F378508

General Info

Members Datasets Scaffolds Average Seq Length
272 121 544 255

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_140166|Ga0400483_140166_1109_1996
Length 295
Sequence MFVNLIPVVIVVLLFLWSAIKVLNEYERGVIFRLGRVINAKGPGLIILIPVIDKMVKVSLRLVAMDVDPQDVITRDNVSVKVNAVIYFRVVDPIKAIIEVEQYNYAMSQLAQTTLRSVCGEAELDELLADREKINTQLQEILDTHTDPWGVKVTTVELKHIDLPQEMQRAMARQAEAEREXXXKVIHAEGEFQASSKLAEASKVIQDHPMALQLRYLQTMREMAAEKNSTTIFPFPIEMFKPFLKLLEEKEDLEEGFDLPYSYRFHELAQKPTSEADQVKDSILSMIRQIINERS

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
41 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
42 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
43 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
46 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
53 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
54 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
55 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
60 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
65 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
66 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
67 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
68 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
69 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
70 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
71 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
84 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 1.84
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 8.09
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 2.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_140166 3300039062 Bacteria 2035
2 Ga0065707_10038226 3300005295 Bacteria 1228
3 Ga0070711_100168624 3300005439 Bacteria 1667
4 Ga0070708_100168520 3300005445 Bacteria 2043
5 Ga0070708_100227766 3300005445 Bacteria 1749
6 Ga0070708_100344801 3300005445 Unclassified 1403
7 Ga0070708_100610256 3300005445 Bacteria 1028
8 Ga0070707_100108479 3300005468 Bacteria 2693
9 Ga0070698_100088420 3300005471 Bacteria 3083
10 Ga0070698_100277665 3300005471 Bacteria 1607
11 Ga0070699_100232200 3300005518 Bacteria 1645
12 Ga0070665_100639230 3300005548 Bacteria 1077
13 Ga0068857_100157008 3300005577 Bacteria 2063
14 Ga0068859_100525663 3300005617 Bacteria 1278
15 Ga0068862_100028412 3300005844 Bacteria 4710
16 Ga0081455_10000973 3300005937 Bacteria 36553
17 Ga0081538_10009112 3300005981 Bacteria 8326
18 Ga0081538_10019702 3300005981 Bacteria 4997
19 Ga0081538_10074297 3300005981 Bacteria 1851
20 Ga0081540_1001831 3300005983 Bacteria 17838
21 Ga0081539_10013587 3300005985 Bacteria 6123
22 Ga0070717_10006119 3300006028 Bacteria 8839
23 Ga0070712_100021798 3300006175 Bacteria 4213
24 Ga0097621_100044731 3300006237 Bacteria 3573
25 Ga0075428_100011118 3300006844 Bacteria 10016
26 Ga0075428_100046017 3300006844 Bacteria 4794
27 Ga0075428_101017626 3300006844 Bacteria 877
28 Ga0075433_10480328 3300006852 Bacteria 1095
29 Ga0097620_100525726 3300006931 Bacteria 1278
30 Ga0111539_10017122 3300009094 Bacteria 8972
31 Ga0111539_10362370 3300009094 Bacteria 1687
32 Ga0111539_10409296 3300009094 Bacteria 1580
33 Ga0114129_10300411 3300009147 Bacteria 2140
34 Ga0114129_10347631 3300009147 Bacteria 1965
35 Ga0114129_10401559 3300009147 Bacteria 1806
36 Ga0105249_10073950 3300009553 Bacteria 3153
37 Ga0105239_10032436 3300010375 Bacteria 5739
38 Ga0157378_10178263 3300013297 Bacteria 1998
39 Ga0163162_10027997 3300013306 Bacteria 5575
40 Ga0157375_10187301 3300013308 Bacteria 2223
41 Ga0157379_10037721 3300014968 Bacteria 4310
42 Ga0207692_10380575 3300025898 Bacteria 876
43 Ga0207693_10114239 3300025915 Bacteria 2119
44 Ga0207663_10066057 3300025916 Bacteria 2314
45 Ga0207646_10068484 3300025922 Bacteria 3170
46 Ga0207646_10329233 3300025922 Bacteria 1380
47 Ga0207712_10100321 3300025961 Bacteria 2151
48 Ga0207708_10226791 3300026075 Bacteria 1499
49 Ga0207674_10361458 3300026116 Bacteria 1403
50 Ga0209588_1000002 3300027671 Bacteria 311181
51 Ga0207428_10025929 3300027907 Unclassified 4898
52 Ga0265338_10114725 3300028800 Bacteria 2161
53 Ga0265330_10006767 3300031235 Bacteria 5652
54 Ga0265330_10039507 3300031235 Bacteria 2096
55 Ga0265329_10004295 3300031242 Bacteria 5968
56 Ga0265329_10037959 3300031242 Bacteria 1550
57 Ga0265339_10102016 3300031249 Bacteria 1492
58 Ga0265331_10000091 3300031250 Bacteria 123475
59 Ga0265316_10000006 3300031344 Bacteria 289686
60 Ga0316575_10003600 3300031665 Bacteria 5369
61 Ga0316575_10007929 3300031665 Bacteria 3854
62 Ga0316575_10019313 3300031665 Bacteria 2604
63 Ga0316575_10051978 3300031665 Unclassified 1632
64 Ga0316575_10083108 3300031665 Bacteria 1292
65 Ga0316575_10127939 3300031665 Bacteria 1041
66 Ga0316579_10002050 3300031691 Bacteria 7548
67 Ga0316579_10016724 3300031691 Unclassified 3208
68 Ga0316579_10020435 3300031691 Bacteria 2937
69 Ga0316579_10031263 3300031691 Bacteria 2436
70 Ga0316579_10033634 3300031691 Bacteria 2355
71 Ga0316579_10119155 3300031691 Bacteria 1268
72 Ga0265314_10000056 3300031711 Bacteria 171647
73 Ga0265342_10011265 3300031712 Bacteria 6132
74 Ga0316576_10000434 3300031727 Bacteria 19436
75 Ga0316576_10001888 3300031727 Bacteria 11652
76 Ga0316576_10016631 3300031727 Bacteria 4975
77 Ga0316576_10060000 3300031727 Bacteria 2786
78 Ga0316576_10066767 3300031727 Bacteria 2646
79 Ga0316576_10179574 3300031727 Bacteria 1596
80 Ga0316576_10195805 3300031727 Bacteria 1523
81 Ga0316576_10249508 3300031727 Bacteria 1333
82 Ga0316578_10001757 3300031728 Bacteria 9085
83 Ga0316578_10004088 3300031728 Bacteria 6820
84 Ga0316578_10004281 3300031728 Bacteria 6705
85 Ga0316578_10004622 3300031728 Bacteria 6529
86 Ga0316578_10040223 3300031728 Bacteria 2702
87 Ga0316578_10172981 3300031728 Bacteria 1302
88 Ga0316577_10000015 3300031733 Bacteria 36565
89 Ga0316577_10000313 3300031733 Bacteria 17728
90 Ga0316577_10009362 3300031733 Bacteria 5269
91 Ga0316577_10030673 3300031733 Bacteria 3002
92 Ga0316577_10038063 3300031733 Bacteria 2689
93 Ga0316577_10060698 3300031733 Bacteria 2110
94 Ga0316577_10288836 3300031733 Bacteria 929
95 Ga0316583_10001809 3300032133 Bacteria 7274
96 Ga0316583_10002177 3300032133 Bacteria 6753
97 Ga0316583_10004569 3300032133 Bacteria 4936
98 Ga0316583_10018581 3300032133 Bacteria 2496
99 Ga0316583_10075946 3300032133 Bacteria 1175
100 Ga0316585_10000859 3300032137 Bacteria 7742
101 Ga0316585_10001752 3300032137 Bacteria 5785
102 Ga0316585_10002203 3300032137 Bacteria 5228
103 Ga0316585_10009710 3300032137 Bacteria 2815
104 Ga0316585_10012728 3300032137 Bacteria 2497
105 Ga0316585_10017301 3300032137 Bacteria 2179
106 Ga0316585_10027753 3300032137 Bacteria 1768
107 Ga0316580_10000675 3300032139 Bacteria 8137
108 Ga0316580_10001233 3300032139 Bacteria 6561
109 Ga0316580_10002175 3300032139 Bacteria 5339
110 Ga0316580_10057197 3300032139 Bacteria 1198
111 Ga0316593_10003652 3300032168 Bacteria 3851
112 Ga0316593_10082011 3300032168 Bacteria 1127
113 Ga0316592_1009513 3300033524 Bacteria 1947
114 Ga0316592_1019589 3300033524 Bacteria 1432
115 Ga0316596_1021650 3300033541 Bacteria 1640
116 Ga0316574_0004610 3300035398 Bacteria 7249
117 Ga0316574_0011933 3300035398 Bacteria 4954
118 Ga0316574_0015593 3300035398 Bacteria 4411
119 Ga0316574_0017373 3300035398 Bacteria 4210
120 Ga0316574_0024477 3300035398 Bacteria 3613
121 Ga0316574_0095872 3300035398 Bacteria 1896
122 Ga0316574_0406063 3300035398 Bacteria 857
123 Ga0316582_0000437 3300036647 Bacteria 15323
124 Ga0316582_0002331 3300036647 Bacteria 8884
125 Ga0316582_0002880 3300036647 Bacteria 8255
126 Ga0316582_0010613 3300036647 Bacteria 5053
127 Ga0316582_0015561 3300036647 Bacteria 4356
128 Ga0316582_0017777 3300036647 Bacteria 4123
129 Ga0316582_0025510 3300036647 Bacteria 3550
130 Ga0316582_0038162 3300036647 Bacteria 2983
131 Ga0316582_0070567 3300036647 Bacteria 2260
132 Ga0316582_0172344 3300036647 Bacteria 1469
133 Ga0316582_0258027 3300036647 Bacteria 1195
134 Ga0316584_0000461 3300036712 Bacteria 21221
135 Ga0316584_0000957 3300036712 Bacteria 16482
136 Ga0316584_0007954 3300036712 Bacteria 7274
137 Ga0316584_0008701 3300036712 Bacteria 7006
138 Ga0316584_0013148 3300036712 Bacteria 5851
139 Ga0316584_0017840 3300036712 Bacteria 5112
140 Ga0316584_0040830 3300036712 Bacteria 3457
141 Ga0316584_0047523 3300036712 Bacteria 3206
142 Ga0316584_0093798 3300036712 Bacteria 2247
143 Ga0316584_0098821 3300036712 Bacteria 2185
144 Ga0316584_0142657 3300036712 Bacteria 1785
145 Ga0316584_0146250 3300036712 Bacteria 1761
146 Ga0316584_0220298 3300036712 Bacteria 1394
147 Ga0316584_0336461 3300036712 Bacteria 1086
148 Ga0395905_0000900 3300037471 Bacteria 38791
149 Ga0395905_0003516 3300037471 Bacteria 16708
150 Ga0395905_0008784 3300037471 Bacteria 9932
151 Ga0395905_0146968 3300037471 Bacteria 2218
152 Ga0316581_0005960 3300037588 Bacteria 3205
153 Ga0316581_0012285 3300037588 Bacteria 2410
154 Ga0316581_0021115 3300037588 Bacteria 1911
155 Ga0316581_0073511 3300037588 Bacteria 1051
156 Ga0316581_0094511 3300037588 Bacteria 920
157 Ga0395901_0332957 3300038443 Unclassified 1569
158 Ga0400484_23010 3300038725 Bacteria 3724
159 Ga0400484_24154 3300038725 Bacteria 16895
160 Ga0400490_42054 3300038726 Bacteria 3294
161 Ga0400490_45117 3300038726 Bacteria 28949
162 Ga0400490_51538 3300038726 Bacteria 3583
163 Ga0400490_55888 3300038726 Bacteria 1560
164 Ga0400491_27807 3300038727 Bacteria 3484
165 Ga0400485_03630 3300038735 Bacteria 17408
166 Ga0400485_12938 3300038735 Bacteria 24542
167 Ga0400485_17656 3300038735 Bacteria 15398
168 Ga0400485_20605 3300038735 Bacteria 29023
169 Ga0400488_49106 3300038741 Bacteria 2089
170 Ga0400488_62011 3300038741 Bacteria 3033
171 Ga0400486_01180 3300038742 Bacteria 13691
172 Ga0400486_06052 3300038742 Bacteria 76843
173 Ga0400486_07276 3300038742 Unclassified 4995
174 Ga0400486_09385 3300038742 Bacteria 62607
175 Ga0400486_14358 3300038742 Bacteria 26686
176 Ga0400483_015941 3300039062 Bacteria 1412
177 Ga0400483_019041 3300039062 Bacteria 2008
178 Ga0400483_046319 3300039062 Bacteria 2454
179 Ga0400483_074678 3300039062 Bacteria 7827
180 Ga0400483_156106 3300039062 Bacteria 10854
181 Ga0400483_157552 3300039062 Bacteria 68258
182 Ga0400483_177962 3300039062 Bacteria 1063
183 Ga0400483_238306 3300039062 Bacteria 4041
184 Ga0400489_16633 3300039093 Bacteria 4771
185 Ga0400489_55420 3300039093 Bacteria 5805
186 Ga0400489_64160 3300039093 Bacteria 21934
187 Ga0400489_95256 3300039093 Bacteria 28247
188 Ga0400487_33854 3300039110 Bacteria 19091
189 Ga0400487_41512 3300039110 Bacteria 58960
190 Ga0400487_59104 3300039110 Bacteria 1313
191 Ga0400487_62347 3300039110 Bacteria 3071
192 Ga0451577_0000578 3300042876 Bacteria 59283
193 Ga0451577_0003240 3300042876 Bacteria 18298
194 Ga0451577_0159394 3300042876 Bacteria 2032
195 Ga0439440_0016471 3300042993 Bacteria 1619
196 Ga0466972_0073012 3300044658 Bacteria 1636
197 Ga0453683_0002517 3300044673 Bacteria 14143
198 Ga0453683_0053820 3300044673 Bacteria 2519
199 Ga0453684_0002495 3300044712 Bacteria 44446
200 Ga0453684_0005586 3300044712 Bacteria 24779
201 Ga0453684_0007058 3300044712 Bacteria 20990
202 Ga0453684_0767668 3300044712 Bacteria 1042
203 Ga0495592_0074463 3300046454 Bacteria 2466
204 Ga0495580_0018814 3300046472 Bacteria 5141
205 Ga0495664_0245548 3300046477 Bacteria 1083
206 Ga0495618_0062444 3300046514 Bacteria 2364
207 Ga0495656_0023850 3300046615 Bacteria 2411
208 Ga0495658_0076427 3300046683 Bacteria 1957
209 Ga0495636_0025127 3300047318 Bacteria 2417
210 Ga0495636_0144773 3300047318 Bacteria 1063
211 Ga0495615_0048535 3300048090 Bacteria 1085
212 Ga0496100_0014725 3300048903 Bacteria 4548
213 Ga0496101_0002817 3300048904 Bacteria 10685
214 Ga0496102_0001267 3300048905 Bacteria 22812
215 Ga0496104_0001579 3300048907 Bacteria 19611
216 Ga0496104_0006660 3300048907 Bacteria 10166
217 Ga0496105_0000948 3300048908 Bacteria 19862
218 Ga0496106_0002962 3300048909 Bacteria 12632
219 Ga0496107_0004456 3300048910 Bacteria 9495
220 Ga0496108_0005028 3300048911 Bacteria 10685
221 Ga0496108_0055295 3300048911 Bacteria 3332
222 Ga0496109_0000791 3300048912 Bacteria 26324
223 Ga0496109_0004583 3300048912 Bacteria 11537
224 Ga0496109_0145244 3300048912 Bacteria 2219
225 Ga0496110_0005196 3300048913 Bacteria 10187
226 Ga0496111_0007658 3300048914 Bacteria 7100
227 Ga0496111_0011638 3300048914 Bacteria 5936
228 Ga0496112_0178843 3300048915 Bacteria 2085
229 Ga0496113_0003235 3300048916 Bacteria 9719
230 Ga0496113_0052158 3300048916 Bacteria 3054
231 Ga0496114_0004643 3300048917 Bacteria 10678
232 Ga0496115_0001152 3300048918 Bacteria 19108
233 Ga0496115_0014628 3300048918 Bacteria 5942
234 Ga0501036_0615699 3300049572 Bacteria 900
235 Ga0501040_0105360 3300049576 Bacteria 1970
236 Ga0501040_0133537 3300049576 Bacteria 1746
237 Ga0501040_0159684 3300049576 Bacteria 1593
238 Ga0501041_0181320 3300049577 Bacteria 1318
239 Ga0501042_0042112 3300049578 Bacteria 3250
240 Ga0501042_0096251 3300049578 Bacteria 2127
241 Ga0501042_0430769 3300049578 Bacteria 956
242 Ga0501072_0024163 3300049588 Bacteria 4726
243 Ga0501074_0146123 3300049590 Bacteria 1691
244 Ga0501075_0197537 3300049591 Bacteria 1534
245 Ga0501075_0431016 3300049591 Bacteria 1005
246 Ga0501076_0139110 3300049592 Bacteria 1972
247 Ga0501076_0253977 3300049592 Bacteria 1439
248 Ga0501081_0065245 3300049743 Bacteria 2530
249 Ga0501081_0102478 3300049743 Bacteria 2025
250 Ga0501083_0221127 3300049744 Bacteria 1234
251 Ga0501035_0000301 3300049822 Bacteria 58131
252 Ga0501045_0112472 3300049824 Bacteria 2019
253 Ga0501045_0370558 3300049824 Bacteria 1066
254 nmdc:mga05p37_49736_c1 3300050507 Bacteria 5157
255 nmdc:mga05p37_7294_c1 3300050507 Bacteria 13044
256 nmdc:mga09592_42623_c1 3300050508 Bacteria 3818
257 nmdc:mga09592_81354_c1 3300050508 Bacteria 2760
258 nmdc:mga0qj67_110887_c1 3300050509 Bacteria 2215
259 nmdc:mga0qj67_398750_c1 3300050509 Bacteria 1110
260 nmdc:mga0qj67_64992_c1 3300050509 Bacteria 2904
261 nmdc:mga08y16_263908_c1 3300050511 Bacteria 1778
262 nmdc:mga08y16_472792_c1 3300050511 Bacteria 1276
263 Ga0495601_0033732 3300053077 Bacteria 3190
264 Ga0495601_0050099 3300053077 Bacteria 2633
265 Ga0500608_002844 3300053122 Unclassified 6394
266 Ga0501084_0156068 3300054114 Bacteria 1925
267 Ga0501084_0332255 3300054114 Bacteria 1284
268 Ga0501082_0200403 3300060353 Bacteria 1737
269 Ga0530510_0069574 3300061734 Bacteria 2554
270 Ga0530510_0211761 3300061734 Bacteria 1440
271 Ga0530510_0289718 3300061734 Bacteria 1224
272 2524002036 2523533628 Bacteria 4098242
273 Ga0400483_140166
274 Ga0065707_10038226
275 Ga0070711_100168624
276 Ga0070708_100168520
277 Ga0070708_100227766
278 Ga0070708_100344801
279 Ga0070708_100610256
280 Ga0070707_100108479
281 Ga0070698_100088420
282 Ga0070698_100277665
283 Ga0070699_100232200
284 Ga0070665_100639230
285 Ga0068857_100157008
286 Ga0068859_100525663
287 Ga0068862_100028412
288 Ga0081455_10000973
289 Ga0081538_10009112
290 Ga0081538_10019702
291 Ga0081538_10074297
292 Ga0081540_1001831
293 Ga0081539_10013587
294 Ga0070717_10006119
295 Ga0070712_100021798
296 Ga0097621_100044731
297 Ga0075428_100011118
298 Ga0075428_100046017
299 Ga0075428_101017626
300 Ga0075433_10480328
301 Ga0097620_100525726
302 Ga0111539_10017122
303 Ga0111539_10362370
304 Ga0111539_10409296
305 Ga0114129_10300411
306 Ga0114129_10347631
307 Ga0114129_10401559
308 Ga0105249_10073950
309 Ga0105239_10032436
310 Ga0157378_10178263
311 Ga0163162_10027997
312 Ga0157375_10187301
313 Ga0157379_10037721
314 Ga0207692_10380575
315 Ga0207693_10114239
316 Ga0207663_10066057
317 Ga0207646_10068484
318 Ga0207646_10329233
319 Ga0207712_10100321
320 Ga0207708_10226791
321 Ga0207674_10361458
322 Ga0209588_1000002
323 Ga0207428_10025929
324 Ga0265338_10114725
325 Ga0265330_10006767
326 Ga0265330_10039507
327 Ga0265329_10004295
328 Ga0265329_10037959
329 Ga0265339_10102016
330 Ga0265331_10000091
331 Ga0265316_10000006
332 Ga0316575_10003600
333 Ga0316575_10007929
334 Ga0316575_10019313
335 Ga0316575_10051978
336 Ga0316575_10083108
337 Ga0316575_10127939
338 Ga0316579_10002050
339 Ga0316579_10016724
340 Ga0316579_10020435
341 Ga0316579_10031263
342 Ga0316579_10033634
343 Ga0316579_10119155
344 Ga0265314_10000056
345 Ga0265342_10011265
346 Ga0316576_10000434
347 Ga0316576_10001888
348 Ga0316576_10016631
349 Ga0316576_10060000
350 Ga0316576_10066767
351 Ga0316576_10179574
352 Ga0316576_10195805
353 Ga0316576_10249508
354 Ga0316578_10001757
355 Ga0316578_10004088
356 Ga0316578_10004281
357 Ga0316578_10004622
358 Ga0316578_10040223
359 Ga0316578_10172981
360 Ga0316577_10000015
361 Ga0316577_10000313
362 Ga0316577_10009362
363 Ga0316577_10030673
364 Ga0316577_10038063
365 Ga0316577_10060698
366 Ga0316577_10288836
367 Ga0316583_10001809
368 Ga0316583_10002177
369 Ga0316583_10004569
370 Ga0316583_10018581
371 Ga0316583_10075946
372 Ga0316585_10000859
373 Ga0316585_10001752
374 Ga0316585_10002203
375 Ga0316585_10009710
376 Ga0316585_10012728
377 Ga0316585_10017301
378 Ga0316585_10027753
379 Ga0316580_10000675
380 Ga0316580_10001233
381 Ga0316580_10002175
382 Ga0316580_10057197
383 Ga0316593_10003652
384 Ga0316593_10082011
385 Ga0316592_1009513
386 Ga0316592_1019589
387 Ga0316596_1021650
388 Ga0316574_0004610
389 Ga0316574_0011933
390 Ga0316574_0015593
391 Ga0316574_0017373
392 Ga0316574_0024477
393 Ga0316574_0095872
394 Ga0316574_0406063
395 Ga0316582_0000437
396 Ga0316582_0002331
397 Ga0316582_0002880
398 Ga0316582_0010613
399 Ga0316582_0015561
400 Ga0316582_0017777
401 Ga0316582_0025510
402 Ga0316582_0038162
403 Ga0316582_0070567
404 Ga0316582_0172344
405 Ga0316582_0258027
406 Ga0316584_0000461
407 Ga0316584_0000957
408 Ga0316584_0007954
409 Ga0316584_0008701
410 Ga0316584_0013148
411 Ga0316584_0017840
412 Ga0316584_0040830
413 Ga0316584_0047523
414 Ga0316584_0093798
415 Ga0316584_0098821
416 Ga0316584_0142657
417 Ga0316584_0146250
418 Ga0316584_0220298
419 Ga0316584_0336461
420 Ga0395905_0000900
421 Ga0395905_0003516
422 Ga0395905_0008784
423 Ga0395905_0146968
424 Ga0316581_0005960
425 Ga0316581_0012285
426 Ga0316581_0021115
427 Ga0316581_0073511
428 Ga0316581_0094511
429 Ga0395901_0332957
430 Ga0400484_23010
431 Ga0400484_24154
432 Ga0400490_42054
433 Ga0400490_45117
434 Ga0400490_51538
435 Ga0400490_55888
436 Ga0400491_27807
437 Ga0400485_03630
438 Ga0400485_12938
439 Ga0400485_17656
440 Ga0400485_20605
441 Ga0400488_49106
442 Ga0400488_62011
443 Ga0400486_01180
444 Ga0400486_06052
445 Ga0400486_07276
446 Ga0400486_09385
447 Ga0400486_14358
448 Ga0400483_015941
449 Ga0400483_019041
450 Ga0400483_046319
451 Ga0400483_074678
452 Ga0400483_156106
453 Ga0400483_157552
454 Ga0400483_177962
455 Ga0400483_238306
456 Ga0400489_16633
457 Ga0400489_55420
458 Ga0400489_64160
459 Ga0400489_95256
460 Ga0400487_33854
461 Ga0400487_41512
462 Ga0400487_59104
463 Ga0400487_62347
464 Ga0451577_0000578
465 Ga0451577_0003240
466 Ga0451577_0159394
467 Ga0439440_0016471
468 Ga0466972_0073012
469 Ga0453683_0002517
470 Ga0453683_0053820
471 Ga0453684_0002495
472 Ga0453684_0005586
473 Ga0453684_0007058
474 Ga0453684_0767668
475 Ga0495592_0074463
476 Ga0495580_0018814
477 Ga0495664_0245548
478 Ga0495618_0062444
479 Ga0495656_0023850
480 Ga0495658_0076427
481 Ga0495636_0025127
482 Ga0495636_0144773
483 Ga0495615_0048535
484 Ga0496100_0014725
485 Ga0496101_0002817
486 Ga0496102_0001267
487 Ga0496104_0001579
488 Ga0496104_0006660
489 Ga0496105_0000948
490 Ga0496106_0002962
491 Ga0496107_0004456
492 Ga0496108_0005028
493 Ga0496108_0055295
494 Ga0496109_0000791
495 Ga0496109_0004583
496 Ga0496109_0145244
497 Ga0496110_0005196
498 Ga0496111_0007658
499 Ga0496111_0011638
500 Ga0496112_0178843
501 Ga0496113_0003235
502 Ga0496113_0052158
503 Ga0496114_0004643
504 Ga0496115_0001152
505 Ga0496115_0014628
506 Ga0501036_0615699
507 Ga0501040_0105360
508 Ga0501040_0133537
509 Ga0501040_0159684
510 Ga0501041_0181320
511 Ga0501042_0042112
512 Ga0501042_0096251
513 Ga0501042_0430769
514 Ga0501072_0024163
515 Ga0501074_0146123
516 Ga0501075_0197537
517 Ga0501075_0431016
518 Ga0501076_0139110
519 Ga0501076_0253977
520 Ga0501081_0065245
521 Ga0501081_0102478
522 Ga0501083_0221127
523 Ga0501035_0000301
524 Ga0501045_0112472
525 Ga0501045_0370558
526 nmdc:mga05p37_49736_c1
527 nmdc:mga05p37_7294_c1
528 nmdc:mga09592_42623_c1
529 nmdc:mga09592_81354_c1
530 nmdc:mga0qj67_110887_c1
531 nmdc:mga0qj67_398750_c1
532 nmdc:mga0qj67_64992_c1
533 nmdc:mga08y16_263908_c1
534 nmdc:mga08y16_472792_c1
535 Ga0495601_0033732
536 Ga0495601_0050099
537 Ga0500608_002844
538 Ga0501084_0156068
539 Ga0501084_0332255
540 Ga0501082_0200403
541 Ga0530510_0069574
542 Ga0530510_0211761
543 Ga0530510_0289718
544 2524002036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

21

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.957 61 164
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.9402 59 165
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.9218 61 164
3bk6-assembly1.cif.gz_B crystal structure of a core domain of stomatin from pyrococcus horikoshii 0.8911 59 190
3bk6-assembly1.cif.gz_C crystal structure of a core domain of stomatin from pyrococcus horikoshii 0.8845 59 208
ID Description Score Start End Superfamily
af_Q9VGD7_116_226_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9965 57 164 3.30.479.30
af_Q8T4B6_101_212_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9947 59 164 3.30.479.30
af_F1R5A4_90_200_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9947 59 165 3.30.479.30
af_F1Q9K0_120_233_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.987 47 159 3.30.479.30
af_A0A1D8PTU3_111_221_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9855 57 164 3.30.479.30
ID Description Score Start End GO Terms
AF-R7UIZ1-F1-model_v4 Band 7 domain-containing protein 0.9833 20 163 GO:0005886
AF-A0A523WQZ2-F1-model_v4 Slipin family protein 0.9812 20 159 GO:0005886
AF-A0A3M1FY76-F1-model_v4 Slipin family protein 0.979 9 165 GO:0005886
AF-A0A381SQX3-F1-model_v4 Band 7 domain-containing protein 0.9745 10 163 GO:0005886
AF-A0A556W0C4-F1-model_v4 Slipin family protein 0.9701 4 160 GO:0005886

Map