F378113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 272 | 209 | 235 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10022366|Ga0070676_100223664 |
| Length | 298 |
| Sequence | MNGMNTMSTPADLSIAASPTILVQLTDLHIREPGRLAYRRVDTSRYFRALVDSVLALKQRADAVVISGDLTDFGRPAEYASLAAQIAPLEAAGLPVYLMPGNHDDRAEMRRSFPTHTHLGDGPSTAVIQFAVDVGPLRLLAIDTCVPMQSAGALDAERLGWLETELDASRERPVVIAMHHPPFQTLIGHMDKIGLLSGAAELEAIVARHRNVERVICGHLHRAIDVRFGGTIASTAPGPAHQVCLDLDPDAVSAWTLEPPAFRVHAWNPAERRLVTHLAASGSFEGPYPFYENGVLID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 3 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 4 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 5 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 6 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 7 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 8 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 9 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 10 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 11 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 12 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 13 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 14 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 15 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 16 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 17 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 18 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 19 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 20 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 21 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 22 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 23 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 24 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 25 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 26 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 27 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 28 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 29 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 30 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 31 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 32 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 33 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 34 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 35 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 36 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 37 | 2941479691 | |||
| 38 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 41 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 42 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 54 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 61 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 164 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 165 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 166 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 167 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 168 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 169 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 170 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 171 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 172 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 173 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 174 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 175 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 194 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 195 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 196 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 197 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 198 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 205 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 206 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 207 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 208 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 209 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.4 |
| Metatranscriptomes | 0 |
| Isolates | 13.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.32 |
| Nodule | 2.21 |
| Rhizoplane | 0.37 |
| Rhizosphere | 58.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1418626 | 2162886007 | Bacteria | 2054 |
| 2 | JGI25151J46595_10006322 | 3300003187 | Bacteria | 5970 |
| 3 | rootH2_10114082 | 3300003320 | Bacteria | 2278 |
| 4 | rootH1_10093045 | 3300003323 | Bacteria | 1704 |
| 5 | JGI25161J50226_1004375 | 3300003374 | Bacteria | 2965 |
| 6 | Ga0055535_1000142 | 3300003761 | Bacteria | 75104 |
| 7 | Ga0055542_1000022 | 3300003762 | Bacteria | 302315 |
| 8 | Ga0055526_1015128 | 3300003771 | Bacteria | 3115 |
| 9 | Ga0055537_1006109 | 3300003773 | Bacteria | 3110 |
| 10 | Ga0055524_1013259 | 3300003775 | Bacteria | 3115 |
| 11 | Ga0055536_1003239 | 3300003781 | Bacteria | 8818 |
| 12 | Ga0055536_1003639 | 3300003781 | Bacteria | 8211 |
| 13 | Ga0055528_1016552 | 3300003790 | Bacteria | 2600 |
| 14 | Ga0055530_10002217 | 3300003791 | Bacteria | 12832 |
| 15 | Ga0055540_1009523 | 3300003792 | Bacteria | 3345 |
| 16 | Ga0055540_1012381 | 3300003792 | Bacteria | 2681 |
| 17 | Ga0055531_10019846 | 3300003794 | Bacteria | 2695 |
| 18 | Ga0055543_1004842 | 3300004625 | Bacteria | 3567 |
| 19 | Ga0065165_1032933 | 3300005262 | Bacteria | 1619 |
| 20 | Ga0065704_10071587 | 3300005289 | Bacteria | 10610 |
| 21 | Ga0065707_10099318 | 3300005295 | Bacteria | 3016 |
| 22 | Ga0070658_10316331 | 3300005327 | Bacteria | 1332 |
| 23 | Ga0070676_10022366 | 3300005328 | Bacteria | 3544 |
| 24 | Ga0070670_100004735 | 3300005331 | Bacteria | 11419 |
| 25 | Ga0070670_100084354 | 3300005331 | Bacteria | 2729 |
| 26 | Ga0070670_100194609 | 3300005331 | Bacteria | 1761 |
| 27 | Ga0070677_10021941 | 3300005333 | Bacteria | 2347 |
| 28 | Ga0070677_10028887 | 3300005333 | Bacteria | 2098 |
| 29 | Ga0070677_10095163 | 3300005333 | Bacteria | 1303 |
| 30 | Ga0068869_100511465 | 3300005334 | Bacteria | 1004 |
| 31 | Ga0070680_100003976 | 3300005336 | Bacteria | 11064 |
| 32 | Ga0068868_100027173 | 3300005338 | Bacteria | 4365 |
| 33 | Ga0070668_100632476 | 3300005347 | Bacteria | 939 |
| 34 | Ga0070669_100014745 | 3300005353 | Bacteria | 5565 |
| 35 | Ga0070675_100002569 | 3300005354 | Bacteria | 13593 |
| 36 | Ga0070675_100024403 | 3300005354 | Bacteria | 4843 |
| 37 | Ga0070675_100129438 | 3300005354 | Bacteria | 2150 |
| 38 | Ga0070671_100018623 | 3300005355 | Bacteria | 5641 |
| 39 | Ga0070671_100184349 | 3300005355 | Bacteria | 1768 |
| 40 | Ga0070674_100001349 | 3300005356 | Bacteria | 12937 |
| 41 | Ga0070674_100312114 | 3300005356 | Bacteria | 1257 |
| 42 | Ga0070673_100007977 | 3300005364 | Bacteria | 7016 |
| 43 | Ga0070673_100171617 | 3300005364 | Bacteria | 1851 |
| 44 | Ga0070673_100549234 | 3300005364 | Bacteria | 1049 |
| 45 | Ga0070667_100062013 | 3300005367 | Bacteria | 3167 |
| 46 | Ga0070678_100035321 | 3300005456 | Bacteria | 3488 |
| 47 | Ga0070678_100083594 | 3300005456 | Bacteria | 2427 |
| 48 | Ga0070678_100375064 | 3300005456 | Bacteria | 1229 |
| 49 | Ga0070662_100496168 | 3300005457 | Bacteria | 1018 |
| 50 | Ga0070681_10025766 | 3300005458 | Bacteria | 5913 |
| 51 | Ga0068867_100004766 | 3300005459 | Bacteria | 9551 |
| 52 | Ga0070679_100006292 | 3300005530 | Bacteria | 11053 |
| 53 | Ga0070672_100005395 | 3300005543 | Bacteria | 8468 |
| 54 | Ga0070672_100140683 | 3300005543 | Bacteria | 1990 |
| 55 | Ga0070665_100661061 | 3300005548 | Bacteria | 1058 |
| 56 | Ga0068854_100168633 | 3300005578 | Bacteria | 1702 |
| 57 | Ga0068856_100139130 | 3300005614 | Bacteria | 2434 |
| 58 | Ga0068852_100243290 | 3300005616 | Bacteria | 1720 |
| 59 | Ga0068864_100368503 | 3300005618 | Bacteria | 1359 |
| 60 | Ga0068851_10056605 | 3300005834 | Bacteria | 2000 |
| 61 | Ga0068860_100022346 | 3300005843 | Bacteria | 6120 |
| 62 | Ga0075364_10009014 | 3300006051 | Bacteria | 5976 |
| 63 | Ga0075364_10030314 | 3300006051 | Bacteria | 3471 |
| 64 | Ga0075366_10003019 | 3300006195 | Bacteria | 8780 |
| 65 | Ga0097621_100044380 | 3300006237 | Bacteria | 3586 |
| 66 | Ga0068871_100016997 | 3300006358 | Bacteria | 5494 |
| 67 | Ga0068865_100137056 | 3300006881 | Bacteria | 1841 |
| 68 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 69 | Ga0114129_10639802 | 3300009147 | Bacteria | 1374 |
| 70 | Ga0105243_10002650 | 3300009148 | Bacteria | 14865 |
| 71 | Ga0105243_10047100 | 3300009148 | Bacteria | 3393 |
| 72 | Ga0105242_10004151 | 3300009176 | Bacteria | 11276 |
| 73 | Ga0105242_10173086 | 3300009176 | Bacteria | 1899 |
| 74 | Ga0157370_10109932 | 3300013104 | Bacteria | 2577 |
| 75 | Ga0157369_10387935 | 3300013105 | Bacteria | 1449 |
| 76 | Ga0163162_10228603 | 3300013306 | Bacteria | 1990 |
| 77 | Ga0157375_10029431 | 3300013308 | Bacteria | 5165 |
| 78 | Ga0157375_10716686 | 3300013308 | Bacteria | 1153 |
| 79 | Ga0157375_10971294 | 3300013308 | Bacteria | 990 |
| 80 | Ga0157380_10106387 | 3300014326 | Bacteria | 2347 |
| 81 | Ga0182008_10006578 | 3300014497 | Bacteria | 6486 |
| 82 | Ga0182008_10032408 | 3300014497 | Bacteria | 2626 |
| 83 | Ga0157376_10296609 | 3300014969 | Bacteria | 1528 |
| 84 | Ga0163161_10004415 | 3300017792 | Bacteria | 9809 |
| 85 | Ga0163161_10034620 | 3300017792 | Bacteria | 3614 |
| 86 | Ga0213872_10003578 | 3300021361 | Bacteria | 8554 |
| 87 | Ga0209436_110411 | 3300025208 | Bacteria | 1703 |
| 88 | Ga0209672_100388 | 3300025228 | Bacteria | 26692 |
| 89 | Ga0209147_100982 | 3300025229 | Bacteria | 12407 |
| 90 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 91 | Ga0207425_1008223 | 3300025245 | Bacteria | 2687 |
| 92 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 93 | Ga0209129_1007753 | 3300025258 | Bacteria | 3118 |
| 94 | Ga0209565_1000355 | 3300025263 | Bacteria | 40050 |
| 95 | Ga0209565_1001175 | 3300025263 | Bacteria | 12538 |
| 96 | Ga0209673_1000615 | 3300025273 | Bacteria | 54497 |
| 97 | Ga0209673_1000806 | 3300025273 | Bacteria | 41441 |
| 98 | Ga0209130_1000157 | 3300025284 | Bacteria | 101890 |
| 99 | Ga0209675_1000504 | 3300025291 | Bacteria | 29131 |
| 100 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 101 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 102 | Ga0209676_1000275 | 3300025292 | Bacteria | 107485 |
| 103 | Ga0209676_1004275 | 3300025292 | Bacteria | 8052 |
| 104 | Ga0209025_1000272 | 3300025294 | Bacteria | 120328 |
| 105 | Ga0209025_1002963 | 3300025294 | Bacteria | 16867 |
| 106 | Ga0209564_1000198 | 3300025295 | Bacteria | 138511 |
| 107 | Ga0209758_1014917 | 3300025297 | Bacteria | 4078 |
| 108 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 109 | Ga0209050_1000122 | 3300025298 | Bacteria | 195305 |
| 110 | Ga0209256_1000088 | 3300025299 | Bacteria | 217236 |
| 111 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 112 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 113 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 114 | Ga0209051_1000168 | 3300025303 | Bacteria | 119312 |
| 115 | Ga0209051_1000179 | 3300025303 | Bacteria | 114055 |
| 116 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 117 | Ga0207697_10007997 | 3300025315 | Bacteria | 4669 |
| 118 | Ga0207682_10003822 | 3300025893 | Bacteria | 6463 |
| 119 | Ga0207682_10109179 | 3300025893 | Bacteria | 1217 |
| 120 | Ga0207642_10225787 | 3300025899 | Bacteria | 1049 |
| 121 | Ga0207688_10090453 | 3300025901 | Bacteria | 1757 |
| 122 | Ga0207680_10132817 | 3300025903 | Bacteria | 1642 |
| 123 | Ga0207645_10033943 | 3300025907 | Bacteria | 3278 |
| 124 | Ga0207643_10025990 | 3300025908 | Bacteria | 3239 |
| 125 | Ga0207705_10030389 | 3300025909 | Bacteria | 3855 |
| 126 | Ga0207660_10021819 | 3300025917 | Bacteria | 4309 |
| 127 | Ga0207652_10016331 | 3300025921 | Bacteria | 6060 |
| 128 | Ga0207681_10006927 | 3300025923 | Bacteria | 6954 |
| 129 | Ga0207650_10001027 | 3300025925 | Bacteria | 20954 |
| 130 | Ga0207659_10001133 | 3300025926 | Bacteria | 15808 |
| 131 | Ga0207644_10001139 | 3300025931 | Bacteria | 17037 |
| 132 | Ga0207706_10186523 | 3300025933 | Bacteria | 1821 |
| 133 | Ga0207686_10003308 | 3300025934 | Bacteria | 8670 |
| 134 | Ga0207709_10000138 | 3300025935 | Bacteria | 104006 |
| 135 | Ga0207669_10012321 | 3300025937 | Bacteria | 4200 |
| 136 | Ga0207669_10157002 | 3300025937 | Bacteria | 1601 |
| 137 | Ga0207691_10001104 | 3300025940 | Bacteria | 26843 |
| 138 | Ga0207691_10060045 | 3300025940 | Bacteria | 3456 |
| 139 | Ga0207691_10140768 | 3300025940 | Bacteria | 2126 |
| 140 | Ga0207691_10149335 | 3300025940 | Bacteria | 2055 |
| 141 | Ga0207651_10003576 | 3300025960 | Bacteria | 7641 |
| 142 | Ga0207668_10103073 | 3300025972 | Bacteria | 2124 |
| 143 | Ga0207668_10308892 | 3300025972 | Bacteria | 1308 |
| 144 | Ga0207658_10078622 | 3300025986 | Bacteria | 2521 |
| 145 | Ga0207677_10006244 | 3300026023 | Bacteria | 6517 |
| 146 | Ga0207678_10096916 | 3300026067 | Bacteria | 2520 |
| 147 | Ga0207702_10035976 | 3300026078 | Bacteria | 4141 |
| 148 | Ga0207648_10009096 | 3300026089 | Bacteria | 9549 |
| 149 | Ga0207648_10022265 | 3300026089 | Bacteria | 5694 |
| 150 | Ga0207648_10211329 | 3300026089 | Bacteria | 1722 |
| 151 | Ga0207676_10029847 | 3300026095 | Bacteria | 4086 |
| 152 | Ga0207683_10011073 | 3300026121 | Bacteria | 7684 |
| 153 | Ga0207683_10032188 | 3300026121 | Bacteria | 4555 |
| 154 | Ga0207683_10084982 | 3300026121 | Bacteria | 2813 |
| 155 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 156 | Ga0268266_10324363 | 3300028379 | Bacteria | 1442 |
| 157 | Ga0307515_10204116 | 3300028794 | Bacteria | 1843 |
| 158 | Ga0265324_10017219 | 3300029957 | Bacteria | 2630 |
| 159 | Ga0265327_10066955 | 3300031251 | Bacteria | 1811 |
| 160 | Ga0307412_10000061 | 3300031911 | Bacteria | 126274 |
| 161 | Ga0307414_10113135 | 3300032004 | Bacteria | 2071 |
| 162 | Ga0373927_0040780 | 3300035695 | Bacteria | 3012 |
| 163 | Ga0373937_0254911 | 3300036401 | Bacteria | 1654 |
| 164 | Ga0395900_0017268 | 3300037418 | Bacteria | 7365 |
| 165 | Ga0395898_0059920 | 3300037466 | Bacteria | 3701 |
| 166 | Ga0395905_0087569 | 3300037471 | Bacteria | 2919 |
| 167 | Ga0395905_0397690 | 3300037471 | Bacteria | 1272 |
| 168 | Ga0395901_0117737 | 3300038443 | Bacteria | 2791 |
| 169 | Ga0436365_0244431 | 3300039437 | Bacteria | 1728 |
| 170 | Ga0436361_1128018 | 3300039447 | Bacteria | 39370 |
| 171 | Ga0439439_0017016 | 3300041406 | Bacteria | 1784 |
| 172 | Ga0439466_0003999 | 3300041411 | Bacteria | 5688 |
| 173 | Ga0439465_0002674 | 3300041413 | Bacteria | 5828 |
| 174 | Ga0439431_0000597 | 3300041997 | Bacteria | 7625 |
| 175 | Ga0439433_0000364 | 3300041999 | Bacteria | 8025 |
| 176 | Ga0439442_019325 | 3300042002 | Bacteria | 1410 |
| 177 | Ga0439445_0000303 | 3300042004 | Bacteria | 9578 |
| 178 | Ga0439432_005717 | 3300042006 | Bacteria | 4467 |
| 179 | Ga0439449_0005014 | 3300042007 | Bacteria | 5092 |
| 180 | Ga0439449_0006098 | 3300042007 | Bacteria | 4606 |
| 181 | Ga0439452_000914 | 3300042010 | Bacteria | 13457 |
| 182 | Ga0439452_037751 | 3300042010 | Bacteria | 1150 |
| 183 | Ga0439462_0003728 | 3300042015 | Bacteria | 3680 |
| 184 | Ga0450923_006034 | 3300042125 | Bacteria | 1986 |
| 185 | Ga0439434_0007048 | 3300042435 | Bacteria | 3284 |
| 186 | Ga0451577_0084692 | 3300042876 | Bacteria | 2828 |
| 187 | Ga0466969_0170916 | 3300044656 | Bacteria | 997 |
| 188 | Ga0466965_0047950 | 3300044683 | Bacteria | 2115 |
| 189 | Ga0453684_0009647 | 3300044712 | Bacteria | 16822 |
| 190 | Ga0453684_0022482 | 3300044712 | Bacteria | 9348 |
| 191 | Ga0453684_0329577 | 3300044712 | Bacteria | 1726 |
| 192 | Ga0451576_0020911 | 3300045051 | Bacteria | 7122 |
| 193 | Ga0495607_0000050 | 3300046501 | Bacteria | 120052 |
| 194 | Ga0495643_0031816 | 3300046522 | Bacteria | 2933 |
| 195 | Ga0495652_0045643 | 3300046529 | Bacteria | 3765 |
| 196 | Ga0495654_0021662 | 3300046530 | Bacteria | 3342 |
| 197 | Ga0495646_0000288 | 3300046680 | Bacteria | 25753 |
| 198 | Ga0495602_0046249 | 3300048088 | Bacteria | 3933 |
| 199 | Ga0495626_0032402 | 3300048091 | Bacteria | 2510 |
| 200 | Ga0496116_0012137 | 3300048919 | Bacteria | 7055 |
| 201 | Ga0496117_0031805 | 3300048920 | Bacteria | 4023 |
| 202 | Ga0496118_0012576 | 3300048921 | Bacteria | 8105 |
| 203 | Ga0496119_0065783 | 3300048922 | Bacteria | 2145 |
| 204 | Ga0496119_0108474 | 3300048922 | Bacteria | 1545 |
| 205 | Ga0496121_0008364 | 3300048924 | Bacteria | 12209 |
| 206 | Ga0496121_0268529 | 3300048924 | Bacteria | 1174 |
| 207 | Ga0496121_0437785 | 3300048924 | Bacteria | 846 |
| 208 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 209 | Ga0496122_0002003 | 3300048925 | Bacteria | 30327 |
| 210 | Ga0496122_0006874 | 3300048925 | Bacteria | 12878 |
| 211 | Ga0496122_0073350 | 3300048925 | Bacteria | 2427 |
| 212 | Ga0496123_0000045 | 3300048926 | Bacteria | 249294 |
| 213 | Ga0496123_0000730 | 3300048926 | Bacteria | 53397 |
| 214 | Ga0496123_0034858 | 3300048926 | Bacteria | 3597 |
| 215 | Ga0496124_0034831 | 3300048927 | Bacteria | 4411 |
| 216 | Ga0496124_0082523 | 3300048927 | Bacteria | 2638 |
| 217 | Ga0496125_0000051 | 3300048928 | Bacteria | 285754 |
| 218 | Ga0496125_0005169 | 3300048928 | Bacteria | 14676 |
| 219 | Ga0496125_0005281 | 3300048928 | Bacteria | 14459 |
| 220 | Ga0496126_0047899 | 3300048929 | Bacteria | 3911 |
| 221 | Ga0496126_0124816 | 3300048929 | Bacteria | 2229 |
| 222 | Ga0501033_0066591 | 3300049570 | Bacteria | 2649 |
| 223 | Ga0501035_0106337 | 3300049822 | Bacteria | 2460 |
| 224 | Ga0501044_0000250 | 3300049823 | Bacteria | 68405 |
| 225 | Ga0501044_0042904 | 3300049823 | Bacteria | 4701 |
| 226 | Ga0501044_0608409 | 3300049823 | Bacteria | 985 |
| 227 | nmdc:mga00v17_449_c1 | 3300050491 | Bacteria | 23134 |
| 228 | nmdc:mga0k408_31921_c1 | 3300050493 | Bacteria | 3009 |
| 229 | Ga0500646_0012729 | 3300053090 | Bacteria | 2174 |
| 230 | Ga0500566_0152021 | 3300053094 | Bacteria | 1216 |
| 231 | Ga0500593_055821 | 3300053117 | Bacteria | 1744 |
| 232 | Ga0500559_0004803 | 3300053136 | Bacteria | 6321 |
| 233 | Ga0500559_0073709 | 3300053136 | Bacteria | 1541 |
| 234 | Ga0500634_0128083 | 3300053161 | Bacteria | 1223 |
| 235 | Ga0500661_008848 | 3300055283 | Bacteria | 1851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0268529 | Ga0496121_0268529_360_1136 | 253 |
| 2 | 3300009147 | Ga0114129_10639802 | Ga0114129_106398022 | 258 |
| 3 | 3300025972 | Ga0207668_10308892 | Ga0207668_103088922 | 258 |
| 4 | iso_pu_bacteria | 2881101125 | 2881103828 | 260 |
| 5 | iso_pu_bacteria | 2599185292 | 2599902841 | 261 |
| 6 | iso_pu_bacteria | 2643221569 | 2643861676 | 261 |
| 7 | iso_pu_bacteria | 2643221594 | 2643983294 | 261 |
| 8 | iso_pu_bacteria | 2643221621 | 2644123560 | 261 |
| 9 | iso_pu_bacteria | 2808606395 | 2809033180 | 261 |
| 10 | iso_pu_bacteria | 2857537821 | 2857538307 | 261 |
| 11 | iso_pu_bacteria | 2858950400 | 2858952149 | 261 |
| 12 | iso_pu_bacteria | 2941479691 | 2941482574 | 261 |
| 13 | 3300005295 | Ga0065707_10099318 | Ga0065707_100993183 | 262 |
| 14 | 3300049823 | Ga0501044_0000250 | Ga0501044_0000250_16044_16895 | 263 |
| 15 | 3300005334 | Ga0068869_100511465 | Ga0068869_1005114651 | 264 |
| 16 | 3300005456 | Ga0070678_100083594 | Ga0070678_1000835942 | 264 |
| 17 | 3300005843 | Ga0068860_100022346 | Ga0068860_1000223464 | 264 |
| 18 | 3300025940 | Ga0207691_10060045 | Ga0207691_100600452 | 264 |
| 19 | 3300026121 | Ga0207683_10084982 | Ga0207683_100849822 | 264 |
| 20 | 3300035695 | Ga0373927_0040780 | Ga0373927_0040780_647_1441 | 264 |
| 21 | 3300025292 | Ga0209676_1004275 | Ga0209676_10042752 | 265 |
| 22 | 3300025937 | Ga0207669_10157002 | Ga0207669_101570022 | 265 |
| 23 | 3300031911 | Ga0307412_10000061 | Ga0307412_1000006194 | 265 |
| 24 | 3300048919 | Ga0496116_0012137 | Ga0496116_0012137_4114_4911 | 265 |
| 25 | 3300048920 | Ga0496117_0031805 | Ga0496117_0031805_2876_3673 | 265 |
| 26 | 3300048921 | Ga0496118_0012576 | Ga0496118_0012576_3436_4233 | 265 |
| 27 | 3300048922 | Ga0496119_0065783 | Ga0496119_0065783_309_1106 | 265 |
| 28 | 3300048922 | Ga0496119_0108474 | Ga0496119_0108474_530_1327 | 265 |
| 29 | 3300048924 | Ga0496121_0008364 | Ga0496121_0008364_10280_11077 | 265 |
| 30 | 3300048924 | Ga0496121_0437785 | Ga0496121_0437785_20_817 | 265 |
| 31 | 3300048925 | Ga0496122_0002003 | Ga0496122_0002003_10356_11153 | 265 |
| 32 | 3300048926 | Ga0496123_0000730 | Ga0496123_0000730_3331_4128 | 265 |
| 33 | 3300048926 | Ga0496123_0034858 | Ga0496123_0034858_1645_2442 | 265 |
| 34 | 3300048927 | Ga0496124_0034831 | Ga0496124_0034831_1618_2415 | 265 |
| 35 | 3300048928 | Ga0496125_0000051 | Ga0496125_0000051_235072_235869 | 265 |
| 36 | 3300048928 | Ga0496125_0005169 | Ga0496125_0005169_9104_9901 | 265 |
| 37 | 3300048929 | Ga0496126_0124816 | Ga0496126_0124816_613_1410 | 265 |
| 38 | 3300037471 | Ga0395905_0087569 | Ga0395905_0087569_617_1420 | 266 |
| 39 | iso_pu_bacteria | 2881927736 | 2881929938 | 268 |
| 40 | 3300003781 | Ga0055536_1003239 | Ga0055536_10032398 | 269 |
| 41 | 3300003792 | Ga0055540_1009523 | Ga0055540_10095232 | 269 |
| 42 | 3300025292 | Ga0209676_1000098 | Ga0209676_1000098151 | 269 |
| 43 | 3300025303 | Ga0209051_1000098 | Ga0209051_1000098151 | 269 |
| 44 | 3300046522 | Ga0495643_0031816 | Ga0495643_0031816_20_832 | 269 |
| 45 | iso_pu_bacteria | 2857576091 | 2857577840 | 269 |
| 46 | iso_pu_bacteria | 2885192300 | 2885194734 | 269 |
| 47 | iso_pu_bacteria | 2894023352 | 2894024178 | 269 |
| 48 | iso_pu_bacteria | 2739367655 | 2739611100 | 270 |
| 49 | iso_pu_bacteria | 2881927736 | 2881930649 | 270 |
| 50 | 3300044712 | Ga0453684_0009647 | Ga0453684_0009647_612_1427 | 271 |
| 51 | 3300044712 | Ga0453684_0022482 | Ga0453684_0022482_5836_6651 | 271 |
| 52 | iso_pu_bacteria | 2643221609 | 2644059584 | 271 |
| 53 | iso_pu_bacteria | 2643221611 | 2644074726 | 271 |
| 54 | iso_pu_bacteria | 2738543012 | 2739241114 | 271 |
| 55 | iso_pu_bacteria | 2816332133 | 2816471808 | 271 |
| 56 | iso_pu_bacteria | 2842733646 | 2842734187 | 271 |
| 57 | iso_pu_bacteria | 2842747753 | 2842749552 | 271 |
| 58 | 3300029957 | Ga0265324_10017219 | Ga0265324_100172192 | 272 |
| 59 | 3300049570 | Ga0501033_0066591 | Ga0501033_0066591_1188_2012 | 272 |
| 60 | 3300049822 | Ga0501035_0106337 | Ga0501035_0106337_399_1223 | 272 |
| 61 | 3300049823 | Ga0501044_0042904 | Ga0501044_0042904_85_909 | 272 |
| 62 | 3300049823 | Ga0501044_0608409 | Ga0501044_0608409_42_863 | 272 |
| 63 | iso_pu_bacteria | 2928115317 | 2928120443 | 272 |
| 64 | 3300003320 | rootH2_10114082 | rootH2_101140822 | 273 |
| 65 | 3300005364 | Ga0070673_100549234 | Ga0070673_1005492342 | 273 |
| 66 | 3300006195 | Ga0075366_10003019 | Ga0075366_100030196 | 273 |
| 67 | 3300014497 | Ga0182008_10032408 | Ga0182008_100324082 | 273 |
| 68 | 3300031251 | Ga0265327_10066955 | Ga0265327_100669552 | 273 |
| 69 | 3300032004 | Ga0307414_10113135 | Ga0307414_101131352 | 273 |
| 70 | 3300041406 | Ga0439439_0017016 | Ga0439439_0017016_318_1139 | 273 |
| 71 | 3300041411 | Ga0439466_0003999 | Ga0439466_0003999_1664_2485 | 273 |
| 72 | 3300041413 | Ga0439465_0002674 | Ga0439465_0002674_1060_1881 | 273 |
| 73 | 3300041997 | Ga0439431_0000597 | Ga0439431_0000597_893_1714 | 273 |
| 74 | 3300041999 | Ga0439433_0000364 | Ga0439433_0000364_6644_7465 | 273 |
| 75 | 3300042002 | Ga0439442_019325 | Ga0439442_019325_90_911 | 273 |
| 76 | 3300042004 | Ga0439445_0000303 | Ga0439445_0000303_3196_4017 | 273 |
| 77 | 3300042006 | Ga0439432_005717 | Ga0439432_005717_517_1338 | 273 |
| 78 | 3300042007 | Ga0439449_0005014 | Ga0439449_0005014_820_1641 | 273 |
| 79 | 3300042007 | Ga0439449_0006098 | Ga0439449_0006098_3708_4529 | 273 |
| 80 | 3300042010 | Ga0439452_000914 | Ga0439452_000914_7638_8459 | 273 |
| 81 | 3300042010 | Ga0439452_037751 | Ga0439452_037751_156_977 | 273 |
| 82 | 3300042015 | Ga0439462_0003728 | Ga0439462_0003728_717_1538 | 273 |
| 83 | 3300042435 | Ga0439434_0007048 | Ga0439434_0007048_80_901 | 273 |
| 84 | 3300046501 | Ga0495607_0000050 | Ga0495607_0000050_69690_70511 | 273 |
| 85 | 3300048091 | Ga0495626_0032402 | Ga0495626_0032402_67_888 | 273 |
| 86 | 3300050493 | nmdc:mga0k408_31921_c1 | nmdc:mga0k408_31921_c1_1514_2335 | 273 |
| 87 | iso_pu_bacteria | 2818991446 | 2819599743 | 273 |
| 88 | iso_pu_bacteria | 2831265667 | 2831271660 | 273 |
| 89 | iso_pu_bacteria | 2838054893 | 2838055573 | 273 |
| 90 | iso_pu_bacteria | 2899924645 | 2899927624 | 273 |
| 91 | iso_pu_bacteria | 2928037797 | 2928042099 | 273 |
| 92 | iso_pu_bacteria | 2928044640 | 2928049663 | 273 |
| 93 | iso_pu_bacteria | 2928051484 | 2928051663 | 273 |
| 94 | iso_pu_bacteria | 2928064002 | 2928065646 | 273 |
| 95 | 3300003323 | rootH1_10093045 | rootH1_100930452 | 274 |
| 96 | 3300003374 | JGI25161J50226_1004375 | JGI25161J50226_10043752 | 274 |
| 97 | 3300003761 | Ga0055535_1000142 | Ga0055535_100014223 | 274 |
| 98 | 3300003762 | Ga0055542_1000022 | Ga0055542_1000022208 | 274 |
| 99 | 3300003771 | Ga0055526_1015128 | Ga0055526_10151283 | 274 |
| 100 | 3300003773 | Ga0055537_1006109 | Ga0055537_10061092 | 274 |
| 101 | 3300003775 | Ga0055524_1013259 | Ga0055524_10132592 | 274 |
| 102 | 3300003781 | Ga0055536_1003639 | Ga0055536_10036393 | 274 |
| 103 | 3300003790 | Ga0055528_1016552 | Ga0055528_10165522 | 274 |
| 104 | 3300003791 | Ga0055530_10002217 | Ga0055530_100022178 | 274 |
| 105 | 3300003792 | Ga0055540_1012381 | Ga0055540_10123812 | 274 |
| 106 | 3300003794 | Ga0055531_10019846 | Ga0055531_100198462 | 274 |
| 107 | 3300004625 | Ga0055543_1004842 | Ga0055543_10048423 | 274 |
| 108 | 3300005262 | Ga0065165_1032933 | Ga0065165_10329332 | 274 |
| 109 | 3300005327 | Ga0070658_10316331 | Ga0070658_103163312 | 274 |
| 110 | 3300005353 | Ga0070669_100014745 | Ga0070669_1000147455 | 274 |
| 111 | 3300005578 | Ga0068854_100168633 | Ga0068854_1001686332 | 274 |
| 112 | 3300006051 | Ga0075364_10030314 | Ga0075364_100303143 | 274 |
| 113 | 3300014497 | Ga0182008_10006578 | Ga0182008_100065785 | 274 |
| 114 | 3300021361 | Ga0213872_10003578 | Ga0213872_100035785 | 274 |
| 115 | 3300025208 | Ga0209436_110411 | Ga0209436_1104112 | 274 |
| 116 | 3300025228 | Ga0209672_100388 | Ga0209672_10038811 | 274 |
| 117 | 3300025229 | Ga0209147_100982 | Ga0209147_1009828 | 274 |
| 118 | 3300025242 | Ga0209258_100009 | Ga0209258_100009871 | 274 |
| 119 | 3300025245 | Ga0207425_1008223 | Ga0207425_10082232 | 274 |
| 120 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007871 | 274 |
| 121 | 3300025258 | Ga0209129_1007753 | Ga0209129_10077532 | 274 |
| 122 | 3300025263 | Ga0209565_1000355 | Ga0209565_100035526 | 274 |
| 123 | 3300025263 | Ga0209565_1001175 | Ga0209565_100117510 | 274 |
| 124 | 3300025273 | Ga0209673_1000615 | Ga0209673_100061528 | 274 |
| 125 | 3300025273 | Ga0209673_1000806 | Ga0209673_100080614 | 274 |
| 126 | 3300025284 | Ga0209130_1000157 | Ga0209130_100015789 | 274 |
| 127 | 3300025291 | Ga0209675_1000504 | Ga0209675_100050420 | 274 |
| 128 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028139 | 274 |
| 129 | 3300025292 | Ga0209676_1000275 | Ga0209676_100027598 | 274 |
| 130 | 3300025294 | Ga0209025_1002963 | Ga0209025_10029631 | 274 |
| 131 | 3300025295 | Ga0209564_1000198 | Ga0209564_1000198128 | 274 |
| 132 | 3300025297 | Ga0209758_1014917 | Ga0209758_10149172 | 274 |
| 133 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002104 | 274 |
| 134 | 3300025298 | Ga0209050_1000122 | Ga0209050_100012292 | 274 |
| 135 | 3300025299 | Ga0209256_1000088 | Ga0209256_10000889 | 274 |
| 136 | 3300025302 | Ga0207426_1000038 | Ga0207426_1000038203 | 274 |
| 137 | 3300025303 | Ga0209051_1000015 | Ga0209051_100001568 | 274 |
| 138 | 3300025303 | Ga0209051_1000168 | Ga0209051_100016897 | 274 |
| 139 | 3300025303 | Ga0209051_1000179 | Ga0209051_100017923 | 274 |
| 140 | 3300025304 | Ga0209257_1000002 | Ga0209257_100000213 | 274 |
| 141 | 3300025909 | Ga0207705_10030389 | Ga0207705_100303893 | 274 |
| 142 | 3300025923 | Ga0207681_10006927 | Ga0207681_100069276 | 274 |
| 143 | 3300028794 | Ga0307515_10204116 | Ga0307515_102041162 | 274 |
| 144 | 3300039447 | Ga0436361_1128018 | Ga0436361_1128018_35401_36225 | 274 |
| 145 | 3300042125 | Ga0450923_006034 | Ga0450923_006034_552_1379 | 274 |
| 146 | 3300042876 | Ga0451577_0084692 | Ga0451577_0084692_725_1549 | 274 |
| 147 | 3300044683 | Ga0466965_0047950 | Ga0466965_0047950_325_1182 | 274 |
| 148 | 3300044712 | Ga0453684_0329577 | Ga0453684_0329577_760_1584 | 274 |
| 149 | 3300045051 | Ga0451576_0020911 | Ga0451576_0020911_763_1587 | 274 |
| 150 | 3300046529 | Ga0495652_0045643 | Ga0495652_0045643_1445_2269 | 274 |
| 151 | 3300046680 | Ga0495646_0000288 | Ga0495646_0000288_6538_7362 | 274 |
| 152 | 3300048088 | Ga0495602_0046249 | Ga0495602_0046249_3056_3880 | 274 |
| 153 | 3300048925 | Ga0496122_0000063 | Ga0496122_0000063_121993_122820 | 274 |
| 154 | 3300048926 | Ga0496123_0000045 | Ga0496123_0000045_172418_173245 | 274 |
| 155 | 3300048927 | Ga0496124_0082523 | Ga0496124_0082523_1555_2382 | 274 |
| 156 | 3300053090 | Ga0500646_0012729 | Ga0500646_0012729_923_1750 | 274 |
| 157 | 3300053094 | Ga0500566_0152021 | Ga0500566_0152021_226_1050 | 274 |
| 158 | 3300053117 | Ga0500593_055821 | Ga0500593_055821_282_1106 | 274 |
| 159 | 3300053136 | Ga0500559_0004803 | Ga0500559_0004803_3020_3847 | 274 |
| 160 | 3300053136 | Ga0500559_0073709 | Ga0500559_0073709_536_1363 | 274 |
| 161 | 3300053161 | Ga0500634_0128083 | Ga0500634_0128083_192_1022 | 274 |
| 162 | 3300055283 | Ga0500661_008848 | Ga0500661_008848_450_1274 | 274 |
| 163 | iso_pu_bacteria | 2855730933 | 2855736671 | 274 |
| 164 | iso_pu_bacteria | 2855767633 | 2855773608 | 274 |
| 165 | iso_pu_bacteria | 2904541872 | 2904549796 | 274 |
| 166 | iso_pu_bacteria | 2929160207 | 2929161763 | 274 |
| 167 | 3300003187 | JGI25151J46595_10006322 | JGI25151J46595_100063222 | 275 |
| 168 | 3300005331 | Ga0070670_100084354 | Ga0070670_1000843542 | 275 |
| 169 | 3300005331 | Ga0070670_100194609 | Ga0070670_1001946093 | 275 |
| 170 | 3300005333 | Ga0070677_10028887 | Ga0070677_100288873 | 275 |
| 171 | 3300005333 | Ga0070677_10095163 | Ga0070677_100951632 | 275 |
| 172 | 3300005336 | Ga0070680_100003976 | Ga0070680_1000039764 | 275 |
| 173 | 3300005354 | Ga0070675_100024403 | Ga0070675_1000244035 | 275 |
| 174 | 3300005354 | Ga0070675_100129438 | Ga0070675_1001294382 | 275 |
| 175 | 3300005355 | Ga0070671_100184349 | Ga0070671_1001843492 | 275 |
| 176 | 3300005356 | Ga0070674_100312114 | Ga0070674_1003121141 | 275 |
| 177 | 3300005364 | Ga0070673_100171617 | Ga0070673_1001716172 | 275 |
| 178 | 3300005456 | Ga0070678_100375064 | Ga0070678_1003750641 | 275 |
| 179 | 3300005457 | Ga0070662_100496168 | Ga0070662_1004961681 | 275 |
| 180 | 3300005458 | Ga0070681_10025766 | Ga0070681_100257665 | 275 |
| 181 | 3300005530 | Ga0070679_100006292 | Ga0070679_10000629210 | 275 |
| 182 | 3300005543 | Ga0070672_100140683 | Ga0070672_1001406833 | 275 |
| 183 | 3300005548 | Ga0070665_100661061 | Ga0070665_1006610611 | 275 |
| 184 | 3300005616 | Ga0068852_100243290 | Ga0068852_1002432902 | 275 |
| 185 | 3300005618 | Ga0068864_100368503 | Ga0068864_1003685031 | 275 |
| 186 | 3300005834 | Ga0068851_10056605 | Ga0068851_100566052 | 275 |
| 187 | 3300006881 | Ga0068865_100137056 | Ga0068865_1001370562 | 275 |
| 188 | 3300009148 | Ga0105243_10047100 | Ga0105243_100471001 | 275 |
| 189 | 3300009176 | Ga0105242_10004151 | Ga0105242_100041513 | 275 |
| 190 | 3300009176 | Ga0105242_10173086 | Ga0105242_101730862 | 275 |
| 191 | 3300013104 | Ga0157370_10109932 | Ga0157370_101099322 | 275 |
| 192 | 3300013105 | Ga0157369_10387935 | Ga0157369_103879352 | 275 |
| 193 | 3300013306 | Ga0163162_10228603 | Ga0163162_102286032 | 275 |
| 194 | 3300013308 | Ga0157375_10716686 | Ga0157375_107166861 | 275 |
| 195 | 3300013308 | Ga0157375_10971294 | Ga0157375_109712941 | 275 |
| 196 | 3300014326 | Ga0157380_10106387 | Ga0157380_101063871 | 275 |
| 197 | 3300017792 | Ga0163161_10034620 | Ga0163161_100346204 | 275 |
| 198 | 3300025294 | Ga0209025_1000272 | Ga0209025_100027221 | 275 |
| 199 | 3300025893 | Ga0207682_10109179 | Ga0207682_101091792 | 275 |
| 200 | 3300025899 | Ga0207642_10225787 | Ga0207642_102257871 | 275 |
| 201 | 3300025901 | Ga0207688_10090453 | Ga0207688_100904532 | 275 |
| 202 | 3300025903 | Ga0207680_10132817 | Ga0207680_101328173 | 275 |
| 203 | 3300025917 | Ga0207660_10021819 | Ga0207660_100218192 | 275 |
| 204 | 3300025921 | Ga0207652_10016331 | Ga0207652_100163315 | 275 |
| 205 | 3300025933 | Ga0207706_10186523 | Ga0207706_101865232 | 275 |
| 206 | 3300025934 | Ga0207686_10003308 | Ga0207686_100033083 | 275 |
| 207 | 3300025940 | Ga0207691_10140768 | Ga0207691_101407682 | 275 |
| 208 | 3300025940 | Ga0207691_10149335 | Ga0207691_101493352 | 275 |
| 209 | 3300026067 | Ga0207678_10096916 | Ga0207678_100969161 | 275 |
| 210 | 3300026089 | Ga0207648_10022265 | Ga0207648_100222653 | 275 |
| 211 | 3300026089 | Ga0207648_10211329 | Ga0207648_102113292 | 275 |
| 212 | 3300026121 | Ga0207683_10011073 | Ga0207683_100110736 | 275 |
| 213 | 3300026121 | Ga0207683_10032188 | Ga0207683_100321885 | 275 |
| 214 | 3300037418 | Ga0395900_0017268 | Ga0395900_0017268_6061_6891 | 275 |
| 215 | 3300037466 | Ga0395898_0059920 | Ga0395898_0059920_1953_2783 | 275 |
| 216 | 3300037471 | Ga0395905_0397690 | Ga0395905_0397690_256_1086 | 275 |
| 217 | 3300038443 | Ga0395901_0117737 | Ga0395901_0117737_478_1308 | 275 |
| 218 | 3300039437 | Ga0436365_0244431 | Ga0436365_0244431_602_1438 | 275 |
| 219 | 3300044656 | Ga0466969_0170916 | Ga0466969_0170916_12_842 | 275 |
| 220 | 3300046530 | Ga0495654_0021662 | Ga0495654_0021662_531_1367 | 275 |
| 221 | 3300005614 | Ga0068856_100139130 | Ga0068856_1001391302 | 276 |
| 222 | 3300006051 | Ga0075364_10009014 | Ga0075364_100090143 | 276 |
| 223 | 3300009148 | Ga0105243_10002650 | Ga0105243_1000265016 | 276 |
| 224 | 3300025935 | Ga0207709_10000138 | Ga0207709_1000013856 | 276 |
| 225 | 3300026078 | Ga0207702_10035976 | Ga0207702_100359764 | 276 |
| 226 | 3300036401 | Ga0373937_0254911 | Ga0373937_0254911_754_1590 | 276 |
| 227 | 3300050491 | nmdc:mga00v17_449_c1 | nmdc:mga00v17_449_c1_17221_18051 | 276 |
| 228 | iso_pu_bacteria | 2842718218 | 2842721515 | 276 |
| 229 | 3300005289 | Ga0065704_10071587 | Ga0065704_100715877 | 277 |
| 230 | 3300005328 | Ga0070676_10022366 | Ga0070676_100223664 | 278 |
| 231 | 3300005331 | Ga0070670_100004735 | Ga0070670_10000473512 | 278 |
| 232 | 3300005333 | Ga0070677_10021941 | Ga0070677_100219412 | 278 |
| 233 | 3300005338 | Ga0068868_100027173 | Ga0068868_1000271732 | 278 |
| 234 | 3300005347 | Ga0070668_100632476 | Ga0070668_1006324761 | 278 |
| 235 | 3300005354 | Ga0070675_100002569 | Ga0070675_1000025696 | 278 |
| 236 | 3300005355 | Ga0070671_100018623 | Ga0070671_1000186231 | 278 |
| 237 | 3300005356 | Ga0070674_100001349 | Ga0070674_1000013497 | 278 |
| 238 | 3300005364 | Ga0070673_100007977 | Ga0070673_1000079775 | 278 |
| 239 | 3300005367 | Ga0070667_100062013 | Ga0070667_1000620134 | 278 |
| 240 | 3300005456 | Ga0070678_100035321 | Ga0070678_1000353212 | 278 |
| 241 | 3300005459 | Ga0068867_100004766 | Ga0068867_1000047666 | 278 |
| 242 | 3300005543 | Ga0070672_100005395 | Ga0070672_1000053957 | 278 |
| 243 | 3300006237 | Ga0097621_100044380 | Ga0097621_1000443804 | 278 |
| 244 | 3300006358 | Ga0068871_100016997 | Ga0068871_1000169976 | 278 |
| 245 | 3300013308 | Ga0157375_10029431 | Ga0157375_100294312 | 278 |
| 246 | 3300014969 | Ga0157376_10296609 | Ga0157376_102966092 | 278 |
| 247 | 3300017792 | Ga0163161_10004415 | Ga0163161_100044157 | 278 |
| 248 | 3300025315 | Ga0207697_10007997 | Ga0207697_100079974 | 278 |
| 249 | 3300025893 | Ga0207682_10003822 | Ga0207682_100038227 | 278 |
| 250 | 3300025907 | Ga0207645_10033943 | Ga0207645_100339432 | 278 |
| 251 | 3300025908 | Ga0207643_10025990 | Ga0207643_100259904 | 278 |
| 252 | 3300025925 | Ga0207650_10001027 | Ga0207650_100010278 | 278 |
| 253 | 3300025926 | Ga0207659_10001133 | Ga0207659_100011338 | 278 |
| 254 | 3300025931 | Ga0207644_10001139 | Ga0207644_100011392 | 278 |
| 255 | 3300025937 | Ga0207669_10012321 | Ga0207669_100123213 | 278 |
| 256 | 3300025940 | Ga0207691_10001104 | Ga0207691_1000110415 | 278 |
| 257 | 3300025960 | Ga0207651_10003576 | Ga0207651_100035761 | 278 |
| 258 | 3300025972 | Ga0207668_10103073 | Ga0207668_101030732 | 278 |
| 259 | 3300025986 | Ga0207658_10078622 | Ga0207658_100786223 | 278 |
| 260 | 3300026023 | Ga0207677_10006244 | Ga0207677_100062444 | 278 |
| 261 | 3300026089 | Ga0207648_10009096 | Ga0207648_100090966 | 278 |
| 262 | 3300026095 | Ga0207676_10029847 | Ga0207676_100298475 | 278 |
| 263 | 3300028379 | Ga0268266_10324363 | Ga0268266_103243632 | 278 |
| 264 | 3300006946 | Ga0079104_1000004 | Ga0079104_1000004343 | 279 |
| 265 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005549 | 279 |
| 266 | iso_pu_bacteria | 2721755523 | 2722884254 | 279 |
| 267 | iso_pu_bacteria | 2839138175 | 2839140763 | 279 |
| 268 | 2162886007 | SwRhRL2b_contig_1418626 | SwRhRL2b_0701.00004990 | 280 |
| 269 | 3300048925 | Ga0496122_0006874 | Ga0496122_0006874_706_1548 | 280 |
| 270 | 3300048925 | Ga0496122_0073350 | Ga0496122_0073350_871_1713 | 280 |
| 271 | 3300048928 | Ga0496125_0005281 | Ga0496125_0005281_2339_3181 | 280 |
| 272 | 3300048929 | Ga0496126_0047899 | Ga0496126_0047899_935_1777 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d03-assembly1.cif.gz_A | 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes | 0.9421 | 6 | 275 |
| 2dxl-assembly1.cif.gz_A | glycerophosphodiesterase from enterobacter aerogenes | 0.9409 | 6 | 275 |
| 2hyp-assembly1.cif.gz_A-2 | crystal structure of rv0805 d66a mutant | 0.9289 | 6 | 259 |
| 2hy1-assembly1.cif.gz_A-2 | crystal structure of rv0805 | 0.9244 | 6 | 259 |
| 2dxl-assembly1.cif.gz_A | glycerophosphodiesterase from enterobacter aerogenes | 0.9208 | 6 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hypA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9289 | 6 | 259 | 3.60.21.10 |
| 2dxlA02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain | 0.9201 | 113 | 238 | 3.30.750.180 |
| 2hypA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9018 | 6 | 259 | 3.60.21.10 |
| 2dxlA02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain | 0.8995 | 113 | 238 | 3.30.750.180 |
| 3ib7A00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8953 | 6 | 276 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519M7K2-F1-model_v4 | Phosphodiesterase | 0.9929 | 4 | 230 |
GO:0004112
|
| AF-A0A519M7K2-F1-model_v4 | Phosphodiesterase | 0.9885 | 4 | 230 |
GO:0004112
|
| AF-A0A0B6S6W4-F1-model_v4 | Metallophosphoesterase | 0.9858 | 6 | 271 |
GO:0004115
|
| AF-A0A838JMB9-F1-model_v4 | Phosphodiesterase | 0.9851 | 6 | 271 |
GO:0004112
|
| AF-A0A1Q9AR10-F1-model_v4 | 3',5'-cyclic-nucleotide phosphodiesterase | 0.9848 | 141 | 271 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar