F378692

General Info

Members Datasets Scaffolds Average Seq Length
272 145 544 271

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0000856|Ga0500646_0000856_3138_4049
Length 303
Sequence MGIVADWAQAIKLAAVRSVGRGRRTVRLGPPAADAVPVGVDTNRPSVARVYDYLLGGHNNFVVDRQVAERAIQVNPDAPAAALASRAFVQRAVRYLASEAGIRQFLVLGSGLPTQGNVHEVARAIDRRARVVYVDNDPMVLVHSRALLARDSKAIVVQADIREPDLVLTHPDLGRHLDFKRPIGLLLLAILHHFNDHEDPAGIARRYREALPSGSYVAVSHFVNPGEENPAAARRALTVEKLFADSLGTGRFRMWDEILGYFGDFDLVEPGLVPLPEWRPDPWDRSQQSHTYSTFVGGVGRKR

Samples

Sample ID Description Type Environment
1 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
72 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
81 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
82 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
83 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
84 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
85 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
86 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
87 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
139 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
140 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
141 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
142 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
143 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
144 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
145 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 2.21
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 0.37
Rhizosphere 90.07
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500646_0000856 3300053090 Bacteria 8422
2 JGI25406J46586_10000831 3300003203 Bacteria 14491
3 JGI25406J46586_10007042 3300003203 Bacteria 5157
4 JGI25407J50210_10030582 3300003373 Bacteria 1395
5 JGI25407J50210_10039750 3300003373 Bacteria 1206
6 Ga0070658_10069326 3300005327 Bacteria 2885
7 Ga0070680_100018834 3300005336 Bacteria 5461
8 Ga0070680_100123100 3300005336 Bacteria 2166
9 Ga0070660_100028433 3300005339 Bacteria 4183
10 Ga0070660_100037694 3300005339 Bacteria 3664
11 Ga0070661_100475702 3300005344 Bacteria 997
12 Ga0070709_10067957 3300005434 Bacteria 2290
13 Ga0070714_100000646 3300005435 Bacteria 24733
14 Ga0070714_100106066 3300005435 Bacteria 2482
15 Ga0070714_100116797 3300005435 Bacteria 2369
16 Ga0070714_100590524 3300005435 Bacteria 1066
17 Ga0070713_100032291 3300005436 Bacteria 4180
18 Ga0070713_100087861 3300005436 Bacteria 2667
19 Ga0070708_100114926 3300005445 Bacteria 2477
20 Ga0070681_10418697 3300005458 Bacteria 1251
21 Ga0070706_100038865 3300005467 Bacteria 4392
22 Ga0070706_100038883 3300005467 Bacteria 4391
23 Ga0070698_100006221 3300005471 Bacteria 12992
24 Ga0070698_100008715 3300005471 Bacteria 10927
25 Ga0070699_100215017 3300005518 Bacteria 1712
26 Ga0070679_100010914 3300005530 Bacteria 8632
27 Ga0070679_100017690 3300005530 Bacteria 6900
28 Ga0070684_100202368 3300005535 Bacteria 1809
29 Ga0070664_100198918 3300005564 Bacteria 1788
30 Ga0068852_100382880 3300005616 Bacteria 1380
31 Ga0068860_100561479 3300005843 Bacteria 1144
32 Ga0081455_10029436 3300005937 Bacteria 5007
33 Ga0081455_10057646 3300005937 Bacteria 3291
34 Ga0081538_10002936 3300005981 Bacteria 16276
35 Ga0081538_10003023 3300005981 Bacteria 16015
36 Ga0081538_10010286 3300005981 Bacteria 7681
37 Ga0081538_10038405 3300005981 Bacteria 3089
38 Ga0081538_10039778 3300005981 Bacteria 3010
39 Ga0081538_10086440 3300005981 Bacteria 1641
40 Ga0081539_10000756 3300005985 Bacteria 64265
41 Ga0081539_10006034 3300005985 Bacteria 11869
42 Ga0081539_10015240 3300005985 Bacteria 5602
43 Ga0081539_10048368 3300005985 Bacteria 2419
44 Ga0081539_10130234 3300005985 Bacteria 1237
45 Ga0070717_10113462 3300006028 Bacteria 2314
46 Ga0070717_10136881 3300006028 Bacteria 2110
47 Ga0075432_10006384 3300006058 Bacteria 4010
48 Ga0075427_10000843 3300006194 Bacteria 3754
49 Ga0075428_100002057 3300006844 Bacteria 21695
50 Ga0075428_100074863 3300006844 Bacteria 3698
51 Ga0075428_100646723 3300006844 Bacteria 1128
52 Ga0075430_100004243 3300006846 Bacteria 12109
53 Ga0075430_100025152 3300006846 Bacteria 5063
54 Ga0075431_100004628 3300006847 Bacteria 13510
55 Ga0075431_100079025 3300006847 Bacteria 3396
56 Ga0075431_100274040 3300006847 Bacteria 1709
57 Ga0075431_100594551 3300006847 Bacteria 1091
58 Ga0075433_10037973 3300006852 Bacteria 4157
59 Ga0075433_10327047 3300006852 Bacteria 1356
60 Ga0075434_100160543 3300006871 Bacteria 2267
61 Ga0075429_100007720 3300006880 Bacteria 9338
62 Ga0075429_100015069 3300006880 Bacteria 6700
63 Ga0114129_10002741 3300009147 Bacteria 24556
64 Ga0114129_10137750 3300009147 Bacteria 3348
65 Ga0114129_10308796 3300009147 Bacteria 2106
66 Ga0114129_10353529 3300009147 Bacteria 1946
67 Ga0105249_10249158 3300009553 Bacteria 1760
68 Ga0157370_10056860 3300013104 Bacteria 3723
69 Ga0157370_10072327 3300013104 Bacteria 3254
70 Ga0157369_10047210 3300013105 Bacteria 4677
71 Ga0157369_10055038 3300013105 Bacteria 4295
72 Ga0157372_10872142 3300013307 Bacteria 1045
73 Ga0206352_10559147 3300020078 Bacteria 1069
74 Ga0206350_10046344 3300020080 Bacteria 997
75 Ga0206353_10925541 3300020082 Bacteria 1284
76 Ga0154015_1202118 3300020610 Bacteria 1389
77 Ga0213875_10000403 3300021388 Bacteria 38099
78 Ga0213875_10036799 3300021388 Bacteria 2308
79 Ga0224712_10007331 3300022467 Bacteria 3206
80 Ga0207684_10022949 3300025910 Bacteria 5329
81 Ga0207684_10031428 3300025910 Bacteria 4517
82 Ga0207707_10074729 3300025912 Bacteria 2956
83 Ga0207707_10147740 3300025912 Bacteria 2055
84 Ga0207660_10191857 3300025917 Bacteria 1591
85 Ga0207660_10348206 3300025917 Bacteria 1187
86 Ga0207657_10024854 3300025919 Bacteria 5537
87 Ga0207657_10071140 3300025919 Bacteria 2946
88 Ga0207657_10120324 3300025919 Bacteria 2161
89 Ga0207652_10061557 3300025921 Bacteria 3241
90 Ga0207652_10305348 3300025921 Bacteria 1436
91 Ga0207700_10070783 3300025928 Bacteria 2683
92 Ga0207664_10000359 3300025929 Bacteria 33418
93 Ga0207664_10053380 3300025929 Bacteria 3199
94 Ga0207664_10126487 3300025929 Bacteria 2146
95 Ga0207661_10235643 3300025944 Bacteria 1622
96 Ga0207675_100148147 3300026118 Bacteria 2233
97 Ga0207428_10006711 3300027907 Bacteria 10568
98 Ga0268266_10667411 3300028379 Bacteria 1001
99 Ga0307512_10003792 3300030522 Bacteria 17075
100 Ga0307513_10008171 3300031456 Bacteria 13427
101 Ga0307509_10073470 3300031507 Bacteria 3560
102 Ga0307408_100479915 3300031548 Bacteria 1084
103 Ga0307516_10347189 3300031730 Bacteria 1150
104 Ga0307405_10001109 3300031731 Bacteria 11020
105 Ga0307405_10006256 3300031731 Bacteria 5839
106 Ga0307405_10206386 3300031731 Bacteria 1431
107 Ga0307413_10033439 3300031824 Bacteria 2928
108 Ga0307413_10071449 3300031824 Bacteria 2187
109 Ga0307410_10007346 3300031852 Bacteria 6026
110 Ga0307410_10011401 3300031852 Bacteria 5081
111 Ga0307410_10146488 3300031852 Bacteria 1753
112 Ga0307410_10172228 3300031852 Bacteria 1632
113 Ga0307406_10003746 3300031901 Bacteria 8268
114 Ga0307406_10086149 3300031901 Bacteria 2102
115 Ga0307407_10023399 3300031903 Bacteria 3223
116 Ga0307407_10038342 3300031903 Bacteria 2655
117 Ga0307407_10117064 3300031903 Bacteria 1683
118 Ga0307412_10004995 3300031911 Bacteria 7416
119 Ga0307412_10315749 3300031911 Bacteria 1241
120 Ga0307409_100000816 3300031995 Bacteria 14302
121 Ga0307409_100028932 3300031995 Bacteria 3957
122 Ga0307409_100092084 3300031995 Bacteria 2486
123 Ga0307416_100031343 3300032002 Bacteria 4001
124 Ga0307416_100046769 3300032002 Bacteria 3418
125 Ga0307414_10153789 3300032004 Bacteria 1818
126 Ga0307411_10078448 3300032005 Bacteria 2264
127 Ga0307415_100000014 3300032126 Bacteria 81236
128 Ga0307415_100013385 3300032126 Bacteria 4788
129 Ga0307415_100032671 3300032126 Bacteria 3368
130 Ga0307415_100175295 3300032126 Bacteria 1676
131 Ga0316212_1009132 3300033547 Unclassified 1423
132 Ga0372808_007194 3300036459 Bacteria 1518
133 Ga0373925_0000031 3300037068 Bacteria 145734
134 Ga0373925_0065987 3300037068 Bacteria 2727
135 Ga0395900_0206966 3300037418 Bacteria 1983
136 Ga0395900_0221696 3300037418 Bacteria 1906
137 Ga0395898_0328628 3300037466 Bacteria 1458
138 Ga0395898_0492241 3300037466 Bacteria 1166
139 Ga0395898_0554917 3300037466 Bacteria 1091
140 Ga0395898_0657578 3300037466 Bacteria 990
141 Ga0395905_0137680 3300037471 Bacteria 2297
142 Ga0395905_0473516 3300037471 Bacteria 1151
143 Ga0436364_0174261 3300037853 Bacteria 2818
144 Ga0436364_0757628 3300037853 Bacteria 45455
145 Ga0436364_1362337 3300037853 Bacteria 1225
146 Ga0395901_0005559 3300038443 Bacteria 12754
147 Ga0395901_0098056 3300038443 Bacteria 3073
148 Ga0395901_0133731 3300038443 Bacteria 2606
149 Ga0395901_0174544 3300038443 Bacteria 2254
150 Ga0439448_0018452 3300042005 Bacteria 2138
151 Ga0439448_0124381 3300042005 Bacteria 886
152 Ga0439450_044059 3300042008 Bacteria 1044
153 Ga0439451_008785 3300042009 Bacteria 2047
154 Ga0439454_000433 3300042011 Bacteria 3315
155 Ga0439455_0008013 3300042012 Bacteria 2253
156 Ga0439455_0012869 3300042012 Bacteria 1886
157 Ga0450912_003384 3300042116 Bacteria 1132
158 Ga0450920_019745 3300042122 Bacteria 1295
159 Ga0450893_0021994 3300042532 Bacteria 1103
160 Ga0439440_0052319 3300042993 Bacteria 1023
161 Ga0466963_0122711 3300044694 Bacteria 1789
162 Ga0466957_0033523 3300044842 Bacteria 3081
163 Ga0466957_0180844 3300044842 Bacteria 1377
164 Ga0466967_0055946 3300045976 Bacteria 3477
165 Ga0466967_1345774 3300045976 Bacteria 711
166 Ga0495636_0065753 3300047318 Bacteria 1541
167 Ga0496115_0523580 3300048918 Bacteria 950
168 Ga0496119_0003054 3300048922 Bacteria 17709
169 Ga0496120_0002119 3300048923 Bacteria 21211
170 Ga0496126_0033661 3300048929 Bacteria 4819
171 Ga0496126_0196351 3300048929 Bacteria 1706
172 Ga0501031_0001777 3300049568 Bacteria 13524
173 Ga0501031_0015250 3300049568 Bacteria 4989
174 Ga0501031_0181669 3300049568 Bacteria 1374
175 Ga0501032_0057046 3300049569 Bacteria 2624
176 Ga0501033_0017648 3300049570 Bacteria 5390
177 Ga0501033_0164643 3300049570 Bacteria 1595
178 Ga0501036_0000312 3300049572 Bacteria 33881
179 Ga0501036_0028132 3300049572 Bacteria 4752
180 Ga0501036_0084610 3300049572 Bacteria 2681
181 Ga0501037_0044447 3300049573 Bacteria 3262
182 Ga0501038_0010473 3300049574 Bacteria 8481
183 Ga0501038_0013676 3300049574 Bacteria 7397
184 Ga0501038_0166219 3300049574 Bacteria 1789
185 Ga0501039_0000603 3300049575 Bacteria 25923
186 Ga0501039_0001591 3300049575 Bacteria 16711
187 Ga0501039_0013943 3300049575 Bacteria 6150
188 Ga0501040_0000053 3300049576 Bacteria 53956
189 Ga0501040_0016439 3300049576 Bacteria 4898
190 Ga0501041_0000122 3300049577 Bacteria 32701
191 Ga0501041_0170573 3300049577 Bacteria 1361
192 Ga0501042_0001345 3300049578 Bacteria 14373
193 Ga0501042_0003232 3300049578 Bacteria 10187
194 Ga0501043_0004254 3300049579 Bacteria 11656
195 Ga0501043_0052517 3300049579 Bacteria 3201
196 Ga0501046_0000559 3300049580 Bacteria 36920
197 Ga0501046_0085769 3300049580 Bacteria 2427
198 Ga0501047_0087720 3300049581 Bacteria 2989
199 Ga0501048_0013100 3300049582 Bacteria 6156
200 Ga0501048_0021176 3300049582 Bacteria 4760
201 Ga0501048_0332111 3300049582 Bacteria 1083
202 Ga0501068_0019718 3300049584 Bacteria 3920
203 Ga0501069_0053409 3300049585 Bacteria 2250
204 Ga0501069_0077562 3300049585 Bacteria 1868
205 Ga0501070_0176806 3300049586 Bacteria 1757
206 Ga0501071_0001940 3300049587 Bacteria 12329
207 Ga0501071_0007552 3300049587 Bacteria 7156
208 Ga0501071_0226615 3300049587 Bacteria 1407
209 Ga0501072_0000123 3300049588 Bacteria 57275
210 Ga0501072_0032965 3300049588 Bacteria 4057
211 Ga0501074_0001328 3300049590 Bacteria 16420
212 Ga0501074_0030433 3300049590 Bacteria 3912
213 Ga0501074_0065750 3300049590 Bacteria 2609
214 Ga0501075_0000119 3300049591 Bacteria 38122
215 Ga0501075_0008886 3300049591 Bacteria 7007
216 Ga0501075_0016312 3300049591 Bacteria 5348
217 Ga0501076_0000691 3300049592 Bacteria 21760
218 Ga0501076_0023286 3300049592 Bacteria 4772
219 Ga0501076_0388999 3300049592 Bacteria 1146
220 Ga0501077_0000404 3300049593 Bacteria 26024
221 Ga0501077_0003894 3300049593 Bacteria 8987
222 Ga0501077_0125333 3300049593 Bacteria 1628
223 Ga0501079_0003720 3300049741 Bacteria 11255
224 Ga0501079_0015673 3300049741 Bacteria 5788
225 Ga0501079_0069964 3300049741 Bacteria 2709
226 Ga0501080_0077136 3300049742 Bacteria 3099
227 Ga0501080_0196754 3300049742 Bacteria 1851
228 Ga0501081_0000687 3300049743 Bacteria 19521
229 Ga0501081_0013408 3300049743 Bacteria 5389
230 Ga0501081_0107910 3300049743 Bacteria 1974
231 Ga0501083_0034441 3300049744 Bacteria 3463
232 Ga0501083_0211148 3300049744 Bacteria 1265
233 Ga0501035_0042511 3300049822 Bacteria 4099
234 Ga0501044_0160054 3300049823 Bacteria 2229
235 Ga0501044_0220318 3300049823 Bacteria 1848
236 Ga0501045_0000397 3300049824 Bacteria 26425
237 Ga0501045_0013278 3300049824 Bacteria 5814
238 Ga0501045_0019416 3300049824 Bacteria 4845
239 nmdc:mga05p37_336007_c1 3300050507 Bacteria 1783
240 nmdc:mga05p37_46935_c1 3300050507 Bacteria 5312
241 nmdc:mga05p37_9009_c1 3300050507 Bacteria 11801
242 nmdc:mga05p37_99501_c1 3300050507 Bacteria 3581
243 nmdc:mga09592_213538_c1 3300050508 Bacteria 1672
244 nmdc:mga09592_446190_c1 3300050508 Bacteria 1116
245 nmdc:mga0qj67_177345_c1 3300050509 Bacteria 1731
246 nmdc:mga0qj67_4666_c1 3300050509 Bacteria 9944
247 nmdc:mga06r32_5810_c1 3300050510 Bacteria 11113
248 nmdc:mga08y16_91742_c1 3300050511 Bacteria 3166
249 nmdc:mga0n895_212429_c1 3300050512 Bacteria 1965
250 nmdc:mga0n895_38013_c1 3300050512 Bacteria 4661
251 nmdc:mga0rr50_256782_c1 3300050513 Bacteria 1453
252 nmdc:mga0a205_4033_c1 3300050515 Bacteria 13134
253 Ga0500646_0000171 3300053090 Bacteria 19429
254 Ga0501084_0012069 3300054114 Bacteria 7156
255 Ga0501084_0016371 3300054114 Bacteria 6156
256 Ga0501084_0029438 3300054114 Bacteria 4593
257 Ga0590071_008388 3300059421 Bacteria 2435
258 Ga0501082_0003695 3300060353 Bacteria 13366
259 Ga0501082_0317778 3300060353 Bacteria 1356
260 Ga0530510_0000063 3300061734 Bacteria 52586
261 Ga0530510_0055429 3300061734 Bacteria 2863
262 2676493251 2675903060 Bacteria 10051191
263 2676493261 2675903060 Bacteria 10051191
264 2884700498 2884693830 Bacteria 11273186
265 2891556169 2891554331 Bacteria 8812224
266 2895430671 2895427314 Bacteria 13147766
267 2895430682 2895427314 Bacteria 13147766
268 2895438408 2895427314 Bacteria 13147766
269 2895450282 2895442618 Bacteria 11027144
270 3003005107 3002998708 Bacteria 11715108
271 8055066925 8055066027 Bacteria 9479577
272 8055176833 8055172936 Bacteria 9305943
273 Ga0500646_0000856
274 JGI25406J46586_10000831
275 JGI25406J46586_10007042
276 JGI25407J50210_10030582
277 JGI25407J50210_10039750
278 Ga0070658_10069326
279 Ga0070680_100018834
280 Ga0070680_100123100
281 Ga0070660_100028433
282 Ga0070660_100037694
283 Ga0070661_100475702
284 Ga0070709_10067957
285 Ga0070714_100000646
286 Ga0070714_100106066
287 Ga0070714_100116797
288 Ga0070714_100590524
289 Ga0070713_100032291
290 Ga0070713_100087861
291 Ga0070708_100114926
292 Ga0070681_10418697
293 Ga0070706_100038865
294 Ga0070706_100038883
295 Ga0070698_100006221
296 Ga0070698_100008715
297 Ga0070699_100215017
298 Ga0070679_100010914
299 Ga0070679_100017690
300 Ga0070684_100202368
301 Ga0070664_100198918
302 Ga0068852_100382880
303 Ga0068860_100561479
304 Ga0081455_10029436
305 Ga0081455_10057646
306 Ga0081538_10002936
307 Ga0081538_10003023
308 Ga0081538_10010286
309 Ga0081538_10038405
310 Ga0081538_10039778
311 Ga0081538_10086440
312 Ga0081539_10000756
313 Ga0081539_10006034
314 Ga0081539_10015240
315 Ga0081539_10048368
316 Ga0081539_10130234
317 Ga0070717_10113462
318 Ga0070717_10136881
319 Ga0075432_10006384
320 Ga0075427_10000843
321 Ga0075428_100002057
322 Ga0075428_100074863
323 Ga0075428_100646723
324 Ga0075430_100004243
325 Ga0075430_100025152
326 Ga0075431_100004628
327 Ga0075431_100079025
328 Ga0075431_100274040
329 Ga0075431_100594551
330 Ga0075433_10037973
331 Ga0075433_10327047
332 Ga0075434_100160543
333 Ga0075429_100007720
334 Ga0075429_100015069
335 Ga0114129_10002741
336 Ga0114129_10137750
337 Ga0114129_10308796
338 Ga0114129_10353529
339 Ga0105249_10249158
340 Ga0157370_10056860
341 Ga0157370_10072327
342 Ga0157369_10047210
343 Ga0157369_10055038
344 Ga0157372_10872142
345 Ga0206352_10559147
346 Ga0206350_10046344
347 Ga0206353_10925541
348 Ga0154015_1202118
349 Ga0213875_10000403
350 Ga0213875_10036799
351 Ga0224712_10007331
352 Ga0207684_10022949
353 Ga0207684_10031428
354 Ga0207707_10074729
355 Ga0207707_10147740
356 Ga0207660_10191857
357 Ga0207660_10348206
358 Ga0207657_10024854
359 Ga0207657_10071140
360 Ga0207657_10120324
361 Ga0207652_10061557
362 Ga0207652_10305348
363 Ga0207700_10070783
364 Ga0207664_10000359
365 Ga0207664_10053380
366 Ga0207664_10126487
367 Ga0207661_10235643
368 Ga0207675_100148147
369 Ga0207428_10006711
370 Ga0268266_10667411
371 Ga0307512_10003792
372 Ga0307513_10008171
373 Ga0307509_10073470
374 Ga0307408_100479915
375 Ga0307516_10347189
376 Ga0307405_10001109
377 Ga0307405_10006256
378 Ga0307405_10206386
379 Ga0307413_10033439
380 Ga0307413_10071449
381 Ga0307410_10007346
382 Ga0307410_10011401
383 Ga0307410_10146488
384 Ga0307410_10172228
385 Ga0307406_10003746
386 Ga0307406_10086149
387 Ga0307407_10023399
388 Ga0307407_10038342
389 Ga0307407_10117064
390 Ga0307412_10004995
391 Ga0307412_10315749
392 Ga0307409_100000816
393 Ga0307409_100028932
394 Ga0307409_100092084
395 Ga0307416_100031343
396 Ga0307416_100046769
397 Ga0307414_10153789
398 Ga0307411_10078448
399 Ga0307415_100000014
400 Ga0307415_100013385
401 Ga0307415_100032671
402 Ga0307415_100175295
403 Ga0316212_1009132
404 Ga0372808_007194
405 Ga0373925_0000031
406 Ga0373925_0065987
407 Ga0395900_0206966
408 Ga0395900_0221696
409 Ga0395898_0328628
410 Ga0395898_0492241
411 Ga0395898_0554917
412 Ga0395898_0657578
413 Ga0395905_0137680
414 Ga0395905_0473516
415 Ga0436364_0174261
416 Ga0436364_0757628
417 Ga0436364_1362337
418 Ga0395901_0005559
419 Ga0395901_0098056
420 Ga0395901_0133731
421 Ga0395901_0174544
422 Ga0439448_0018452
423 Ga0439448_0124381
424 Ga0439450_044059
425 Ga0439451_008785
426 Ga0439454_000433
427 Ga0439455_0008013
428 Ga0439455_0012869
429 Ga0450912_003384
430 Ga0450920_019745
431 Ga0450893_0021994
432 Ga0439440_0052319
433 Ga0466963_0122711
434 Ga0466957_0033523
435 Ga0466957_0180844
436 Ga0466967_0055946
437 Ga0466967_1345774
438 Ga0495636_0065753
439 Ga0496115_0523580
440 Ga0496119_0003054
441 Ga0496120_0002119
442 Ga0496126_0033661
443 Ga0496126_0196351
444 Ga0501031_0001777
445 Ga0501031_0015250
446 Ga0501031_0181669
447 Ga0501032_0057046
448 Ga0501033_0017648
449 Ga0501033_0164643
450 Ga0501036_0000312
451 Ga0501036_0028132
452 Ga0501036_0084610
453 Ga0501037_0044447
454 Ga0501038_0010473
455 Ga0501038_0013676
456 Ga0501038_0166219
457 Ga0501039_0000603
458 Ga0501039_0001591
459 Ga0501039_0013943
460 Ga0501040_0000053
461 Ga0501040_0016439
462 Ga0501041_0000122
463 Ga0501041_0170573
464 Ga0501042_0001345
465 Ga0501042_0003232
466 Ga0501043_0004254
467 Ga0501043_0052517
468 Ga0501046_0000559
469 Ga0501046_0085769
470 Ga0501047_0087720
471 Ga0501048_0013100
472 Ga0501048_0021176
473 Ga0501048_0332111
474 Ga0501068_0019718
475 Ga0501069_0053409
476 Ga0501069_0077562
477 Ga0501070_0176806
478 Ga0501071_0001940
479 Ga0501071_0007552
480 Ga0501071_0226615
481 Ga0501072_0000123
482 Ga0501072_0032965
483 Ga0501074_0001328
484 Ga0501074_0030433
485 Ga0501074_0065750
486 Ga0501075_0000119
487 Ga0501075_0008886
488 Ga0501075_0016312
489 Ga0501076_0000691
490 Ga0501076_0023286
491 Ga0501076_0388999
492 Ga0501077_0000404
493 Ga0501077_0003894
494 Ga0501077_0125333
495 Ga0501079_0003720
496 Ga0501079_0015673
497 Ga0501079_0069964
498 Ga0501080_0077136
499 Ga0501080_0196754
500 Ga0501081_0000687
501 Ga0501081_0013408
502 Ga0501081_0107910
503 Ga0501083_0034441
504 Ga0501083_0211148
505 Ga0501035_0042511
506 Ga0501044_0160054
507 Ga0501044_0220318
508 Ga0501045_0000397
509 Ga0501045_0013278
510 Ga0501045_0019416
511 nmdc:mga05p37_336007_c1
512 nmdc:mga05p37_46935_c1
513 nmdc:mga05p37_9009_c1
514 nmdc:mga05p37_99501_c1
515 nmdc:mga09592_213538_c1
516 nmdc:mga09592_446190_c1
517 nmdc:mga0qj67_177345_c1
518 nmdc:mga0qj67_4666_c1
519 nmdc:mga06r32_5810_c1
520 nmdc:mga08y16_91742_c1
521 nmdc:mga0n895_212429_c1
522 nmdc:mga0n895_38013_c1
523 nmdc:mga0rr50_256782_c1
524 nmdc:mga0a205_4033_c1
525 Ga0500646_0000171
526 Ga0501084_0012069
527 Ga0501084_0016371
528 Ga0501084_0029438
529 Ga0590071_008388
530 Ga0501082_0003695
531 Ga0501082_0317778
532 Ga0530510_0000063
533 Ga0530510_0055429
534 2676493251
535 2676493261
536 2884700498
537 2891556169
538 2895430671
539 2895430682
540 2895438408
541 2895450282
542 3003005107
543 8055066925
544 8055176833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04672

Methyltransf_19

S-adenosyl methyltransferase

34

303

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.9083 13 279
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.8984 13 279
2qe6-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tfu_2867) from thermobifida fusca yx at 1.95 a resolution 0.8916 16 278
2qe6-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tfu_2867) from thermobifida fusca yx at 1.95 a resolution 0.8468 16 278
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.7462 63 249
ID Description Score Start End Superfamily
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8871 13 278 3.40.50.150
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8763 13 279 3.40.50.150
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8666 13 279 3.40.50.150
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8515 13 278 3.40.50.150
af_I1K7G0_44_306_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7542 62 237 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H3IXM1-F1-model_v4 S-adenosyl methyltransferase 0.9607 14 278 GO:0008168
GO:0032259
AF-A0A0M8WHN7-F1-model_v4 Methyltransferase 0.9585 14 279
AF-A0A840IYU3-F1-model_v4 O-methyltransferase involved in polyketide biosynthesis 0.9563 5 278 GO:0008168
GO:0032259
AF-A0A1G6UGN6-F1-model_v4 S-adenosyl methyltransferase 0.9513 13 277 GO:0008168
GO:0032259
AF-A0A1T3NJ13-F1-model_v4 Methyltransferase 0.9499 16 279

Map