F378113

General Info

Members Datasets Scaffolds Average Seq Length
272 209 235 281

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10022366|Ga0070676_100223664
Length 298
Sequence MNGMNTMSTPADLSIAASPTILVQLTDLHIREPGRLAYRRVDTSRYFRALVDSVLALKQRADAVVISGDLTDFGRPAEYASLAAQIAPLEAAGLPVYLMPGNHDDRAEMRRSFPTHTHLGDGPSTAVIQFAVDVGPLRLLAIDTCVPMQSAGALDAERLGWLETELDASRERPVVIAMHHPPFQTLIGHMDKIGLLSGAAELEAIVARHRNVERVICGHLHRAIDVRFGGTIASTAPGPAHQVCLDLDPDAVSAWTLEPPAFRVHAWNPAERRLVTHLAASGSFEGPYPFYENGVLID

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2721755523 Delftia sp. HK171 Isolate Unclassified
9 2738543012 Acidovorax sp. CF301 Isolate Unclassified
10 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
11 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
12 2816332133 Acidovorax radicis 2721A Isolate Unclassified
13 2818991446 Variovorax sp. 1180 Isolate Unclassified
14 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
15 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
16 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
17 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
18 2842733646 Variovorax sp. R-72446 Isolate Unclassified
19 2842747753 Variovorax sp. R-72060 Isolate Unclassified
20 2855730933 Achromobacter sp. HZ28 Isolate Nodule
21 2855767633 Achromobacter sp. HZ34 Isolate Nodule
22 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
23 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
24 2858950400 Achromobacter sp. K91 Isolate Unclassified
25 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
26 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
27 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
28 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
29 2899924645 Variovorax sp. 369 Isolate Unclassified
30 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
31 2928037797 Variovorax sp. 1126 Isolate Unclassified
32 2928044640 Variovorax sp. 1128 Isolate Unclassified
33 2928051484 Variovorax sp. 1133 Isolate Unclassified
34 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
35 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
36 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
37 2941479691
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
209 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.4
Metatranscriptomes 0
Isolates 13.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.32
Nodule 2.21
Rhizoplane 0.37
Rhizosphere 58.09
Stem 0
Stem Tuber 0
Unclassified 18.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1418626 2162886007 Bacteria 2054
2 JGI25151J46595_10006322 3300003187 Bacteria 5970
3 rootH2_10114082 3300003320 Bacteria 2278
4 rootH1_10093045 3300003323 Bacteria 1704
5 JGI25161J50226_1004375 3300003374 Bacteria 2965
6 Ga0055535_1000142 3300003761 Bacteria 75104
7 Ga0055542_1000022 3300003762 Bacteria 302315
8 Ga0055526_1015128 3300003771 Bacteria 3115
9 Ga0055537_1006109 3300003773 Bacteria 3110
10 Ga0055524_1013259 3300003775 Bacteria 3115
11 Ga0055536_1003239 3300003781 Bacteria 8818
12 Ga0055536_1003639 3300003781 Bacteria 8211
13 Ga0055528_1016552 3300003790 Bacteria 2600
14 Ga0055530_10002217 3300003791 Bacteria 12832
15 Ga0055540_1009523 3300003792 Bacteria 3345
16 Ga0055540_1012381 3300003792 Bacteria 2681
17 Ga0055531_10019846 3300003794 Bacteria 2695
18 Ga0055543_1004842 3300004625 Bacteria 3567
19 Ga0065165_1032933 3300005262 Bacteria 1619
20 Ga0065704_10071587 3300005289 Bacteria 10610
21 Ga0065707_10099318 3300005295 Bacteria 3016
22 Ga0070658_10316331 3300005327 Bacteria 1332
23 Ga0070676_10022366 3300005328 Bacteria 3544
24 Ga0070670_100004735 3300005331 Bacteria 11419
25 Ga0070670_100084354 3300005331 Bacteria 2729
26 Ga0070670_100194609 3300005331 Bacteria 1761
27 Ga0070677_10021941 3300005333 Bacteria 2347
28 Ga0070677_10028887 3300005333 Bacteria 2098
29 Ga0070677_10095163 3300005333 Bacteria 1303
30 Ga0068869_100511465 3300005334 Bacteria 1004
31 Ga0070680_100003976 3300005336 Bacteria 11064
32 Ga0068868_100027173 3300005338 Bacteria 4365
33 Ga0070668_100632476 3300005347 Bacteria 939
34 Ga0070669_100014745 3300005353 Bacteria 5565
35 Ga0070675_100002569 3300005354 Bacteria 13593
36 Ga0070675_100024403 3300005354 Bacteria 4843
37 Ga0070675_100129438 3300005354 Bacteria 2150
38 Ga0070671_100018623 3300005355 Bacteria 5641
39 Ga0070671_100184349 3300005355 Bacteria 1768
40 Ga0070674_100001349 3300005356 Bacteria 12937
41 Ga0070674_100312114 3300005356 Bacteria 1257
42 Ga0070673_100007977 3300005364 Bacteria 7016
43 Ga0070673_100171617 3300005364 Bacteria 1851
44 Ga0070673_100549234 3300005364 Bacteria 1049
45 Ga0070667_100062013 3300005367 Bacteria 3167
46 Ga0070678_100035321 3300005456 Bacteria 3488
47 Ga0070678_100083594 3300005456 Bacteria 2427
48 Ga0070678_100375064 3300005456 Bacteria 1229
49 Ga0070662_100496168 3300005457 Bacteria 1018
50 Ga0070681_10025766 3300005458 Bacteria 5913
51 Ga0068867_100004766 3300005459 Bacteria 9551
52 Ga0070679_100006292 3300005530 Bacteria 11053
53 Ga0070672_100005395 3300005543 Bacteria 8468
54 Ga0070672_100140683 3300005543 Bacteria 1990
55 Ga0070665_100661061 3300005548 Bacteria 1058
56 Ga0068854_100168633 3300005578 Bacteria 1702
57 Ga0068856_100139130 3300005614 Bacteria 2434
58 Ga0068852_100243290 3300005616 Bacteria 1720
59 Ga0068864_100368503 3300005618 Bacteria 1359
60 Ga0068851_10056605 3300005834 Bacteria 2000
61 Ga0068860_100022346 3300005843 Bacteria 6120
62 Ga0075364_10009014 3300006051 Bacteria 5976
63 Ga0075364_10030314 3300006051 Bacteria 3471
64 Ga0075366_10003019 3300006195 Bacteria 8780
65 Ga0097621_100044380 3300006237 Bacteria 3586
66 Ga0068871_100016997 3300006358 Bacteria 5494
67 Ga0068865_100137056 3300006881 Bacteria 1841
68 Ga0079104_1000004 3300006946 Bacteria 444549
69 Ga0114129_10639802 3300009147 Bacteria 1374
70 Ga0105243_10002650 3300009148 Bacteria 14865
71 Ga0105243_10047100 3300009148 Bacteria 3393
72 Ga0105242_10004151 3300009176 Bacteria 11276
73 Ga0105242_10173086 3300009176 Bacteria 1899
74 Ga0157370_10109932 3300013104 Bacteria 2577
75 Ga0157369_10387935 3300013105 Bacteria 1449
76 Ga0163162_10228603 3300013306 Bacteria 1990
77 Ga0157375_10029431 3300013308 Bacteria 5165
78 Ga0157375_10716686 3300013308 Bacteria 1153
79 Ga0157375_10971294 3300013308 Bacteria 990
80 Ga0157380_10106387 3300014326 Bacteria 2347
81 Ga0182008_10006578 3300014497 Bacteria 6486
82 Ga0182008_10032408 3300014497 Bacteria 2626
83 Ga0157376_10296609 3300014969 Bacteria 1528
84 Ga0163161_10004415 3300017792 Bacteria 9809
85 Ga0163161_10034620 3300017792 Bacteria 3614
86 Ga0213872_10003578 3300021361 Bacteria 8554
87 Ga0209436_110411 3300025208 Bacteria 1703
88 Ga0209672_100388 3300025228 Bacteria 26692
89 Ga0209147_100982 3300025229 Bacteria 12407
90 Ga0209258_100009 3300025242 Bacteria 996276
91 Ga0207425_1008223 3300025245 Bacteria 2687
92 Ga0209148_1000007 3300025254 Bacteria 1592273
93 Ga0209129_1007753 3300025258 Bacteria 3118
94 Ga0209565_1000355 3300025263 Bacteria 40050
95 Ga0209565_1001175 3300025263 Bacteria 12538
96 Ga0209673_1000615 3300025273 Bacteria 54497
97 Ga0209673_1000806 3300025273 Bacteria 41441
98 Ga0209130_1000157 3300025284 Bacteria 101890
99 Ga0209675_1000504 3300025291 Bacteria 29131
100 Ga0209676_1000028 3300025292 Bacteria 559745
101 Ga0209676_1000098 3300025292 Bacteria 234305
102 Ga0209676_1000275 3300025292 Bacteria 107485
103 Ga0209676_1004275 3300025292 Bacteria 8052
104 Ga0209025_1000272 3300025294 Bacteria 120328
105 Ga0209025_1002963 3300025294 Bacteria 16867
106 Ga0209564_1000198 3300025295 Bacteria 138511
107 Ga0209758_1014917 3300025297 Bacteria 4078
108 Ga0209050_1000002 3300025298 Bacteria 1792849
109 Ga0209050_1000122 3300025298 Bacteria 195305
110 Ga0209256_1000088 3300025299 Bacteria 217236
111 Ga0207426_1000038 3300025302 Bacteria 441522
112 Ga0209051_1000015 3300025303 Bacteria 546798
113 Ga0209051_1000098 3300025303 Bacteria 165284
114 Ga0209051_1000168 3300025303 Bacteria 119312
115 Ga0209051_1000179 3300025303 Bacteria 114055
116 Ga0209257_1000002 3300025304 Bacteria 1767052
117 Ga0207697_10007997 3300025315 Bacteria 4669
118 Ga0207682_10003822 3300025893 Bacteria 6463
119 Ga0207682_10109179 3300025893 Bacteria 1217
120 Ga0207642_10225787 3300025899 Bacteria 1049
121 Ga0207688_10090453 3300025901 Bacteria 1757
122 Ga0207680_10132817 3300025903 Bacteria 1642
123 Ga0207645_10033943 3300025907 Bacteria 3278
124 Ga0207643_10025990 3300025908 Bacteria 3239
125 Ga0207705_10030389 3300025909 Bacteria 3855
126 Ga0207660_10021819 3300025917 Bacteria 4309
127 Ga0207652_10016331 3300025921 Bacteria 6060
128 Ga0207681_10006927 3300025923 Bacteria 6954
129 Ga0207650_10001027 3300025925 Bacteria 20954
130 Ga0207659_10001133 3300025926 Bacteria 15808
131 Ga0207644_10001139 3300025931 Bacteria 17037
132 Ga0207706_10186523 3300025933 Bacteria 1821
133 Ga0207686_10003308 3300025934 Bacteria 8670
134 Ga0207709_10000138 3300025935 Bacteria 104006
135 Ga0207669_10012321 3300025937 Bacteria 4200
136 Ga0207669_10157002 3300025937 Bacteria 1601
137 Ga0207691_10001104 3300025940 Bacteria 26843
138 Ga0207691_10060045 3300025940 Bacteria 3456
139 Ga0207691_10140768 3300025940 Bacteria 2126
140 Ga0207691_10149335 3300025940 Bacteria 2055
141 Ga0207651_10003576 3300025960 Bacteria 7641
142 Ga0207668_10103073 3300025972 Bacteria 2124
143 Ga0207668_10308892 3300025972 Bacteria 1308
144 Ga0207658_10078622 3300025986 Bacteria 2521
145 Ga0207677_10006244 3300026023 Bacteria 6517
146 Ga0207678_10096916 3300026067 Bacteria 2520
147 Ga0207702_10035976 3300026078 Bacteria 4141
148 Ga0207648_10009096 3300026089 Bacteria 9549
149 Ga0207648_10022265 3300026089 Bacteria 5694
150 Ga0207648_10211329 3300026089 Bacteria 1722
151 Ga0207676_10029847 3300026095 Bacteria 4086
152 Ga0207683_10011073 3300026121 Bacteria 7684
153 Ga0207683_10032188 3300026121 Bacteria 4555
154 Ga0207683_10084982 3300026121 Bacteria 2813
155 Ga0209281_1000005 3300027111 Bacteria 1242284
156 Ga0268266_10324363 3300028379 Bacteria 1442
157 Ga0307515_10204116 3300028794 Bacteria 1843
158 Ga0265324_10017219 3300029957 Bacteria 2630
159 Ga0265327_10066955 3300031251 Bacteria 1811
160 Ga0307412_10000061 3300031911 Bacteria 126274
161 Ga0307414_10113135 3300032004 Bacteria 2071
162 Ga0373927_0040780 3300035695 Bacteria 3012
163 Ga0373937_0254911 3300036401 Bacteria 1654
164 Ga0395900_0017268 3300037418 Bacteria 7365
165 Ga0395898_0059920 3300037466 Bacteria 3701
166 Ga0395905_0087569 3300037471 Bacteria 2919
167 Ga0395905_0397690 3300037471 Bacteria 1272
168 Ga0395901_0117737 3300038443 Bacteria 2791
169 Ga0436365_0244431 3300039437 Bacteria 1728
170 Ga0436361_1128018 3300039447 Bacteria 39370
171 Ga0439439_0017016 3300041406 Bacteria 1784
172 Ga0439466_0003999 3300041411 Bacteria 5688
173 Ga0439465_0002674 3300041413 Bacteria 5828
174 Ga0439431_0000597 3300041997 Bacteria 7625
175 Ga0439433_0000364 3300041999 Bacteria 8025
176 Ga0439442_019325 3300042002 Bacteria 1410
177 Ga0439445_0000303 3300042004 Bacteria 9578
178 Ga0439432_005717 3300042006 Bacteria 4467
179 Ga0439449_0005014 3300042007 Bacteria 5092
180 Ga0439449_0006098 3300042007 Bacteria 4606
181 Ga0439452_000914 3300042010 Bacteria 13457
182 Ga0439452_037751 3300042010 Bacteria 1150
183 Ga0439462_0003728 3300042015 Bacteria 3680
184 Ga0450923_006034 3300042125 Bacteria 1986
185 Ga0439434_0007048 3300042435 Bacteria 3284
186 Ga0451577_0084692 3300042876 Bacteria 2828
187 Ga0466969_0170916 3300044656 Bacteria 997
188 Ga0466965_0047950 3300044683 Bacteria 2115
189 Ga0453684_0009647 3300044712 Bacteria 16822
190 Ga0453684_0022482 3300044712 Bacteria 9348
191 Ga0453684_0329577 3300044712 Bacteria 1726
192 Ga0451576_0020911 3300045051 Bacteria 7122
193 Ga0495607_0000050 3300046501 Bacteria 120052
194 Ga0495643_0031816 3300046522 Bacteria 2933
195 Ga0495652_0045643 3300046529 Bacteria 3765
196 Ga0495654_0021662 3300046530 Bacteria 3342
197 Ga0495646_0000288 3300046680 Bacteria 25753
198 Ga0495602_0046249 3300048088 Bacteria 3933
199 Ga0495626_0032402 3300048091 Bacteria 2510
200 Ga0496116_0012137 3300048919 Bacteria 7055
201 Ga0496117_0031805 3300048920 Bacteria 4023
202 Ga0496118_0012576 3300048921 Bacteria 8105
203 Ga0496119_0065783 3300048922 Bacteria 2145
204 Ga0496119_0108474 3300048922 Bacteria 1545
205 Ga0496121_0008364 3300048924 Bacteria 12209
206 Ga0496121_0268529 3300048924 Bacteria 1174
207 Ga0496121_0437785 3300048924 Bacteria 846
208 Ga0496122_0000063 3300048925 Bacteria 241378
209 Ga0496122_0002003 3300048925 Bacteria 30327
210 Ga0496122_0006874 3300048925 Bacteria 12878
211 Ga0496122_0073350 3300048925 Bacteria 2427
212 Ga0496123_0000045 3300048926 Bacteria 249294
213 Ga0496123_0000730 3300048926 Bacteria 53397
214 Ga0496123_0034858 3300048926 Bacteria 3597
215 Ga0496124_0034831 3300048927 Bacteria 4411
216 Ga0496124_0082523 3300048927 Bacteria 2638
217 Ga0496125_0000051 3300048928 Bacteria 285754
218 Ga0496125_0005169 3300048928 Bacteria 14676
219 Ga0496125_0005281 3300048928 Bacteria 14459
220 Ga0496126_0047899 3300048929 Bacteria 3911
221 Ga0496126_0124816 3300048929 Bacteria 2229
222 Ga0501033_0066591 3300049570 Bacteria 2649
223 Ga0501035_0106337 3300049822 Bacteria 2460
224 Ga0501044_0000250 3300049823 Bacteria 68405
225 Ga0501044_0042904 3300049823 Bacteria 4701
226 Ga0501044_0608409 3300049823 Bacteria 985
227 nmdc:mga00v17_449_c1 3300050491 Bacteria 23134
228 nmdc:mga0k408_31921_c1 3300050493 Bacteria 3009
229 Ga0500646_0012729 3300053090 Bacteria 2174
230 Ga0500566_0152021 3300053094 Bacteria 1216
231 Ga0500593_055821 3300053117 Bacteria 1744
232 Ga0500559_0004803 3300053136 Bacteria 6321
233 Ga0500559_0073709 3300053136 Bacteria 1541
234 Ga0500634_0128083 3300053161 Bacteria 1223
235 Ga0500661_008848 3300055283 Bacteria 1851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0268529 Ga0496121_0268529_360_1136 253
2 3300009147 Ga0114129_10639802 Ga0114129_106398022 258
3 3300025972 Ga0207668_10308892 Ga0207668_103088922 258
4 iso_pu_bacteria 2881101125 2881103828 260
5 iso_pu_bacteria 2599185292 2599902841 261
6 iso_pu_bacteria 2643221569 2643861676 261
7 iso_pu_bacteria 2643221594 2643983294 261
8 iso_pu_bacteria 2643221621 2644123560 261
9 iso_pu_bacteria 2808606395 2809033180 261
10 iso_pu_bacteria 2857537821 2857538307 261
11 iso_pu_bacteria 2858950400 2858952149 261
12 iso_pu_bacteria 2941479691 2941482574 261
13 3300005295 Ga0065707_10099318 Ga0065707_100993183 262
14 3300049823 Ga0501044_0000250 Ga0501044_0000250_16044_16895 263
15 3300005334 Ga0068869_100511465 Ga0068869_1005114651 264
16 3300005456 Ga0070678_100083594 Ga0070678_1000835942 264
17 3300005843 Ga0068860_100022346 Ga0068860_1000223464 264
18 3300025940 Ga0207691_10060045 Ga0207691_100600452 264
19 3300026121 Ga0207683_10084982 Ga0207683_100849822 264
20 3300035695 Ga0373927_0040780 Ga0373927_0040780_647_1441 264
21 3300025292 Ga0209676_1004275 Ga0209676_10042752 265
22 3300025937 Ga0207669_10157002 Ga0207669_101570022 265
23 3300031911 Ga0307412_10000061 Ga0307412_1000006194 265
24 3300048919 Ga0496116_0012137 Ga0496116_0012137_4114_4911 265
25 3300048920 Ga0496117_0031805 Ga0496117_0031805_2876_3673 265
26 3300048921 Ga0496118_0012576 Ga0496118_0012576_3436_4233 265
27 3300048922 Ga0496119_0065783 Ga0496119_0065783_309_1106 265
28 3300048922 Ga0496119_0108474 Ga0496119_0108474_530_1327 265
29 3300048924 Ga0496121_0008364 Ga0496121_0008364_10280_11077 265
30 3300048924 Ga0496121_0437785 Ga0496121_0437785_20_817 265
31 3300048925 Ga0496122_0002003 Ga0496122_0002003_10356_11153 265
32 3300048926 Ga0496123_0000730 Ga0496123_0000730_3331_4128 265
33 3300048926 Ga0496123_0034858 Ga0496123_0034858_1645_2442 265
34 3300048927 Ga0496124_0034831 Ga0496124_0034831_1618_2415 265
35 3300048928 Ga0496125_0000051 Ga0496125_0000051_235072_235869 265
36 3300048928 Ga0496125_0005169 Ga0496125_0005169_9104_9901 265
37 3300048929 Ga0496126_0124816 Ga0496126_0124816_613_1410 265
38 3300037471 Ga0395905_0087569 Ga0395905_0087569_617_1420 266
39 iso_pu_bacteria 2881927736 2881929938 268
40 3300003781 Ga0055536_1003239 Ga0055536_10032398 269
41 3300003792 Ga0055540_1009523 Ga0055540_10095232 269
42 3300025292 Ga0209676_1000098 Ga0209676_1000098151 269
43 3300025303 Ga0209051_1000098 Ga0209051_1000098151 269
44 3300046522 Ga0495643_0031816 Ga0495643_0031816_20_832 269
45 iso_pu_bacteria 2857576091 2857577840 269
46 iso_pu_bacteria 2885192300 2885194734 269
47 iso_pu_bacteria 2894023352 2894024178 269
48 iso_pu_bacteria 2739367655 2739611100 270
49 iso_pu_bacteria 2881927736 2881930649 270
50 3300044712 Ga0453684_0009647 Ga0453684_0009647_612_1427 271
51 3300044712 Ga0453684_0022482 Ga0453684_0022482_5836_6651 271
52 iso_pu_bacteria 2643221609 2644059584 271
53 iso_pu_bacteria 2643221611 2644074726 271
54 iso_pu_bacteria 2738543012 2739241114 271
55 iso_pu_bacteria 2816332133 2816471808 271
56 iso_pu_bacteria 2842733646 2842734187 271
57 iso_pu_bacteria 2842747753 2842749552 271
58 3300029957 Ga0265324_10017219 Ga0265324_100172192 272
59 3300049570 Ga0501033_0066591 Ga0501033_0066591_1188_2012 272
60 3300049822 Ga0501035_0106337 Ga0501035_0106337_399_1223 272
61 3300049823 Ga0501044_0042904 Ga0501044_0042904_85_909 272
62 3300049823 Ga0501044_0608409 Ga0501044_0608409_42_863 272
63 iso_pu_bacteria 2928115317 2928120443 272
64 3300003320 rootH2_10114082 rootH2_101140822 273
65 3300005364 Ga0070673_100549234 Ga0070673_1005492342 273
66 3300006195 Ga0075366_10003019 Ga0075366_100030196 273
67 3300014497 Ga0182008_10032408 Ga0182008_100324082 273
68 3300031251 Ga0265327_10066955 Ga0265327_100669552 273
69 3300032004 Ga0307414_10113135 Ga0307414_101131352 273
70 3300041406 Ga0439439_0017016 Ga0439439_0017016_318_1139 273
71 3300041411 Ga0439466_0003999 Ga0439466_0003999_1664_2485 273
72 3300041413 Ga0439465_0002674 Ga0439465_0002674_1060_1881 273
73 3300041997 Ga0439431_0000597 Ga0439431_0000597_893_1714 273
74 3300041999 Ga0439433_0000364 Ga0439433_0000364_6644_7465 273
75 3300042002 Ga0439442_019325 Ga0439442_019325_90_911 273
76 3300042004 Ga0439445_0000303 Ga0439445_0000303_3196_4017 273
77 3300042006 Ga0439432_005717 Ga0439432_005717_517_1338 273
78 3300042007 Ga0439449_0005014 Ga0439449_0005014_820_1641 273
79 3300042007 Ga0439449_0006098 Ga0439449_0006098_3708_4529 273
80 3300042010 Ga0439452_000914 Ga0439452_000914_7638_8459 273
81 3300042010 Ga0439452_037751 Ga0439452_037751_156_977 273
82 3300042015 Ga0439462_0003728 Ga0439462_0003728_717_1538 273
83 3300042435 Ga0439434_0007048 Ga0439434_0007048_80_901 273
84 3300046501 Ga0495607_0000050 Ga0495607_0000050_69690_70511 273
85 3300048091 Ga0495626_0032402 Ga0495626_0032402_67_888 273
86 3300050493 nmdc:mga0k408_31921_c1 nmdc:mga0k408_31921_c1_1514_2335 273
87 iso_pu_bacteria 2818991446 2819599743 273
88 iso_pu_bacteria 2831265667 2831271660 273
89 iso_pu_bacteria 2838054893 2838055573 273
90 iso_pu_bacteria 2899924645 2899927624 273
91 iso_pu_bacteria 2928037797 2928042099 273
92 iso_pu_bacteria 2928044640 2928049663 273
93 iso_pu_bacteria 2928051484 2928051663 273
94 iso_pu_bacteria 2928064002 2928065646 273
95 3300003323 rootH1_10093045 rootH1_100930452 274
96 3300003374 JGI25161J50226_1004375 JGI25161J50226_10043752 274
97 3300003761 Ga0055535_1000142 Ga0055535_100014223 274
98 3300003762 Ga0055542_1000022 Ga0055542_1000022208 274
99 3300003771 Ga0055526_1015128 Ga0055526_10151283 274
100 3300003773 Ga0055537_1006109 Ga0055537_10061092 274
101 3300003775 Ga0055524_1013259 Ga0055524_10132592 274
102 3300003781 Ga0055536_1003639 Ga0055536_10036393 274
103 3300003790 Ga0055528_1016552 Ga0055528_10165522 274
104 3300003791 Ga0055530_10002217 Ga0055530_100022178 274
105 3300003792 Ga0055540_1012381 Ga0055540_10123812 274
106 3300003794 Ga0055531_10019846 Ga0055531_100198462 274
107 3300004625 Ga0055543_1004842 Ga0055543_10048423 274
108 3300005262 Ga0065165_1032933 Ga0065165_10329332 274
109 3300005327 Ga0070658_10316331 Ga0070658_103163312 274
110 3300005353 Ga0070669_100014745 Ga0070669_1000147455 274
111 3300005578 Ga0068854_100168633 Ga0068854_1001686332 274
112 3300006051 Ga0075364_10030314 Ga0075364_100303143 274
113 3300014497 Ga0182008_10006578 Ga0182008_100065785 274
114 3300021361 Ga0213872_10003578 Ga0213872_100035785 274
115 3300025208 Ga0209436_110411 Ga0209436_1104112 274
116 3300025228 Ga0209672_100388 Ga0209672_10038811 274
117 3300025229 Ga0209147_100982 Ga0209147_1009828 274
118 3300025242 Ga0209258_100009 Ga0209258_100009871 274
119 3300025245 Ga0207425_1008223 Ga0207425_10082232 274
120 3300025254 Ga0209148_1000007 Ga0209148_1000007871 274
121 3300025258 Ga0209129_1007753 Ga0209129_10077532 274
122 3300025263 Ga0209565_1000355 Ga0209565_100035526 274
123 3300025263 Ga0209565_1001175 Ga0209565_100117510 274
124 3300025273 Ga0209673_1000615 Ga0209673_100061528 274
125 3300025273 Ga0209673_1000806 Ga0209673_100080614 274
126 3300025284 Ga0209130_1000157 Ga0209130_100015789 274
127 3300025291 Ga0209675_1000504 Ga0209675_100050420 274
128 3300025292 Ga0209676_1000028 Ga0209676_1000028139 274
129 3300025292 Ga0209676_1000275 Ga0209676_100027598 274
130 3300025294 Ga0209025_1002963 Ga0209025_10029631 274
131 3300025295 Ga0209564_1000198 Ga0209564_1000198128 274
132 3300025297 Ga0209758_1014917 Ga0209758_10149172 274
133 3300025298 Ga0209050_1000002 Ga0209050_1000002104 274
134 3300025298 Ga0209050_1000122 Ga0209050_100012292 274
135 3300025299 Ga0209256_1000088 Ga0209256_10000889 274
136 3300025302 Ga0207426_1000038 Ga0207426_1000038203 274
137 3300025303 Ga0209051_1000015 Ga0209051_100001568 274
138 3300025303 Ga0209051_1000168 Ga0209051_100016897 274
139 3300025303 Ga0209051_1000179 Ga0209051_100017923 274
140 3300025304 Ga0209257_1000002 Ga0209257_100000213 274
141 3300025909 Ga0207705_10030389 Ga0207705_100303893 274
142 3300025923 Ga0207681_10006927 Ga0207681_100069276 274
143 3300028794 Ga0307515_10204116 Ga0307515_102041162 274
144 3300039447 Ga0436361_1128018 Ga0436361_1128018_35401_36225 274
145 3300042125 Ga0450923_006034 Ga0450923_006034_552_1379 274
146 3300042876 Ga0451577_0084692 Ga0451577_0084692_725_1549 274
147 3300044683 Ga0466965_0047950 Ga0466965_0047950_325_1182 274
148 3300044712 Ga0453684_0329577 Ga0453684_0329577_760_1584 274
149 3300045051 Ga0451576_0020911 Ga0451576_0020911_763_1587 274
150 3300046529 Ga0495652_0045643 Ga0495652_0045643_1445_2269 274
151 3300046680 Ga0495646_0000288 Ga0495646_0000288_6538_7362 274
152 3300048088 Ga0495602_0046249 Ga0495602_0046249_3056_3880 274
153 3300048925 Ga0496122_0000063 Ga0496122_0000063_121993_122820 274
154 3300048926 Ga0496123_0000045 Ga0496123_0000045_172418_173245 274
155 3300048927 Ga0496124_0082523 Ga0496124_0082523_1555_2382 274
156 3300053090 Ga0500646_0012729 Ga0500646_0012729_923_1750 274
157 3300053094 Ga0500566_0152021 Ga0500566_0152021_226_1050 274
158 3300053117 Ga0500593_055821 Ga0500593_055821_282_1106 274
159 3300053136 Ga0500559_0004803 Ga0500559_0004803_3020_3847 274
160 3300053136 Ga0500559_0073709 Ga0500559_0073709_536_1363 274
161 3300053161 Ga0500634_0128083 Ga0500634_0128083_192_1022 274
162 3300055283 Ga0500661_008848 Ga0500661_008848_450_1274 274
163 iso_pu_bacteria 2855730933 2855736671 274
164 iso_pu_bacteria 2855767633 2855773608 274
165 iso_pu_bacteria 2904541872 2904549796 274
166 iso_pu_bacteria 2929160207 2929161763 274
167 3300003187 JGI25151J46595_10006322 JGI25151J46595_100063222 275
168 3300005331 Ga0070670_100084354 Ga0070670_1000843542 275
169 3300005331 Ga0070670_100194609 Ga0070670_1001946093 275
170 3300005333 Ga0070677_10028887 Ga0070677_100288873 275
171 3300005333 Ga0070677_10095163 Ga0070677_100951632 275
172 3300005336 Ga0070680_100003976 Ga0070680_1000039764 275
173 3300005354 Ga0070675_100024403 Ga0070675_1000244035 275
174 3300005354 Ga0070675_100129438 Ga0070675_1001294382 275
175 3300005355 Ga0070671_100184349 Ga0070671_1001843492 275
176 3300005356 Ga0070674_100312114 Ga0070674_1003121141 275
177 3300005364 Ga0070673_100171617 Ga0070673_1001716172 275
178 3300005456 Ga0070678_100375064 Ga0070678_1003750641 275
179 3300005457 Ga0070662_100496168 Ga0070662_1004961681 275
180 3300005458 Ga0070681_10025766 Ga0070681_100257665 275
181 3300005530 Ga0070679_100006292 Ga0070679_10000629210 275
182 3300005543 Ga0070672_100140683 Ga0070672_1001406833 275
183 3300005548 Ga0070665_100661061 Ga0070665_1006610611 275
184 3300005616 Ga0068852_100243290 Ga0068852_1002432902 275
185 3300005618 Ga0068864_100368503 Ga0068864_1003685031 275
186 3300005834 Ga0068851_10056605 Ga0068851_100566052 275
187 3300006881 Ga0068865_100137056 Ga0068865_1001370562 275
188 3300009148 Ga0105243_10047100 Ga0105243_100471001 275
189 3300009176 Ga0105242_10004151 Ga0105242_100041513 275
190 3300009176 Ga0105242_10173086 Ga0105242_101730862 275
191 3300013104 Ga0157370_10109932 Ga0157370_101099322 275
192 3300013105 Ga0157369_10387935 Ga0157369_103879352 275
193 3300013306 Ga0163162_10228603 Ga0163162_102286032 275
194 3300013308 Ga0157375_10716686 Ga0157375_107166861 275
195 3300013308 Ga0157375_10971294 Ga0157375_109712941 275
196 3300014326 Ga0157380_10106387 Ga0157380_101063871 275
197 3300017792 Ga0163161_10034620 Ga0163161_100346204 275
198 3300025294 Ga0209025_1000272 Ga0209025_100027221 275
199 3300025893 Ga0207682_10109179 Ga0207682_101091792 275
200 3300025899 Ga0207642_10225787 Ga0207642_102257871 275
201 3300025901 Ga0207688_10090453 Ga0207688_100904532 275
202 3300025903 Ga0207680_10132817 Ga0207680_101328173 275
203 3300025917 Ga0207660_10021819 Ga0207660_100218192 275
204 3300025921 Ga0207652_10016331 Ga0207652_100163315 275
205 3300025933 Ga0207706_10186523 Ga0207706_101865232 275
206 3300025934 Ga0207686_10003308 Ga0207686_100033083 275
207 3300025940 Ga0207691_10140768 Ga0207691_101407682 275
208 3300025940 Ga0207691_10149335 Ga0207691_101493352 275
209 3300026067 Ga0207678_10096916 Ga0207678_100969161 275
210 3300026089 Ga0207648_10022265 Ga0207648_100222653 275
211 3300026089 Ga0207648_10211329 Ga0207648_102113292 275
212 3300026121 Ga0207683_10011073 Ga0207683_100110736 275
213 3300026121 Ga0207683_10032188 Ga0207683_100321885 275
214 3300037418 Ga0395900_0017268 Ga0395900_0017268_6061_6891 275
215 3300037466 Ga0395898_0059920 Ga0395898_0059920_1953_2783 275
216 3300037471 Ga0395905_0397690 Ga0395905_0397690_256_1086 275
217 3300038443 Ga0395901_0117737 Ga0395901_0117737_478_1308 275
218 3300039437 Ga0436365_0244431 Ga0436365_0244431_602_1438 275
219 3300044656 Ga0466969_0170916 Ga0466969_0170916_12_842 275
220 3300046530 Ga0495654_0021662 Ga0495654_0021662_531_1367 275
221 3300005614 Ga0068856_100139130 Ga0068856_1001391302 276
222 3300006051 Ga0075364_10009014 Ga0075364_100090143 276
223 3300009148 Ga0105243_10002650 Ga0105243_1000265016 276
224 3300025935 Ga0207709_10000138 Ga0207709_1000013856 276
225 3300026078 Ga0207702_10035976 Ga0207702_100359764 276
226 3300036401 Ga0373937_0254911 Ga0373937_0254911_754_1590 276
227 3300050491 nmdc:mga00v17_449_c1 nmdc:mga00v17_449_c1_17221_18051 276
228 iso_pu_bacteria 2842718218 2842721515 276
229 3300005289 Ga0065704_10071587 Ga0065704_100715877 277
230 3300005328 Ga0070676_10022366 Ga0070676_100223664 278
231 3300005331 Ga0070670_100004735 Ga0070670_10000473512 278
232 3300005333 Ga0070677_10021941 Ga0070677_100219412 278
233 3300005338 Ga0068868_100027173 Ga0068868_1000271732 278
234 3300005347 Ga0070668_100632476 Ga0070668_1006324761 278
235 3300005354 Ga0070675_100002569 Ga0070675_1000025696 278
236 3300005355 Ga0070671_100018623 Ga0070671_1000186231 278
237 3300005356 Ga0070674_100001349 Ga0070674_1000013497 278
238 3300005364 Ga0070673_100007977 Ga0070673_1000079775 278
239 3300005367 Ga0070667_100062013 Ga0070667_1000620134 278
240 3300005456 Ga0070678_100035321 Ga0070678_1000353212 278
241 3300005459 Ga0068867_100004766 Ga0068867_1000047666 278
242 3300005543 Ga0070672_100005395 Ga0070672_1000053957 278
243 3300006237 Ga0097621_100044380 Ga0097621_1000443804 278
244 3300006358 Ga0068871_100016997 Ga0068871_1000169976 278
245 3300013308 Ga0157375_10029431 Ga0157375_100294312 278
246 3300014969 Ga0157376_10296609 Ga0157376_102966092 278
247 3300017792 Ga0163161_10004415 Ga0163161_100044157 278
248 3300025315 Ga0207697_10007997 Ga0207697_100079974 278
249 3300025893 Ga0207682_10003822 Ga0207682_100038227 278
250 3300025907 Ga0207645_10033943 Ga0207645_100339432 278
251 3300025908 Ga0207643_10025990 Ga0207643_100259904 278
252 3300025925 Ga0207650_10001027 Ga0207650_100010278 278
253 3300025926 Ga0207659_10001133 Ga0207659_100011338 278
254 3300025931 Ga0207644_10001139 Ga0207644_100011392 278
255 3300025937 Ga0207669_10012321 Ga0207669_100123213 278
256 3300025940 Ga0207691_10001104 Ga0207691_1000110415 278
257 3300025960 Ga0207651_10003576 Ga0207651_100035761 278
258 3300025972 Ga0207668_10103073 Ga0207668_101030732 278
259 3300025986 Ga0207658_10078622 Ga0207658_100786223 278
260 3300026023 Ga0207677_10006244 Ga0207677_100062444 278
261 3300026089 Ga0207648_10009096 Ga0207648_100090966 278
262 3300026095 Ga0207676_10029847 Ga0207676_100298475 278
263 3300028379 Ga0268266_10324363 Ga0268266_103243632 278
264 3300006946 Ga0079104_1000004 Ga0079104_1000004343 279
265 3300027111 Ga0209281_1000005 Ga0209281_1000005549 279
266 iso_pu_bacteria 2721755523 2722884254 279
267 iso_pu_bacteria 2839138175 2839140763 279
268 2162886007 SwRhRL2b_contig_1418626 SwRhRL2b_0701.00004990 280
269 3300048925 Ga0496122_0006874 Ga0496122_0006874_706_1548 280
270 3300048925 Ga0496122_0073350 Ga0496122_0073350_871_1713 280
271 3300048928 Ga0496125_0005281 Ga0496125_0005281_2339_3181 280
272 3300048929 Ga0496126_0047899 Ga0496126_0047899_935_1777 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

21

223

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d03-assembly1.cif.gz_A 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes 0.9421 6 275
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.9409 6 275
2hyp-assembly1.cif.gz_A-2 crystal structure of rv0805 d66a mutant 0.9289 6 259
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.9244 6 259
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.9208 6 275
ID Description Score Start End Superfamily
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9289 6 259 3.60.21.10
2dxlA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain 0.9201 113 238 3.30.750.180
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9018 6 259 3.60.21.10
2dxlA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain 0.8995 113 238 3.30.750.180
3ib7A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8953 6 276 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A519M7K2-F1-model_v4 Phosphodiesterase 0.9929 4 230 GO:0004112
AF-A0A519M7K2-F1-model_v4 Phosphodiesterase 0.9885 4 230 GO:0004112
AF-A0A0B6S6W4-F1-model_v4 Metallophosphoesterase 0.9858 6 271 GO:0004115
AF-A0A838JMB9-F1-model_v4 Phosphodiesterase 0.9851 6 271 GO:0004112
AF-A0A1Q9AR10-F1-model_v4 3',5'-cyclic-nucleotide phosphodiesterase 0.9848 141 271

Feature Viewer

pLDDT pTM Quality
95.94 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map