F378646

General Info

Members Datasets Scaffolds Average Seq Length
272 177 544 310

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0044735|Ga0501033_0044735_451_1452
Length 333
Sequence MTPENQPPARGEAARDPLRRRSKSETELAIDVQGLNKSFGKKHVVKDFSLKVKRGEIYGFLGPNGSGKTTSIRMLCGLLKPDSGSGTCLGHDVVRETAAIKREVGYMTQRFSLWEDLTIRENLEFVARMYGMRERKEAVASALRDLNLYEKQEQLAGTLSGGWKQRLALAACMLHRPKLLLLDEPTAGVDPQARRDFWEEIHALAAKGISVLVATHYMDEAERCHRLAYIAWGKLLATGTPDEVLHLFALRTWAVSGPSARLAALAAELHARPGISHVTAFGNTLHVTGEEDAALEKAVSPYFDEKDLSWKKAEANLEDVFIHLMQSAPEAQA

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
115 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
116 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 1.47
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0044735 3300049570 Bacteria 3295
2 Ga0070658_10469085 3300005327 Bacteria 1086
3 Ga0070670_100085773 3300005331 Bacteria 2706
4 Ga0070677_10013058 3300005333 Bacteria 2896
5 Ga0068869_100017920 3300005334 Bacteria 4812
6 Ga0070680_100080009 3300005336 Bacteria 2695
7 Ga0070689_100054572 3300005340 Bacteria 3093
8 Ga0070689_100085876 3300005340 Bacteria 2475
9 Ga0070692_10012561 3300005345 Bacteria 3924
10 Ga0070669_100075343 3300005353 Bacteria 2502
11 Ga0070675_100017730 3300005354 Bacteria 5663
12 Ga0070675_100136543 3300005354 Bacteria 2093
13 Ga0070674_100250808 3300005356 Bacteria 1390
14 Ga0070659_100019712 3300005366 Bacteria 5117
15 Ga0070659_100073011 3300005366 Bacteria 2731
16 Ga0070667_100084163 3300005367 Bacteria 2726
17 Ga0070710_10171481 3300005437 Bacteria 1352
18 Ga0070694_100009093 3300005444 Bacteria 6093
19 Ga0070694_100115586 3300005444 Bacteria 1918
20 Ga0070694_100280353 3300005444 Bacteria 1270
21 Ga0070678_100318000 3300005456 Bacteria 1328
22 Ga0070662_100061190 3300005457 Bacteria 2748
23 Ga0070662_100072057 3300005457 Bacteria 2550
24 Ga0070681_10455367 3300005458 Bacteria 1192
25 Ga0070681_10520658 3300005458 Bacteria 1103
26 Ga0068867_100091771 3300005459 Bacteria 2306
27 Ga0068867_100229247 3300005459 Bacteria 1501
28 Ga0070707_100312684 3300005468 Bacteria 1527
29 Ga0070699_100012492 3300005518 Bacteria 7327
30 Ga0070684_100013664 3300005535 Bacteria 6553
31 Ga0070684_100389666 3300005535 Bacteria 1284
32 Ga0070672_100008065 3300005543 Bacteria 7197
33 Ga0070672_100135487 3300005543 Bacteria 2028
34 Ga0070686_100023897 3300005544 Bacteria 3658
35 Ga0070686_100067326 3300005544 Bacteria 2333
36 Ga0070695_100005192 3300005545 Bacteria 7683
37 Ga0070695_100079084 3300005545 Bacteria 2169
38 Ga0070695_100102309 3300005545 Bacteria 1931
39 Ga0070696_100200712 3300005546 Bacteria 1489
40 Ga0070665_100038090 3300005548 Bacteria 4833
41 Ga0070665_100284669 3300005548 Bacteria 1655
42 Ga0070665_100412510 3300005548 Bacteria 1359
43 Ga0070704_100005183 3300005549 Bacteria 7579
44 Ga0070704_100133988 3300005549 Bacteria 1925
45 Ga0068856_100076592 3300005614 Bacteria 3314
46 Ga0068859_100032566 3300005617 Bacteria 5236
47 Ga0068859_100060356 3300005617 Bacteria 3821
48 Ga0068864_100117822 3300005618 Bacteria 2371
49 Ga0068864_100215599 3300005618 Bacteria 1769
50 Ga0068863_100035367 3300005841 Bacteria 4758
51 Ga0068858_100127674 3300005842 Bacteria 2383
52 Ga0068860_100243713 3300005843 Bacteria 1749
53 Ga0068860_100438959 3300005843 Bacteria 1296
54 Ga0068862_100223259 3300005844 Bacteria 1706
55 Ga0097621_100002568 3300006237 Bacteria 12439
56 Ga0097621_100101199 3300006237 Bacteria 2424
57 Ga0068871_100017052 3300006358 Bacteria 5487
58 Ga0068871_100021016 3300006358 Bacteria 5009
59 Ga0068871_100050874 3300006358 Bacteria 3353
60 Ga0075430_100040562 3300006846 Bacteria 3941
61 Ga0075431_100057724 3300006847 Bacteria 4003
62 Ga0075433_10193970 3300006852 Bacteria 1807
63 Ga0075434_100000233 3300006871 Bacteria 38350
64 Ga0075434_100033079 3300006871 Bacteria 5101
65 Ga0075434_100346219 3300006871 Bacteria 1507
66 Ga0075436_100008259 3300006914 Bacteria 7121
67 Ga0097620_100032566 3300006931 Bacteria 5236
68 Ga0097620_100060351 3300006931 Bacteria 3821
69 Ga0097620_100067469 3300006931 Bacteria 3611
70 Ga0075435_100236851 3300007076 Bacteria 1551
71 Ga0105240_10003484 3300009093 Bacteria 24415
72 Ga0111539_10098479 3300009094 Bacteria 3434
73 Ga0105247_10168293 3300009101 Bacteria 1455
74 Ga0105242_10051838 3300009176 Bacteria 3346
75 Ga0105248_10090415 3300009177 Bacteria 3447
76 Ga0105237_10042501 3300009545 Bacteria 4583
77 Ga0105249_10024086 3300009553 Bacteria 5468
78 Ga0105249_10143911 3300009553 Bacteria 2289
79 Ga0157373_10334267 3300013100 Bacteria 1079
80 Ga0157378_10066076 3300013297 Bacteria 3238
81 Ga0157375_10256482 3300013308 Bacteria 1910
82 Ga0163163_10358045 3300014325 Bacteria 1516
83 Ga0157380_10061363 3300014326 Bacteria 3008
84 Ga0157380_10444654 3300014326 Bacteria 1243
85 Ga0157377_10027159 3300014745 Bacteria 3071
86 Ga0157376_10060535 3300014969 Bacteria 3180
87 Ga0207710_10093547 3300025900 Bacteria 1410
88 Ga0207688_10047863 3300025901 Bacteria 2388
89 Ga0207684_10119904 3300025910 Bacteria 2255
90 Ga0207707_10353545 3300025912 Bacteria 1266
91 Ga0207695_10011800 3300025913 Bacteria 10543
92 Ga0207660_10042921 3300025917 Bacteria 3176
93 Ga0207646_10220733 3300025922 Bacteria 1712
94 Ga0207681_10050288 3300025923 Bacteria 2820
95 Ga0207681_10095524 3300025923 Bacteria 2132
96 Ga0207659_10016267 3300025926 Bacteria 4838
97 Ga0207659_10027861 3300025926 Bacteria 3832
98 Ga0207644_10319241 3300025931 Bacteria 1256
99 Ga0207706_10080101 3300025933 Bacteria 2872
100 Ga0207706_10221722 3300025933 Bacteria 1656
101 Ga0207691_10004796 3300025940 Bacteria 13085
102 Ga0207691_10103684 3300025940 Bacteria 2536
103 Ga0207689_10003597 3300025942 Bacteria 14156
104 Ga0207712_10086409 3300025961 Bacteria 2297
105 Ga0207658_10161275 3300025986 Bacteria 1838
106 Ga0207703_10054140 3300026035 Bacteria 3263
107 Ga0207708_10035746 3300026075 Bacteria 3781
108 Ga0207708_10075317 3300026075 Bacteria 2588
109 Ga0207702_10497894 3300026078 Bacteria 1188
110 Ga0207641_10047234 3300026088 Bacteria 3630
111 Ga0207641_10066818 3300026088 Bacteria 3078
112 Ga0207641_10099812 3300026088 Bacteria 2555
113 Ga0207676_10174863 3300026095 Bacteria 1874
114 Ga0207675_100224442 3300026118 Bacteria 1811
115 Ga0207683_10105025 3300026121 Bacteria 2525
116 Ga0209967_1000713 3300027364 Bacteria 4274
117 Ga0210000_1000773 3300027462 Bacteria 4428
118 Ga0209999_1001526 3300027543 Bacteria 3979
119 Ga0209983_1008567 3300027665 Bacteria 2092
120 Ga0209974_10014618 3300027876 Bacteria 2610
121 Ga0207428_10237056 3300027907 Bacteria 1364
122 Ga0268266_10359328 3300028379 Bacteria 1370
123 Ga0268265_10032608 3300028380 Bacteria 3777
124 Ga0268264_10078854 3300028381 Bacteria 2809
125 Ga0265338_10028731 3300028800 Bacteria 5537
126 Ga0265340_10017828 3300031247 Bacteria 3673
127 Ga0307408_100089907 3300031548 Bacteria 2316
128 Ga0307413_10051586 3300031824 Bacteria 2479
129 Ga0307413_10113574 3300031824 Bacteria 1818
130 Ga0307410_10047137 3300031852 Bacteria 2878
131 Ga0307407_10006987 3300031903 Bacteria 5074
132 Ga0307407_10053999 3300031903 Bacteria 2314
133 Ga0307412_10122129 3300031911 Bacteria 1877
134 Ga0307409_100002658 3300031995 Bacteria 9411
135 Ga0307409_100036455 3300031995 Bacteria 3615
136 Ga0307409_100145475 3300031995 Bacteria 2049
137 Ga0307409_100233597 3300031995 Bacteria 1669
138 Ga0307409_100280680 3300031995 Bacteria 1539
139 Ga0307416_100086779 3300032002 Bacteria 2669
140 Ga0307416_100103811 3300032002 Bacteria 2483
141 Ga0307416_100378845 3300032002 Bacteria 1444
142 Ga0307414_10018317 3300032004 Bacteria 4307
143 Ga0307414_10046760 3300032004 Bacteria 2973
144 Ga0307414_10114125 3300032004 Bacteria 2063
145 Ga0307411_10002490 3300032005 Bacteria 8174
146 Ga0307411_10024049 3300032005 Bacteria 3623
147 Ga0307415_100003356 3300032126 Bacteria 8131
148 Ga0307415_100050322 3300032126 Bacteria 2823
149 Ga0307415_100452627 3300032126 Bacteria 1110
150 Ga0373923_0063321 3300035111 Bacteria 1575
151 Ga0373936_0045069 3300035113 Bacteria 1776
152 Ga0373954_0007271 3300035118 Bacteria 4840
153 Ga0373943_0043645 3300035170 Bacteria 2178
154 Ga0373942_0003844 3300035207 Bacteria 3512
155 Ga0373931_0058561 3300035691 Bacteria 2069
156 Ga0373937_0015749 3300036401 Bacteria 6697
157 Ga0373937_0152081 3300036401 Bacteria 2168
158 Ga0373937_0404138 3300036401 Bacteria 1296
159 Ga0373925_0109130 3300037068 Bacteria 2136
160 Ga0395900_0244570 3300037418 Bacteria 1798
161 Ga0395905_0000155 3300037471 Bacteria 112355
162 Ga0395905_0023671 3300037471 Bacteria 5799
163 Ga0395905_0031086 3300037471 Bacteria 5028
164 Ga0395905_0091661 3300037471 Bacteria 2849
165 Ga0395905_0301453 3300037471 Bacteria 1490
166 Ga0395905_0301635 3300037471 Bacteria 1489
167 Ga0395901_0611325 3300038443 Bacteria 1098
168 Ga0451807_1157955 3300041486 Bacteria 1681
169 Ga0439441_002824 3300042001 Bacteria 2487
170 Ga0439451_003114 3300042009 Bacteria 3368
171 Ga0439434_0017298 3300042435 Bacteria 2157
172 Ga0439435_0002688 3300042436 Bacteria 3576
173 Ga0439435_0012802 3300042436 Bacteria 2041
174 Ga0439460_0008418 3300042461 Bacteria 2606
175 Ga0466969_0005301 3300044656 Bacteria 6861
176 Ga0466966_0001465 3300044684 Bacteria 15189
177 Ga0466966_0073663 3300044684 Bacteria 2135
178 Ga0466961_0004887 3300044693 Bacteria 8428
179 Ga0466963_0131440 3300044694 Bacteria 1729
180 Ga0466963_0196572 3300044694 Bacteria 1410
181 Ga0466959_0000315 3300045049 Bacteria 28795
182 Ga0466959_0010642 3300045049 Bacteria 6588
183 Ga0451576_0318203 3300045051 Bacteria 1628
184 Ga0466958_0028176 3300045836 Bacteria 3329
185 Ga0466958_0056339 3300045836 Bacteria 2387
186 Ga0466967_0009548 3300045976 Bacteria 7207
187 Ga0466967_0416708 3300045976 Bacteria 1308
188 Ga0495629_0017429 3300046459 Bacteria 5147
189 Ga0495580_0006621 3300046472 Bacteria 9413
190 Ga0495582_0012935 3300046473 Bacteria 4598
191 Ga0495664_0012614 3300046477 Bacteria 4789
192 Ga0495652_0079540 3300046529 Bacteria 2710
193 Ga0495587_0124116 3300046536 Bacteria 1478
194 Ga0495621_0000490 3300046539 Bacteria 9755
195 Ga0495621_0086354 3300046539 Bacteria 1177
196 Ga0495656_0060640 3300046615 Bacteria 1649
197 Ga0495659_0019713 3300046664 Bacteria 2258
198 Ga0495659_0027824 3300046664 Bacteria 1953
199 Ga0495599_0264536 3300046678 Bacteria 1044
200 Ga0495675_0043868 3300047444 Bacteria 2848
201 Ga0495602_0032861 3300048088 Bacteria 4878
202 Ga0496110_0024310 3300048913 Bacteria 5163
203 Ga0496111_0321014 3300048914 Bacteria 1147
204 Ga0496114_0276156 3300048917 Bacteria 1481
205 Ga0501036_0010474 3300049572 Bacteria 7660
206 Ga0501036_0042678 3300049572 Bacteria 3840
207 Ga0501036_0063864 3300049572 Bacteria 3117
208 Ga0501036_0102417 3300049572 Bacteria 2422
209 Ga0501038_0004736 3300049574 Bacteria 12656
210 Ga0501038_0022945 3300049574 Bacteria 5586
211 Ga0501038_0340692 3300049574 Bacteria 1169
212 Ga0501039_0035259 3300049575 Bacteria 3860
213 Ga0501039_0103449 3300049575 Bacteria 2223
214 Ga0501040_0000848 3300049576 Bacteria 19181
215 Ga0501040_0081653 3300049576 Bacteria 2240
216 Ga0501041_0009183 3300049577 Bacteria 5825
217 Ga0501041_0027316 3300049577 Bacteria 3439
218 Ga0501041_0028080 3300049577 Bacteria 3393
219 Ga0501041_0040468 3300049577 Bacteria 2829
220 Ga0501042_0015984 3300049578 Bacteria 5149
221 Ga0501043_0033872 3300049579 Bacteria 4019
222 Ga0501043_0137917 3300049579 Bacteria 1911
223 Ga0501046_0052466 3300049580 Bacteria 3214
224 Ga0501047_0051948 3300049581 Bacteria 3961
225 Ga0501047_0202795 3300049581 Bacteria 1844
226 Ga0501048_0003325 3300049582 Bacteria 12242
227 Ga0501048_0035445 3300049582 Bacteria 3592
228 Ga0501048_0043375 3300049582 Bacteria 3220
229 Ga0501048_0345983 3300049582 Bacteria 1060
230 Ga0501067_0004918 3300049583 Bacteria 7426
231 Ga0501069_0003926 3300049585 Bacteria 7667
232 Ga0501070_0016775 3300049586 Bacteria 6147
233 Ga0501070_0070700 3300049586 Bacteria 2890
234 Ga0501072_0002020 3300049588 Bacteria 15097
235 Ga0501072_0076468 3300049588 Bacteria 2649
236 Ga0501072_0141261 3300049588 Bacteria 1920
237 Ga0501073_0189869 3300049589 Bacteria 1421
238 Ga0501074_0298878 3300049590 Bacteria 1143
239 Ga0501075_0004546 3300049591 Bacteria 9402
240 Ga0501075_0045879 3300049591 Bacteria 3281
241 Ga0501075_0129864 3300049591 Bacteria 1919
242 Ga0501076_0000444 3300049592 Bacteria 26168
243 Ga0501077_0007426 3300049593 Bacteria 6762
244 Ga0501077_0175250 3300049593 Bacteria 1363
245 Ga0501077_0205225 3300049593 Bacteria 1252
246 Ga0501079_0002288 3300049741 Bacteria 13844
247 Ga0501079_0005175 3300049741 Bacteria 9696
248 Ga0501080_0020088 3300049742 Bacteria 6181
249 Ga0501081_0015960 3300049743 Bacteria 4959
250 Ga0501035_0010912 3300049822 Bacteria 8413
251 Ga0501045_0051316 3300049824 Bacteria 3010
252 Ga0501045_0089935 3300049824 Bacteria 2268
253 nmdc:mga0qj67_32568_c1 3300050509 Bacteria 4066
254 nmdc:mga06r32_98480_c1 3300050510 Bacteria 2866
255 nmdc:mga08y16_80811_c1 3300050511 Bacteria 3389
256 nmdc:mga0n895_10423_c1 3300050512 Bacteria 8209
257 nmdc:mga0n895_7141_c1 3300050512 Bacteria 9551
258 nmdc:mga0rr50_2199_c1 3300050513 Bacteria 10935
259 nmdc:mga0rr50_88424_c1 3300050513 Bacteria 2407
260 nmdc:mga08x19_4852_c1 3300050514 Bacteria 7950
261 nmdc:mga08x19_53260_c1 3300050514 Bacteria 2603
262 Ga0500635_0001510 3300053080 Bacteria 5592
263 Ga0501084_0004484 3300054114 Bacteria 11403
264 Ga0501084_0027065 3300054114 Bacteria 4791
265 Ga0501082_0003465 3300060353 Bacteria 13760
266 Ga0501082_0034696 3300060353 Bacteria 4349
267 Ga0501082_0279223 3300060353 Bacteria 1454
268 Ga0466962_0004852 3300061719 Bacteria 6474
269 Ga0466962_0088201 3300061719 Bacteria 1486
270 Ga0530510_0000916 3300061734 Bacteria 19450
271 Ga0530510_0004821 3300061734 Bacteria 9337
272 2739790195 2739367756 Bacteria 4553612
273 Ga0501033_0044735
274 Ga0070658_10469085
275 Ga0070670_100085773
276 Ga0070677_10013058
277 Ga0068869_100017920
278 Ga0070680_100080009
279 Ga0070689_100054572
280 Ga0070689_100085876
281 Ga0070692_10012561
282 Ga0070669_100075343
283 Ga0070675_100017730
284 Ga0070675_100136543
285 Ga0070674_100250808
286 Ga0070659_100019712
287 Ga0070659_100073011
288 Ga0070667_100084163
289 Ga0070710_10171481
290 Ga0070694_100009093
291 Ga0070694_100115586
292 Ga0070694_100280353
293 Ga0070678_100318000
294 Ga0070662_100061190
295 Ga0070662_100072057
296 Ga0070681_10455367
297 Ga0070681_10520658
298 Ga0068867_100091771
299 Ga0068867_100229247
300 Ga0070707_100312684
301 Ga0070699_100012492
302 Ga0070684_100013664
303 Ga0070684_100389666
304 Ga0070672_100008065
305 Ga0070672_100135487
306 Ga0070686_100023897
307 Ga0070686_100067326
308 Ga0070695_100005192
309 Ga0070695_100079084
310 Ga0070695_100102309
311 Ga0070696_100200712
312 Ga0070665_100038090
313 Ga0070665_100284669
314 Ga0070665_100412510
315 Ga0070704_100005183
316 Ga0070704_100133988
317 Ga0068856_100076592
318 Ga0068859_100032566
319 Ga0068859_100060356
320 Ga0068864_100117822
321 Ga0068864_100215599
322 Ga0068863_100035367
323 Ga0068858_100127674
324 Ga0068860_100243713
325 Ga0068860_100438959
326 Ga0068862_100223259
327 Ga0097621_100002568
328 Ga0097621_100101199
329 Ga0068871_100017052
330 Ga0068871_100021016
331 Ga0068871_100050874
332 Ga0075430_100040562
333 Ga0075431_100057724
334 Ga0075433_10193970
335 Ga0075434_100000233
336 Ga0075434_100033079
337 Ga0075434_100346219
338 Ga0075436_100008259
339 Ga0097620_100032566
340 Ga0097620_100060351
341 Ga0097620_100067469
342 Ga0075435_100236851
343 Ga0105240_10003484
344 Ga0111539_10098479
345 Ga0105247_10168293
346 Ga0105242_10051838
347 Ga0105248_10090415
348 Ga0105237_10042501
349 Ga0105249_10024086
350 Ga0105249_10143911
351 Ga0157373_10334267
352 Ga0157378_10066076
353 Ga0157375_10256482
354 Ga0163163_10358045
355 Ga0157380_10061363
356 Ga0157380_10444654
357 Ga0157377_10027159
358 Ga0157376_10060535
359 Ga0207710_10093547
360 Ga0207688_10047863
361 Ga0207684_10119904
362 Ga0207707_10353545
363 Ga0207695_10011800
364 Ga0207660_10042921
365 Ga0207646_10220733
366 Ga0207681_10050288
367 Ga0207681_10095524
368 Ga0207659_10016267
369 Ga0207659_10027861
370 Ga0207644_10319241
371 Ga0207706_10080101
372 Ga0207706_10221722
373 Ga0207691_10004796
374 Ga0207691_10103684
375 Ga0207689_10003597
376 Ga0207712_10086409
377 Ga0207658_10161275
378 Ga0207703_10054140
379 Ga0207708_10035746
380 Ga0207708_10075317
381 Ga0207702_10497894
382 Ga0207641_10047234
383 Ga0207641_10066818
384 Ga0207641_10099812
385 Ga0207676_10174863
386 Ga0207675_100224442
387 Ga0207683_10105025
388 Ga0209967_1000713
389 Ga0210000_1000773
390 Ga0209999_1001526
391 Ga0209983_1008567
392 Ga0209974_10014618
393 Ga0207428_10237056
394 Ga0268266_10359328
395 Ga0268265_10032608
396 Ga0268264_10078854
397 Ga0265338_10028731
398 Ga0265340_10017828
399 Ga0307408_100089907
400 Ga0307413_10051586
401 Ga0307413_10113574
402 Ga0307410_10047137
403 Ga0307407_10006987
404 Ga0307407_10053999
405 Ga0307412_10122129
406 Ga0307409_100002658
407 Ga0307409_100036455
408 Ga0307409_100145475
409 Ga0307409_100233597
410 Ga0307409_100280680
411 Ga0307416_100086779
412 Ga0307416_100103811
413 Ga0307416_100378845
414 Ga0307414_10018317
415 Ga0307414_10046760
416 Ga0307414_10114125
417 Ga0307411_10002490
418 Ga0307411_10024049
419 Ga0307415_100003356
420 Ga0307415_100050322
421 Ga0307415_100452627
422 Ga0373923_0063321
423 Ga0373936_0045069
424 Ga0373954_0007271
425 Ga0373943_0043645
426 Ga0373942_0003844
427 Ga0373931_0058561
428 Ga0373937_0015749
429 Ga0373937_0152081
430 Ga0373937_0404138
431 Ga0373925_0109130
432 Ga0395900_0244570
433 Ga0395905_0000155
434 Ga0395905_0023671
435 Ga0395905_0031086
436 Ga0395905_0091661
437 Ga0395905_0301453
438 Ga0395905_0301635
439 Ga0395901_0611325
440 Ga0451807_1157955
441 Ga0439441_002824
442 Ga0439451_003114
443 Ga0439434_0017298
444 Ga0439435_0002688
445 Ga0439435_0012802
446 Ga0439460_0008418
447 Ga0466969_0005301
448 Ga0466966_0001465
449 Ga0466966_0073663
450 Ga0466961_0004887
451 Ga0466963_0131440
452 Ga0466963_0196572
453 Ga0466959_0000315
454 Ga0466959_0010642
455 Ga0451576_0318203
456 Ga0466958_0028176
457 Ga0466958_0056339
458 Ga0466967_0009548
459 Ga0466967_0416708
460 Ga0495629_0017429
461 Ga0495580_0006621
462 Ga0495582_0012935
463 Ga0495664_0012614
464 Ga0495652_0079540
465 Ga0495587_0124116
466 Ga0495621_0000490
467 Ga0495621_0086354
468 Ga0495656_0060640
469 Ga0495659_0019713
470 Ga0495659_0027824
471 Ga0495599_0264536
472 Ga0495675_0043868
473 Ga0495602_0032861
474 Ga0496110_0024310
475 Ga0496111_0321014
476 Ga0496114_0276156
477 Ga0501036_0010474
478 Ga0501036_0042678
479 Ga0501036_0063864
480 Ga0501036_0102417
481 Ga0501038_0004736
482 Ga0501038_0022945
483 Ga0501038_0340692
484 Ga0501039_0035259
485 Ga0501039_0103449
486 Ga0501040_0000848
487 Ga0501040_0081653
488 Ga0501041_0009183
489 Ga0501041_0027316
490 Ga0501041_0028080
491 Ga0501041_0040468
492 Ga0501042_0015984
493 Ga0501043_0033872
494 Ga0501043_0137917
495 Ga0501046_0052466
496 Ga0501047_0051948
497 Ga0501047_0202795
498 Ga0501048_0003325
499 Ga0501048_0035445
500 Ga0501048_0043375
501 Ga0501048_0345983
502 Ga0501067_0004918
503 Ga0501069_0003926
504 Ga0501070_0016775
505 Ga0501070_0070700
506 Ga0501072_0002020
507 Ga0501072_0076468
508 Ga0501072_0141261
509 Ga0501073_0189869
510 Ga0501074_0298878
511 Ga0501075_0004546
512 Ga0501075_0045879
513 Ga0501075_0129864
514 Ga0501076_0000444
515 Ga0501077_0007426
516 Ga0501077_0175250
517 Ga0501077_0205225
518 Ga0501079_0002288
519 Ga0501079_0005175
520 Ga0501080_0020088
521 Ga0501081_0015960
522 Ga0501035_0010912
523 Ga0501045_0051316
524 Ga0501045_0089935
525 nmdc:mga0qj67_32568_c1
526 nmdc:mga06r32_98480_c1
527 nmdc:mga08y16_80811_c1
528 nmdc:mga0n895_10423_c1
529 nmdc:mga0n895_7141_c1
530 nmdc:mga0rr50_2199_c1
531 nmdc:mga0rr50_88424_c1
532 nmdc:mga08x19_4852_c1
533 nmdc:mga08x19_53260_c1
534 Ga0500635_0001510
535 Ga0501084_0004484
536 Ga0501084_0027065
537 Ga0501082_0003465
538 Ga0501082_0034696
539 Ga0501082_0279223
540 Ga0466962_0004852
541 Ga0466962_0088201
542 Ga0530510_0000916
543 Ga0530510_0004821
544 2739790195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

187

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

91

218

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9279 2 222
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9246 4 222
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9217 2 222
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9187 2 215
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9122 1 221
ID Description Score Start End Superfamily
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9496 3 224 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9379 6 222 3.40.50.300
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9372 6 222 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9358 1 222 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9347 3 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B9BHG2-F1-model_v4 ABC transporter ATP-binding protein 0.9573 3 223 GO:0005524
GO:0016887
AF-A0A7U8KC86-F1-model_v4 deleted 0.9573 1 151
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9528 6 222 GO:0005524
GO:0016887
AF-A0A7Y7WIE4-F1-model_v4 Ribosome-associated ATPase/putative transporter RbbA 0.9527 1 222 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A483IYM9-F1-model_v4 ABC transporter ATP-binding protein/permease 0.9512 3 224 GO:0005524
GO:0016020
GO:0016887
GO:0140359

Map