572 Bacteria 1857
200 Ga0501037_0002614 3300049573 Bacteria 13000
201 Ga0501037_0109000 3300049573 Bacteria 1995
202 Ga0501038_0002995 3300049574 Bacteria 15747
203 Ga0501038_0091059 3300049574 Bacteria 2555
204 Ga0501039_0007623 3300049575 Bacteria 8266
205 Ga0501039_0031239 3300049575 Bacteria 4105
206 Ga0501043_0001406 3300049579 Bacteria 21026
207 Ga0501043_0024195 3300049579 Bacteria 4765
208 Ga0501046_0009754 3300049580 Bacteria 8278
209 Ga0501047_0002928 3300049581 Bacteria 16212
210 Ga0501047_0004724 3300049581 Bacteria 12814
211 Ga0501048_0002383 3300049582 Bacteria 14351
212 Ga0501067_0019583 3300049583 Bacteria 3747
213 Ga0501069_0016135 3300049585 Bacteria 4007
214 Ga0501070_0006606 3300049586 Bacteria 9868
215 Ga0501070_0064264 3300049586 Bacteria 3039
216 Ga0501073_0007997 3300049589 Bacteria 7852
217 Ga0501074_0003340 3300049590 Bacteria 11364
218 Ga0501076_0461559 3300049592 Bacteria 1046
219 Ga0501080_0011123 3300049742 Bacteria 8237
220 Ga0501080_0120690 3300049742 Bacteria 2429
221 Ga0501083_0185466 3300049744 Bacteria 1358
222 Ga0501035_0004506 3300049822 Bacteria 13221
223 Ga0501035_0020987 3300049822 Bacteria 6003
224 Ga0501035_0056984 3300049822 Bacteria 3484
225 Ga0501044_0003691 3300049823 Bacteria 17208
226 Ga0501044_0027972 3300049823 Bacteria 5950
227 Ga0501044_0145298 3300049823 Bacteria 2358
228 nmdc:mga05p37_2523_c1 3300050507 Bacteria 21280
229 nmdc:mga0qj67_181274_c1 3300050509 Bacteria 1710
230 nmdc:mga06r32_66663_c1 3300050510 Bacteria 3474
231 nmdc:mga0n895_44019_c1 3300050512 Bacteria 4354
232 nmdc:mga0n895_53471_c1 3300050512 Bacteria 3968
233 nmdc:mga0rr50_149543_c1 3300050513 Bacteria 1886
234 nmdc:mga0rr50_66114_c1 3300050513 Bacteria 2742
235 nmdc:mga08x19_70296_c1 3300050514 Bacteria 2281
236 nmdc:mga0a205_27224_c1 3300050515 Bacteria 5460
237 Ga0495601_0046243 3300053077 Bacteria 2739
238 Ga0495612_0031315 3300053078 Bacteria 2144
239 Ga0495595_0013948 3300053084 Bacteria 3402
240 Ga0495619_0317031 3300053085 Bacteria 1079
241 Ga0500583_0019743 3300053092 Bacteria 2769
242 Ga0500568_0001444 3300053139 Bacteria 15307
243 Ga0500616_0018584 3300053153 Bacteria 3928
244 Ga0500616_0023191 3300053153 Bacteria 3459
245 Ga0501084_0004554 3300054114 Bacteria 11332
246 Ga0466962_0023266 3300061719 Bacteria 2978
247 2528205331 2527291627 Bacteria 5309833
248 2508678173 2508501039 Bacteria 9978592
249 2517759668 2517572101 Bacteria 6884336
250 2528214787 2527291629 Bacteria 5267418
251 2546950926 2546825537 Bacteria 5389291
252 2579749283 2576861822 Bacteria 5004595
253 2579857101 2579778521 Bacteria 7624758
254 2619858234 2619618881 Bacteria 7521104
255 2620352399 2619619003 Bacteria 7619552
256 2626633843 2626541554 Bacteria 7741902
257 2671833742 2671180195 Bacteria 9757215
258 2686543152 2684623036 Bacteria 5199090
259 2689956648 2687453737 Bacteria 11203906
260 2689993484 2687453743 Bacteria 8361025
261 2710604887 2710264753 Bacteria 5455564
262 2774851898 2773857922 Bacteria 9757215
263 2774866061 2773857924 Bacteria 5256821
264 2856742785 2856741275 Bacteria 8096094
265 2883822571 2883821847 Bacteria 5121194
266 2891565788 2891562705 Bacteria 8039471
267 637880472 637000116 Bacteria 5433628
268 8002785238 8002784119 Bacteria 9788632
269 8003863216 8003856774 Bacteria 7675274
270 8054919972 8054913762 Bacteria 7713009
271 8054924073 8054920844 Bacteria 7068637
272 8055159804 8055157932 Bacteria 6429399
273 Ga0070658_10019508
274 Ga0070658_10086805
275 Ga0070683_100012733
276 Ga0070680_100000358
277 Ga0070682_100115568
278 Ga0070714_100370088
279 Ga0070708_100005430
280 Ga0070708_100205238
281 Ga0070681_10000093
282 Ga0070681_10023228
283 Ga0070706_100001244
284 Ga0070707_100007765
285 Ga0070707_100048779
286 Ga0070698_100000309
287 Ga0070679_100000086
288 Ga0070679_100134983
289 Ga0070679_100262715
290 Ga0070679_100487912
291 Ga0070684_100859726
292 Ga0070697_100315591
293 Ga0068859_100001483
294 Ga0068859_100001588
295 Ga0068863_100000757
296 Ga0068858_100000004
297 Ga0068858_100000084
298 Ga0068858_100020739
299 Ga0068862_100001306
300 Ga0081455_10003009
301 Ga0081538_10053693
302 Ga0081540_1000120
303 Ga0070717_10005803
304 Ga0075428_100157555
305 Ga0075430_100266867
306 Ga0075431_100056732
307 Ga0075433_10414738
308 Ga0075434_100114300
309 Ga0075434_100288327
310 Ga0075436_100320490
311 Ga0097620_100001483
312 Ga0097620_100001588
313 Ga0075435_100006831
314 Ga0111539_10648235
315 Ga0105247_10000013
316 Ga0105247_10000759
317 Ga0114129_10341810
318 Ga0105248_10000241
319 Ga0105248_10000486
320 Ga0105248_10004048
321 Ga0105237_10634312
322 Ga0105249_10017077
323 Ga0105239_10092601
324 Ga0157345_1017176
325 Ga0157369_10018462
326 Ga0163163_10002966
327 Ga0163163_10173894
328 Ga0157379_10000001
329 Ga0157379_10000076
330 Ga0157379_10474335
331 Ga0206354_11228806
332 Ga0206353_10241958
333 Ga0206353_10707918
334 Ga0213875_10124303
335 Ga0224712_10029442
336 Ga0207710_10000023
337 Ga0207710_10000030
338 Ga0207685_10114794
339 Ga0207705_10094215
340 Ga0207684_10001995
341 Ga0207707_10000164
342 Ga0207707_10203223
343 Ga0207693_10144390
344 Ga0207660_10002372
345 Ga0207657_10029113
346 Ga0207652_10000172
347 Ga0207652_10021125
348 Ga0207652_10282016
349 Ga0207646_10000647
350 Ga0207646_10089532
351 Ga0207664_11114011
352 Ga0207711_10000282
353 Ga0207711_10001427
354 Ga0207711_10218341
355 Ga0207661_10004263
356 Ga0207661_10047435
357 Ga0207661_10155238
358 Ga0207703_10000003
359 Ga0207703_10000011
360 Ga0207641_10003599
361 Ga0268265_10000024
362 Ga0307513_10040215
363 Ga0307513_10354756
364 Ga0316576_10002939
365 Ga0316576_10013814
366 Ga0316576_10137754
367 Ga0316578_10038821
368 Ga0307405_10000566
369 Ga0316577_10076358
370 Ga0307413_10249558
371 Ga0307410_10054979
372 Ga0307406_10018601
373 Ga0307406_10197880
374 Ga0307407_10041627
375 Ga0307409_100010750
376 Ga0307409_100240925
377 Ga0307409_101288097
378 Ga0307416_100011672
379 Ga0307416_100143509
380 Ga0307416_100365172
381 Ga0307414_10453897
382 Ga0307414_11082387
383 Ga0307411_10126679
384 Ga0307411_10170609
385 Ga0307415_100000006
386 Ga0307415_100069116
387 Ga0316583_10023897
388 Ga0316580_10060986
389 Ga0373936_0055895
390 Ga0373953_0007141
391 Ga0373946_0298540
392 Ga0316574_0030945
393 Ga0316574_0094518
394 Ga0373924_0008378
395 Ga0373931_0368821
396 Ga0373935_0002664
397 Ga0373933_0079128
398 Ga0316582_0299158
399 Ga0316584_0069075
400 Ga0373925_0018150
401 Ga0395899_0517121
402 Ga0395900_0099621
403 Ga0395900_0125522
404 Ga0395900_0162161
405 Ga0395898_0016228
406 Ga0436364_1546834
407 Ga0395901_0001731
408 Ga0395901_0070464
409 Ga0436365_1473848
410 Ga0466972_0078038
411 Ga0466966_0026541
412 Ga0466961_0223211
413 Ga0466963_0031639
414 Ga0466963_0291537
415 Ga0466960_0023927
416 Ga0466959_0052145
417 Ga0466967_0111767
418 Ga0466967_0196900
419 Ga0466967_0202511
420 Ga0466967_0263669
421 Ga0495629_0003903
422 Ga0495641_0011344
423 Ga0495653_0014071
424 Ga0495582_0034761
425 Ga0495662_0002303
426 Ga0495664_0015869
427 Ga0495608_0087690
428 Ga0495618_0046587
429 Ga0495630_0025534
430 Ga0495652_0262784
431 Ga0495665_0006255
432 Ga0495640_0147756
433 Ga0495587_0008240
434 Ga0495645_0070989
435 Ga0495667_0053362
436 Ga0495668_0013284
437 Ga0495634_0038760
438 Ga0495625_0050464
439 Ga0495635_0112093
440 Ga0495623_0085089
441 Ga0495646_0025430
442 Ga0495669_0001523
443 Ga0495613_0006096
444 Ga0495624_0004025
445 Ga0495581_0008751
446 Ga0495581_0067976
447 Ga0495675_0001492
448 Ga0495675_0017693
449 Ga0495593_0017129
450 Ga0496102_0025445
451 Ga0496109_0030771
452 Ga0496116_0000430
453 Ga0496117_0007890
454 Ga0496117_0333360
455 Ga0496118_0002122
456 Ga0496118_0021853
457 Ga0496119_0001843
458 Ga0496119_0007833
459 Ga0496120_0000103
460 Ga0496120_0030296
461 Ga0496121_0026745
462 Ga0501031_0000070
463 Ga0501032_0002042
464 Ga0501032_0012563
465 Ga0501032_0014266
466 Ga0501033_0009644
467 Ga0501033_0104641
468 Ga0501034_0042202
469 Ga0501036_0002970
470 Ga0501036_0006292
471 Ga0501036_0166615
472 Ga0501037_0002614
473 Ga0501037_0109000
474 Ga0501038_0002995
475 Ga0501038_0091059
476 Ga0501039_0007623
477 Ga0501039_0031239
478 Ga0501043_0001406
479 Ga0501043_0024195
480 Ga0501046_0009754
481 Ga0501047_0002928
482 Ga0501047_0004724
483 Ga0501048_0002383
484 Ga0501067_0019583
485 Ga0501069_0016135
486 Ga0501070_0006606
487 Ga0501070_0064264
488 Ga0501073_0007997
489 Ga0501074_0003340
490 Ga0501076_0461559
491 Ga0501080_0011123
492 Ga0501080_0120690
493 Ga0501083_0185466
494 Ga0501035_0004506
495 Ga0501035_0020987
496 Ga0501035_0056984
497 Ga0501044_0003691
498 Ga0501044_0027972
499 Ga0501044_0145298
500 nmdc:mga05p37_2523_c1
501 nmdc:mga0qj67_181274_c1
502 nmdc:mga06r32_66663_c1
503 nmdc:mga0n895_44019_c1
504 nmdc:mga0n895_53471_c1
505 nmdc:mga0rr50_149543_c1
506 nmdc:mga0rr50_66114_c1
507 nmdc:mga08x19_70296_c1
508 nmdc:mga0a205_27224_c1
509 Ga0495601_0046243
510 Ga0495612_0031315
511 Ga0495595_0013948
512 Ga0495619_0317031
513 Ga0500583_0019743
514 Ga0500568_0001444
515 Ga0500616_0018584
516 Ga0500616_0023191
517 Ga0501084_0004554
518 Ga0466962_0023266
519 2528205331
520 2508678173
521 2517759668
522 2528214787
523 2546950926
524 2579749283
525 2579857101
526 2619858234
527 2620352399
528 2626633843
529 2671833742
530 2686543152
531 2689956648
532 2689993484
533 2710604887
534 2774851898
535 2774866061
536 2856742785
537 2883822571
538 2891565788
539 637880472
540 8002785238
541 8003863216
542 8054919972
543 8054924073
544 8055159804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

38

133

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n2i-assembly2.cif.gz_D f420:nadph oxidoreductase from thermobifida fusca with nadp+ bound 0.9729 5 228
5n2i-assembly2.cif.gz_D f420:nadph oxidoreductase from thermobifida fusca with nadp+ bound 0.9599 5 228
1jay-assembly1.cif.gz_B structure of coenzyme f420h2:nadp+ oxidoreductase (fno) with its substrates bound 0.9405 12 225
1jay-assembly1.cif.gz_B structure of coenzyme f420h2:nadp+ oxidoreductase (fno) with its substrates bound 0.9319 12 225
3alm-assembly2.cif.gz_B crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a 0.8822 12 45
ID Description Score Start End Superfamily
5n2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 5 228 3.40.50.720
5n2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9536 5 228 3.40.50.720
af_Q58896_1_221_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9439 12 228 3.40.50.720
1jayB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9405 12 225 3.40.50.720
1jayB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9319 12 225 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I2W5G7-F1-model_v4 NADPH-dependent F420 reductase 0.9926 98 228
AF-A0A6B3CS60-F1-model_v4 NADPH-dependent F420 reductase 0.9924 122 200
AF-A0A1Q7BZN3-F1-model_v4 NADPH-dependent F420 reductase 0.9916 78 228 GO:0006740
GO:0016651
GO:0050661
GO:0070967
AF-A0A6N7GNU7-F1-model_v4 NADPH-dependent F420 reductase 0.9865 118 228
AF-A0A7W8EK80-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9836 6 228 GO:0005886
GO:0006740
GO:0008823
GO:0015677
GO:0016651
GO:0050661
GO:0052851
GO:0070967

Map