F378127

General Info

Members Datasets Scaffolds Average Seq Length
272 144 544 315

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100032313|Ga0070670_1000323134
Length 347
Sequence VLNRTPGLRGAILTLPVEPEFLMSPCALTFVVPLYRSAETIASVVRDIESLDIEGGHEIILVNDGSTDRTSEVVRSLMGHTRVPLTLIEHARNFGEHNAVLTGWRHARGAHIVNLDDDGQNPPAEAKRLWEEAKRSGLDVIFGHYRMKQHSVWRNVGSWFTNKMTDWALDKPHGFYLSSFRCVSAFVASQVVNYAGPYPYIDGLILQVTQRIGSIEVRHEARQAGQSTYTLRRLIRLWMAAWVNFSVLPLRVATVLGLTMAAAGMVALVVLVWLWLKNVGPSYGFGWLMAALLVFSGTQLVLLGLIGEYIGRTFLTVNQRPQAVVREVLTSAPQSAALSERALHHAR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
89 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.94
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100032313 3300005331 Bacteria 4507
2 rootL2_10097350 3300003322 Bacteria 1575
3 rootH1_10165369 3300003323 Unclassified 2674
4 Ga0065712_10003087 3300005290 Bacteria 4240
5 Ga0065712_10009729 3300005290 Bacteria 3744
6 Ga0065715_10178033 3300005293 Bacteria 1481
7 Ga0065707_10020718 3300005295 Bacteria 1324
8 Ga0070658_10050398 3300005327 Bacteria 3375
9 Ga0070683_100000059 3300005329 Bacteria 81605
10 Ga0070670_100005068 3300005331 Bacteria 11084
11 Ga0070666_10177743 3300005335 Bacteria 1492
12 Ga0070689_100020187 3300005340 Bacteria 4941
13 Ga0070689_100096224 3300005340 Bacteria 2340
14 Ga0070661_100061066 3300005344 Bacteria 2766
15 Ga0070669_100005031 3300005353 Bacteria 9558
16 Ga0070675_100201613 3300005354 Bacteria 1727
17 Ga0070671_100060675 3300005355 Bacteria 3149
18 Ga0070674_100156488 3300005356 Bacteria 1725
19 Ga0070673_100198528 3300005364 Bacteria 1727
20 Ga0070713_100013178 3300005436 Bacteria 6096
21 Ga0070663_100004809 3300005455 Bacteria 7964
22 Ga0070678_100070735 3300005456 Bacteria 2610
23 Ga0070678_100285128 3300005456 Unclassified 1398
24 Ga0070662_100036175 3300005457 Bacteria 3491
25 Ga0070679_100163571 3300005530 Bacteria 2199
26 Ga0070684_100001140 3300005535 Bacteria 19092
27 Ga0070672_100012890 3300005543 Bacteria 5890
28 Ga0070693_100095421 3300005547 Bacteria 1801
29 Ga0070665_100043483 3300005548 Bacteria 4514
30 Ga0070664_100001846 3300005564 Bacteria 16969
31 Ga0068862_100010176 3300005844 Bacteria 7763
32 Ga0097621_100138626 3300006237 Unclassified 2077
33 Ga0075428_100015068 3300006844 Bacteria 8589
34 Ga0075428_100274614 3300006844 Bacteria 1813
35 Ga0075430_100036476 3300006846 Bacteria 4168
36 Ga0075430_100142219 3300006846 Bacteria 1998
37 Ga0075431_100125450 3300006847 Bacteria 2649
38 Ga0075431_100422768 3300006847 Bacteria 1332
39 Ga0075433_10027904 3300006852 Bacteria 4795
40 Ga0075433_10096031 3300006852 Bacteria 2623
41 Ga0075433_10126880 3300006852 Bacteria 2266
42 Ga0075434_100007173 3300006871 Bacteria 10303
43 Ga0075434_100103243 3300006871 Bacteria 2859
44 Ga0075435_100088134 3300007076 Unclassified 2558
45 Ga0075435_100320202 3300007076 Bacteria 1327
46 Ga0111539_10008101 3300009094 Bacteria 13388
47 Ga0111539_10010640 3300009094 Bacteria 11584
48 Ga0111539_10014378 3300009094 Bacteria 9878
49 Ga0111539_10017055 3300009094 Bacteria 8990
50 Ga0111539_10080571 3300009094 Bacteria 3830
51 Ga0111539_10092793 3300009094 Bacteria 3547
52 Ga0111539_10101378 3300009094 Bacteria 3380
53 Ga0111539_10102628 3300009094 Bacteria 3357
54 Ga0111539_10108738 3300009094 Bacteria 3254
55 Ga0111539_10122338 3300009094 Unclassified 3050
56 Ga0111539_10211298 3300009094 Bacteria 2261
57 Ga0114129_10001471 3300009147 Bacteria 31879
58 Ga0114129_10013150 3300009147 Bacteria 11792
59 Ga0114129_10029052 3300009147 Bacteria 7832
60 Ga0105242_10402318 3300009176 Bacteria 1278
61 Ga0105248_10011820 3300009177 Bacteria 9630
62 Ga0105248_10086988 3300009177 Unclassified 3517
63 Ga0105248_10212148 3300009177 Unclassified 2182
64 Ga0105248_10602340 3300009177 Bacteria 1240
65 Ga0105249_10000783 3300009553 Bacteria 28521
66 Ga0105249_10244899 3300009553 Bacteria 1774
67 Ga0105246_10049895 3300011119 Bacteria 2868
68 Ga0105246_10114442 3300011119 Bacteria 1987
69 Ga0163162_10009992 3300013306 Bacteria 9230
70 Ga0163162_10189826 3300013306 Bacteria 2182
71 Ga0163163_10417900 3300014325 Unclassified 1400
72 Ga0157376_10372414 3300014969 Unclassified 1373
73 Ga0207697_10029062 3300025315 Bacteria 2261
74 Ga0207680_10077161 3300025903 Bacteria 2083
75 Ga0207680_10082074 3300025903 Bacteria 2028
76 Ga0207643_10046421 3300025908 Bacteria 2456
77 Ga0207705_10183803 3300025909 Bacteria 1579
78 Ga0207649_10053161 3300025920 Bacteria 2516
79 Ga0207652_10132841 3300025921 Bacteria 2221
80 Ga0207681_10360306 3300025923 Bacteria 1166
81 Ga0207650_10018445 3300025925 Bacteria 4897
82 Ga0207650_10128515 3300025925 Unclassified 1980
83 Ga0207650_10265577 3300025925 Bacteria 1393
84 Ga0207659_10037730 3300025926 Bacteria 3357
85 Ga0207659_10162686 3300025926 Bacteria 1754
86 Ga0207659_10506969 3300025926 Unclassified 1022
87 Ga0207700_10128613 3300025928 Bacteria 2064
88 Ga0207706_10127683 3300025933 Bacteria 2236
89 Ga0207670_10058787 3300025936 Bacteria 2613
90 Ga0207670_10123053 3300025936 Bacteria 1889
91 Ga0207691_10022412 3300025940 Bacteria 5956
92 Ga0207711_10056257 3300025941 Unclassified 3380
93 Ga0207711_10075347 3300025941 Bacteria 2937
94 Ga0207711_10110778 3300025941 Bacteria 2441
95 Ga0207661_10002248 3300025944 Bacteria 13317
96 Ga0207679_10003860 3300025945 Bacteria 9295
97 Ga0207651_10111971 3300025960 Bacteria 2051
98 Ga0207712_10009783 3300025961 Bacteria 6077
99 Ga0207712_10044808 3300025961 Bacteria 3060
100 Ga0207678_10015373 3300026067 Bacteria 6731
101 Ga0207641_10460676 3300026088 Bacteria 1230
102 Ga0207683_10003045 3300026121 Bacteria 14657
103 Ga0207428_10002489 3300027907 Bacteria 18394
104 Ga0207428_10027266 3300027907 Bacteria 4758
105 Ga0207428_10103589 3300027907 Bacteria 2197
106 Ga0207428_10126462 3300027907 Bacteria 1957
107 Ga0207428_10129641 3300027907 Unclassified 1931
108 Ga0207428_10132534 3300027907 Bacteria 1906
109 Ga0268266_10022901 3300028379 Bacteria 5316
110 Ga0268266_10056199 3300028379 Bacteria 3386
111 Ga0268265_10116992 3300028380 Bacteria 2188
112 Ga0265319_1000486 3300028563 Bacteria 27833
113 Ga0265318_10035124 3300028577 Bacteria 1929
114 Ga0265318_10060598 3300028577 Bacteria 1410
115 Ga0265323_10005112 3300028653 Bacteria 5593
116 Ga0265330_10010356 3300031235 Bacteria 4399
117 Ga0265320_10009900 3300031240 Bacteria 5710
118 Ga0265327_10001508 3300031251 Bacteria 28797
119 Ga0265327_10017573 3300031251 Bacteria 4479
120 Ga0265316_10085831 3300031344 Bacteria 2407
121 Ga0265316_10177743 3300031344 Unclassified 1585
122 Ga0307408_100182151 3300031548 Bacteria 1685
123 Ga0265342_10103140 3300031712 Bacteria 1622
124 Ga0265342_10177021 3300031712 Bacteria 1170
125 Ga0307405_10044413 3300031731 Bacteria 2718
126 Ga0307405_10099765 3300031731 Bacteria 1944
127 Ga0307413_10048453 3300031824 Bacteria 2540
128 Ga0307410_10020805 3300031852 Bacteria 4023
129 Ga0307407_10033345 3300031903 Bacteria 2809
130 Ga0307407_10126424 3300031903 Bacteria 1629
131 Ga0307412_10306081 3300031911 Bacteria 1258
132 Ga0307409_100022690 3300031995 Unclassified 4330
133 Ga0307409_100165619 3300031995 Bacteria 1939
134 Ga0307416_100047390 3300032002 Bacteria 3401
135 Ga0307414_10041162 3300032004 Bacteria 3127
136 Ga0307411_10021113 3300032005 Bacteria 3802
137 Ga0307411_10069596 3300032005 Bacteria 2377
138 Ga0307415_100022204 3300032126 Bacteria 3912
139 Ga0307415_100132233 3300032126 Bacteria 1891
140 Ga0373933_0062178 3300035724 Bacteria 2254
141 Ga0439433_0001690 3300041999 Bacteria 4603
142 Ga0439441_022142 3300042001 Bacteria 1179
143 Ga0451577_0041909 3300042876 Bacteria 4108
144 Ga0451577_0161144 3300042876 Bacteria 2020
145 Ga0453683_0000926 3300044673 Bacteria 27966
146 Ga0453683_0015207 3300044673 Bacteria 4988
147 Ga0453684_0086113 3300044712 Bacteria 3900
148 Ga0453684_0187141 3300044712 Bacteria 2425
149 Ga0453684_0559689 3300044712 Bacteria 1258
150 Ga0451576_0000182 3300045051 Bacteria 157929
151 Ga0451576_0002481 3300045051 Bacteria 27409
152 Ga0451576_0225110 3300045051 Unclassified 1958
153 Ga0451576_0230103 3300045051 Bacteria 1936
154 Ga0495599_0030954 3300046678 Bacteria 3359
155 Ga0495599_0112482 3300046678 Bacteria 1695
156 Ga0495600_0161626 3300046809 Bacteria 1448
157 Ga0495600_0312239 3300046809 Bacteria 990
158 Ga0495684_0130149 3300047471 Bacteria 1891
159 Ga0496104_0005690 3300048907 Bacteria 10907
160 Ga0496105_0012649 3300048908 Bacteria 6685
161 Ga0496106_0311671 3300048909 Unclassified 1263
162 Ga0496108_0001529 3300048911 Bacteria 18316
163 Ga0496109_0010903 3300048912 Bacteria 7784
164 Ga0496110_0002080 3300048913 Bacteria 14925
165 Ga0496111_0014915 3300048914 Bacteria 5320
166 Ga0496112_0000862 3300048915 Bacteria 21705
167 Ga0501031_0027500 3300049568 Bacteria 3708
168 Ga0501032_0017137 3300049569 Bacteria 5091
169 Ga0501032_0020094 3300049569 Bacteria 4657
170 Ga0501032_0145100 3300049569 Bacteria 1562
171 Ga0501033_0009116 3300049570 Bacteria 7654
172 Ga0501034_0018415 3300049571 Bacteria 7161
173 Ga0501034_0036757 3300049571 Bacteria 4959
174 Ga0501034_0119212 3300049571 Bacteria 2625
175 Ga0501034_0325028 3300049571 Bacteria 1470
176 Ga0501034_0406801 3300049571 Unclassified 1283
177 Ga0501036_0008939 3300049572 Bacteria 8235
178 Ga0501036_0171787 3300049572 Bacteria 1826
179 Ga0501037_0046882 3300049573 Bacteria 3168
180 Ga0501037_0053309 3300049573 Bacteria 2958
181 Ga0501037_0294906 3300049573 Bacteria 1127
182 Ga0501038_0073891 3300049574 Bacteria 2885
183 Ga0501038_0095215 3300049574 Bacteria 2487
184 Ga0501039_0006558 3300049575 Bacteria 8837
185 Ga0501039_0289600 3300049575 Bacteria 1287
186 Ga0501041_0253284 3300049577 Bacteria 1107
187 Ga0501042_0085284 3300049578 Bacteria 2265
188 Ga0501043_0000218 3300049579 Bacteria 52071
189 Ga0501043_0121537 3300049579 Bacteria 2048
190 Ga0501043_0195299 3300049579 Bacteria 1572
191 Ga0501046_0002930 3300049580 Bacteria 15789
192 Ga0501046_0011388 3300049580 Bacteria 7608
193 Ga0501046_0014372 3300049580 Bacteria 6683
194 Ga0501046_0016324 3300049580 Bacteria 6222
195 Ga0501046_0070417 3300049580 Bacteria 2719
196 Ga0501046_0248380 3300049580 Bacteria 1310
197 Ga0501047_0000207 3300049581 Bacteria 71430
198 Ga0501047_0004265 3300049581 Bacteria 13459
199 Ga0501047_0015617 3300049581 Bacteria 7235
200 Ga0501047_0046917 3300049581 Bacteria 4174
201 Ga0501047_0055729 3300049581 Bacteria 3822
202 Ga0501048_0101738 3300049582 Bacteria 2027
203 Ga0501048_0217308 3300049582 Bacteria 1355
204 Ga0501048_0342882 3300049582 Bacteria 1065
205 Ga0501067_0010435 3300049583 Bacteria 5142
206 Ga0501067_0053379 3300049583 Bacteria 2240
207 Ga0501067_0120361 3300049583 Bacteria 1460
208 Ga0501068_0032065 3300049584 Bacteria 3123
209 Ga0501068_0079347 3300049584 Bacteria 2013
210 Ga0501069_0018879 3300049585 Bacteria 3722
211 Ga0501070_0135606 3300049586 Bacteria 2033
212 Ga0501072_0016712 3300049588 Bacteria 5638
213 Ga0501072_0112325 3300049588 Bacteria 2169
214 Ga0501072_0245765 3300049588 Bacteria 1425
215 Ga0501073_0007057 3300049589 Bacteria 8369
216 Ga0501073_0022596 3300049589 Bacteria 4527
217 Ga0501073_0202528 3300049589 Bacteria 1372
218 Ga0501074_0144013 3300049590 Bacteria 1704
219 Ga0501075_0432816 3300049591 Bacteria 1003
220 Ga0501076_0065935 3300049592 Bacteria 2889
221 Ga0501077_0072525 3300049593 Bacteria 2182
222 Ga0501077_0098249 3300049593 Bacteria 1856
223 Ga0501243_000105 3300049675 Bacteria 9076
224 Ga0501080_0003859 3300049742 Bacteria 13246
225 Ga0501080_0108180 3300049742 Bacteria 2577
226 Ga0501080_0160029 3300049742 Bacteria 2080
227 Ga0501081_0212725 3300049743 Bacteria 1404
228 Ga0501083_0000839 3300049744 Bacteria 20205
229 Ga0501083_0013203 3300049744 Bacteria 5773
230 Ga0501083_0014714 3300049744 Bacteria 5469
231 Ga0501083_0015440 3300049744 Bacteria 5348
232 Ga0501083_0107996 3300049744 Bacteria 1831
233 Ga0501035_0010062 3300049822 Bacteria 8779
234 Ga0501044_0002546 3300049823 Bacteria 20767
235 Ga0501044_0002954 3300049823 Bacteria 19342
236 Ga0501044_0004972 3300049823 Bacteria 14866
237 Ga0501044_0037236 3300049823 Bacteria 5086
238 nmdc:mga05p37_15_c1 3300050507 Bacteria 134650
239 nmdc:mga05p37_366938_c1 3300050507 Bacteria 1691
240 nmdc:mga05p37_9171_c1 3300050507 Bacteria 11694
241 nmdc:mga09592_249059_c1 3300050508 Bacteria 1540
242 nmdc:mga09592_379225_c1 3300050508 Bacteria 1223
243 nmdc:mga09592_394990_c1 3300050508 Bacteria 1195
244 nmdc:mga09592_53553_c1 3300050508 Bacteria 3407
245 nmdc:mga0qj67_216276_c1 3300050509 Bacteria 1556
246 nmdc:mga06r32_186044_c1 3300050510 Bacteria 2064
247 nmdc:mga06r32_201736_c1 3300050510 Bacteria 1977
248 nmdc:mga06r32_231353_c1 3300050510 Bacteria 1836
249 nmdc:mga06r32_412482_c1 3300050510 Bacteria 1332
250 nmdc:mga08y16_10409_c1 3300050511 Bacteria 9755
251 nmdc:mga08y16_1546_c1 3300050511 Bacteria 23180
252 nmdc:mga08y16_17642_c1 3300050511 Bacteria 7518
253 nmdc:mga08y16_182797_c1 3300050511 Bacteria 2176
254 nmdc:mga08y16_20733_c1 3300050511 Bacteria 6939
255 nmdc:mga08y16_73292_c1 3300050511 Unclassified 3568
256 nmdc:mga08y16_82017_c1 3300050511 Bacteria 3362
257 nmdc:mga08y16_94244_c1 3300050511 Bacteria 3119
258 nmdc:mga08y16_94315_c1 3300050511 Bacteria 3118
259 nmdc:mga0n895_206002_c1 3300050512 Bacteria 1997
260 nmdc:mga0n895_6205_c1 3300050512 Bacteria 10110
261 nmdc:mga0rr50_287162_c1 3300050513 Bacteria 1374
262 nmdc:mga0rr50_294864_c1 3300050513 Bacteria 1356
263 nmdc:mga0rr50_443362_c1 3300050513 Bacteria 1100
264 nmdc:mga0a205_241738_c1 3300050515 Bacteria 1686
265 nmdc:mga0a205_24372_c1 3300050515 Bacteria 5754
266 nmdc:mga0a205_32038_c1 3300050515 Bacteria 5039
267 Ga0501084_0182791 3300054114 Bacteria 1770
268 Ga0501084_0399514 3300054114 Bacteria 1161
269 Ga0501082_0004629 3300060353 Bacteria 12005
270 Ga0501082_0033974 3300060353 Bacteria 4399
271 Ga0501082_0077843 3300060353 Bacteria 2859
272 Ga0501082_0427309 3300060353 Bacteria 1157
273 Ga0070670_100032313
274 rootL2_10097350
275 rootH1_10165369
276 Ga0065712_10003087
277 Ga0065712_10009729
278 Ga0065715_10178033
279 Ga0065707_10020718
280 Ga0070658_10050398
281 Ga0070683_100000059
282 Ga0070670_100005068
283 Ga0070666_10177743
284 Ga0070689_100020187
285 Ga0070689_100096224
286 Ga0070661_100061066
287 Ga0070669_100005031
288 Ga0070675_100201613
289 Ga0070671_100060675
290 Ga0070674_100156488
291 Ga0070673_100198528
292 Ga0070713_100013178
293 Ga0070663_100004809
294 Ga0070678_100070735
295 Ga0070678_100285128
296 Ga0070662_100036175
297 Ga0070679_100163571
298 Ga0070684_100001140
299 Ga0070672_100012890
300 Ga0070693_100095421
301 Ga0070665_100043483
302 Ga0070664_100001846
303 Ga0068862_100010176
304 Ga0097621_100138626
305 Ga0075428_100015068
306 Ga0075428_100274614
307 Ga0075430_100036476
308 Ga0075430_100142219
309 Ga0075431_100125450
310 Ga0075431_100422768
311 Ga0075433_10027904
312 Ga0075433_10096031
313 Ga0075433_10126880
314 Ga0075434_100007173
315 Ga0075434_100103243
316 Ga0075435_100088134
317 Ga0075435_100320202
318 Ga0111539_10008101
319 Ga0111539_10010640
320 Ga0111539_10014378
321 Ga0111539_10017055
322 Ga0111539_10080571
323 Ga0111539_10092793
324 Ga0111539_10101378
325 Ga0111539_10102628
326 Ga0111539_10108738
327 Ga0111539_10122338
328 Ga0111539_10211298
329 Ga0114129_10001471
330 Ga0114129_10013150
331 Ga0114129_10029052
332 Ga0105242_10402318
333 Ga0105248_10011820
334 Ga0105248_10086988
335 Ga0105248_10212148
336 Ga0105248_10602340
337 Ga0105249_10000783
338 Ga0105249_10244899
339 Ga0105246_10049895
340 Ga0105246_10114442
341 Ga0163162_10009992
342 Ga0163162_10189826
343 Ga0163163_10417900
344 Ga0157376_10372414
345 Ga0207697_10029062
346 Ga0207680_10077161
347 Ga0207680_10082074
348 Ga0207643_10046421
349 Ga0207705_10183803
350 Ga0207649_10053161
351 Ga0207652_10132841
352 Ga0207681_10360306
353 Ga0207650_10018445
354 Ga0207650_10128515
355 Ga0207650_10265577
356 Ga0207659_10037730
357 Ga0207659_10162686
358 Ga0207659_10506969
359 Ga0207700_10128613
360 Ga0207706_10127683
361 Ga0207670_10058787
362 Ga0207670_10123053
363 Ga0207691_10022412
364 Ga0207711_10056257
365 Ga0207711_10075347
366 Ga0207711_10110778
367 Ga0207661_10002248
368 Ga0207679_10003860
369 Ga0207651_10111971
370 Ga0207712_10009783
371 Ga0207712_10044808
372 Ga0207678_10015373
373 Ga0207641_10460676
374 Ga0207683_10003045
375 Ga0207428_10002489
376 Ga0207428_10027266
377 Ga0207428_10103589
378 Ga0207428_10126462
379 Ga0207428_10129641
380 Ga0207428_10132534
381 Ga0268266_10022901
382 Ga0268266_10056199
383 Ga0268265_10116992
384 Ga0265319_1000486
385 Ga0265318_10035124
386 Ga0265318_10060598
387 Ga0265323_10005112
388 Ga0265330_10010356
389 Ga0265320_10009900
390 Ga0265327_10001508
391 Ga0265327_10017573
392 Ga0265316_10085831
393 Ga0265316_10177743
394 Ga0307408_100182151
395 Ga0265342_10103140
396 Ga0265342_10177021
397 Ga0307405_10044413
398 Ga0307405_10099765
399 Ga0307413_10048453
400 Ga0307410_10020805
401 Ga0307407_10033345
402 Ga0307407_10126424
403 Ga0307412_10306081
404 Ga0307409_100022690
405 Ga0307409_100165619
406 Ga0307416_100047390
407 Ga0307414_10041162
408 Ga0307411_10021113
409 Ga0307411_10069596
410 Ga0307415_100022204
411 Ga0307415_100132233
412 Ga0373933_0062178
413 Ga0439433_0001690
414 Ga0439441_022142
415 Ga0451577_0041909
416 Ga0451577_0161144
417 Ga0453683_0000926
418 Ga0453683_0015207
419 Ga0453684_0086113
420 Ga0453684_0187141
421 Ga0453684_0559689
422 Ga0451576_0000182
423 Ga0451576_0002481
424 Ga0451576_0225110
425 Ga0451576_0230103
426 Ga0495599_0030954
427 Ga0495599_0112482
428 Ga0495600_0161626
429 Ga0495600_0312239
430 Ga0495684_0130149
431 Ga0496104_0005690
432 Ga0496105_0012649
433 Ga0496106_0311671
434 Ga0496108_0001529
435 Ga0496109_0010903
436 Ga0496110_0002080
437 Ga0496111_0014915
438 Ga0496112_0000862
439 Ga0501031_0027500
440 Ga0501032_0017137
441 Ga0501032_0020094
442 Ga0501032_0145100
443 Ga0501033_0009116
444 Ga0501034_0018415
445 Ga0501034_0036757
446 Ga0501034_0119212
447 Ga0501034_0325028
448 Ga0501034_0406801
449 Ga0501036_0008939
450 Ga0501036_0171787
451 Ga0501037_0046882
452 Ga0501037_0053309
453 Ga0501037_0294906
454 Ga0501038_0073891
455 Ga0501038_0095215
456 Ga0501039_0006558
457 Ga0501039_0289600
458 Ga0501041_0253284
459 Ga0501042_0085284
460 Ga0501043_0000218
461 Ga0501043_0121537
462 Ga0501043_0195299
463 Ga0501046_0002930
464 Ga0501046_0011388
465 Ga0501046_0014372
466 Ga0501046_0016324
467 Ga0501046_0070417
468 Ga0501046_0248380
469 Ga0501047_0000207
470 Ga0501047_0004265
471 Ga0501047_0015617
472 Ga0501047_0046917
473 Ga0501047_0055729
474 Ga0501048_0101738
475 Ga0501048_0217308
476 Ga0501048_0342882
477 Ga0501067_0010435
478 Ga0501067_0053379
479 Ga0501067_0120361
480 Ga0501068_0032065
481 Ga0501068_0079347
482 Ga0501069_0018879
483 Ga0501070_0135606
484 Ga0501072_0016712
485 Ga0501072_0112325
486 Ga0501072_0245765
487 Ga0501073_0007057
488 Ga0501073_0022596
489 Ga0501073_0202528
490 Ga0501074_0144013
491 Ga0501075_0432816
492 Ga0501076_0065935
493 Ga0501077_0072525
494 Ga0501077_0098249
495 Ga0501243_000105
496 Ga0501080_0003859
497 Ga0501080_0108180
498 Ga0501080_0160029
499 Ga0501081_0212725
500 Ga0501083_0000839
501 Ga0501083_0013203
502 Ga0501083_0014714
503 Ga0501083_0015440
504 Ga0501083_0107996
505 Ga0501035_0010062
506 Ga0501044_0002546
507 Ga0501044_0002954
508 Ga0501044_0004972
509 Ga0501044_0037236
510 nmdc:mga05p37_15_c1
511 nmdc:mga05p37_366938_c1
512 nmdc:mga05p37_9171_c1
513 nmdc:mga09592_249059_c1
514 nmdc:mga09592_379225_c1
515 nmdc:mga09592_394990_c1
516 nmdc:mga09592_53553_c1
517 nmdc:mga0qj67_216276_c1
518 nmdc:mga06r32_186044_c1
519 nmdc:mga06r32_201736_c1
520 nmdc:mga06r32_231353_c1
521 nmdc:mga06r32_412482_c1
522 nmdc:mga08y16_10409_c1
523 nmdc:mga08y16_1546_c1
524 nmdc:mga08y16_17642_c1
525 nmdc:mga08y16_182797_c1
526 nmdc:mga08y16_20733_c1
527 nmdc:mga08y16_73292_c1
528 nmdc:mga08y16_82017_c1
529 nmdc:mga08y16_94244_c1
530 nmdc:mga08y16_94315_c1
531 nmdc:mga0n895_206002_c1
532 nmdc:mga0n895_6205_c1
533 nmdc:mga0rr50_287162_c1
534 nmdc:mga0rr50_294864_c1
535 nmdc:mga0rr50_443362_c1
536 nmdc:mga0a205_241738_c1
537 nmdc:mga0a205_24372_c1
538 nmdc:mga0a205_32038_c1
539 Ga0501084_0182791
540 Ga0501084_0399514
541 Ga0501082_0004629
542 Ga0501082_0033974
543 Ga0501082_0077843
544 Ga0501082_0427309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

29

193

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pxu-assembly1.cif.gz_A crystal structure of human galnac-t12 bound to a diglycosylated peptide, mn2+, and udp 0.779 1 125
5nqa-assembly1.cif.gz_A crystal structure of galnac-t4 in complex with the monoglycopeptide 3 0.7608 1 125
3zbh-assembly4.cif.gz_E geobacillus thermodenitrificans esxa crystal form i 0.7555 230 298
7p3r-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7551 219 303
6pxu-assembly2.cif.gz_B crystal structure of human galnac-t12 bound to a diglycosylated peptide, mn2+, and udp 0.7479 2 125
ID Description Score Start End Superfamily
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8937 7 97 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8557 8 185 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8506 8 207 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8358 4 217 3.90.550.10
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8303 6 206 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A383C3Z3-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.8908 1 192 GO:0005886
GO:0099621
AF-A0A349NKG1-F1-model_v4 deleted 0.8874 8 217
AF-A0A383C3Z3-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.8821 1 192 GO:0005886
GO:0099621
AF-A0A7V2X6S9-F1-model_v4 Glycosyltransferase 0.8816 5 216 GO:0005886
GO:0016757
AF-A0A1F2PI89-F1-model_v4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (EC 2.4.2.53) 0.8803 5 219 GO:0005886
GO:0099621

Map