F377995

General Info

Members Datasets Scaffolds Average Seq Length
271 182 542 112

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_1867681|Ga0501084_1867681_12_422
Length 136
Sequence VAGHRTVRGPPGAPGNGLIKETDMSGINEFIDNEVKGNDVVLFMKGTPQFPQCGFSGQLVQILDYLGTPYKGINVLESDDLRQGIKAYTQWPTIPQLYVKGEFVGGCDIVREMFQAGELQSLLKEKGLPAKDTAPA

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
180 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
181 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
182 2848858292 Azospirillum brasilense Az39 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.41
Metatranscriptomes 7.75
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.13
Nodule 0
Rhizoplane 0
Rhizosphere 77.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_1867681 3300054114 Bacteria 501
2 Ga0006778J45830_1076892 3300003162 Bacteria 528
3 JGI25153J46596_10003979 3300003215 Bacteria 8079
4 Ga0058861_11793751 3300004800 Bacteria 1071
5 Ga0058862_12576960 3300004803 Bacteria 877
6 Ga0070680_100349739 3300005336 Bacteria 1257
7 Ga0070680_101173586 3300005336 Bacteria 664
8 Ga0070682_100097574 3300005337 Bacteria 1935
9 Ga0070689_100226958 3300005340 Bacteria 1534
10 Ga0070669_101991545 3300005353 Bacteria 508
11 Ga0070674_100820276 3300005356 Bacteria 805
12 Ga0070714_100280483 3300005435 Bacteria 1548
13 Ga0070714_100410658 3300005435 Bacteria 1281
14 Ga0070711_101371711 3300005439 Bacteria 615
15 Ga0070681_11083987 3300005458 Bacteria 722
16 Ga0070681_11802532 3300005458 Bacteria 539
17 Ga0070706_100040715 3300005467 Bacteria 4289
18 Ga0070679_100124507 3300005530 Bacteria 2560
19 Ga0070679_100747162 3300005530 Bacteria 921
20 Ga0068853_100696430 3300005539 Bacteria 969
21 Ga0070665_100393321 3300005548 Bacteria 1394
22 Ga0068855_100211740 3300005563 Bacteria 2177
23 Ga0068852_100317154 3300005616 Bacteria 1513
24 Ga0068870_10920901 3300005840 Bacteria 619
25 Ga0068858_100873501 3300005842 Bacteria 879
26 Ga0068860_100263713 3300005843 Bacteria 1680
27 Ga0068862_101284789 3300005844 Bacteria 733
28 Ga0081455_10228560 3300005937 Bacteria 1374
29 Ga0081455_10233113 3300005937 Bacteria 1357
30 Ga0081455_10463829 3300005937 Bacteria 862
31 Ga0081538_10013498 3300005981 Bacteria 6461
32 Ga0081538_10023314 3300005981 Bacteria 4453
33 Ga0070717_10220743 3300006028 Bacteria 1666
34 Ga0070717_10224553 3300006028 Bacteria 1652
35 Ga0075365_10133847 3300006038 Bacteria 1717
36 Ga0075365_10419610 3300006038 Bacteria 945
37 Ga0075368_10122253 3300006042 Bacteria 1079
38 Ga0075368_10149681 3300006042 Bacteria 975
39 Ga0075363_100106771 3300006048 Bacteria 1553
40 Ga0075363_100207888 3300006048 Bacteria 1120
41 Ga0075364_10184239 3300006051 Bacteria 1413
42 Ga0075364_10238255 3300006051 Bacteria 1236
43 Ga0075364_10637484 3300006051 Bacteria 728
44 Ga0070715_10053415 3300006163 Bacteria 1746
45 Ga0070716_100178340 3300006173 Bacteria 1392
46 Ga0070712_100182899 3300006175 Bacteria 1635
47 Ga0075362_10174759 3300006177 Bacteria 1039
48 Ga0075367_10237030 3300006178 Bacteria 1143
49 Ga0075367_10250649 3300006178 Bacteria 1110
50 Ga0075367_10824949 3300006178 Bacteria 591
51 Ga0075369_10475926 3300006186 Bacteria 592
52 Ga0075366_10068115 3300006195 Bacteria 2118
53 Ga0097621_100290664 3300006237 Bacteria 1441
54 Ga0068871_100678277 3300006358 Bacteria 943
55 Ga0068871_101141515 3300006358 Bacteria 729
56 Ga0075430_101134948 3300006846 Bacteria 644
57 Ga0075433_11466387 3300006852 Bacteria 590
58 Ga0075429_100592173 3300006880 Bacteria 972
59 Ga0075429_101243384 3300006880 Bacteria 650
60 Ga0075436_100908387 3300006914 Bacteria 659
61 Ga0099794_10069794 3300007265 Bacteria 1719
62 Ga0099795_10009364 3300007788 Bacteria 2839
63 Ga0105240_10494392 3300009093 Bacteria 1361
64 Ga0105240_10567952 3300009093 Bacteria 1253
65 Ga0111539_12573333 3300009094 Bacteria 590
66 Ga0105245_10762167 3300009098 Bacteria 1004
67 Ga0105247_10386211 3300009101 Bacteria 994
68 Ga0114129_10165394 3300009147 Bacteria 3019
69 Ga0114129_11381900 3300009147 Bacteria 869
70 Ga0105243_10228057 3300009148 Bacteria 1651
71 Ga0105248_10228239 3300009177 Bacteria 2096
72 Ga0105248_11010430 3300009177 Bacteria 940
73 Ga0105248_11580184 3300009177 Bacteria 743
74 Ga0105238_12267726 3300009551 Bacteria 578
75 Ga0105249_10806788 3300009553 Bacteria 1003
76 Ga0105249_12259351 3300009553 Bacteria 617
77 Ga0105249_12939322 3300009553 Bacteria 547
78 Ga0105239_10409855 3300010375 Bacteria 1535
79 Ga0105246_11210142 3300011119 Bacteria 696
80 Ga0157374_10198558 3300013296 Bacteria 1964
81 Ga0157378_10498778 3300013297 Bacteria 1216
82 Ga0157372_10992743 3300013307 Bacteria 972
83 Ga0157380_10449865 3300014326 Bacteria 1237
84 Ga0157379_10493884 3300014968 Bacteria 1134
85 Ga0157376_10384059 3300014969 Bacteria 1353
86 Ga0197907_10638728 3300020069 Bacteria 1214
87 Ga0206356_10916460 3300020070 Bacteria 1068
88 Ga0206356_11445123 3300020070 Bacteria 623
89 Ga0206349_1076069 3300020075 Bacteria 1047
90 Ga0206350_10368273 3300020080 Bacteria 1118
91 Ga0206353_10145036 3300020082 Bacteria 910
92 Ga0154015_1422482 3300020610 Bacteria 708
93 Ga0154015_1633464 3300020610 Bacteria 802
94 Ga0213876_10127081 3300021384 Bacteria 1354
95 Ga0213875_10000007 3300021388 Bacteria 562717
96 Ga0213871_10012959 3300021441 Bacteria 1948
97 Ga0224712_10015137 3300022467 Bacteria 2503
98 Ga0224712_10468069 3300022467 Bacteria 606
99 Ga0209758_1000060 3300025297 Bacteria 324326
100 Ga0209758_1000158 3300025297 Bacteria 156129
101 Ga0207710_10308824 3300025900 Bacteria 800
102 Ga0207685_10019789 3300025905 Bacteria 2224
103 Ga0207645_11000850 3300025907 Bacteria 566
104 Ga0207684_10070884 3300025910 Bacteria 2962
105 Ga0207671_10514757 3300025914 Bacteria 954
106 Ga0207693_10078748 3300025915 Bacteria 2579
107 Ga0207652_10660223 3300025921 Bacteria 935
108 Ga0207694_10177003 3300025924 Bacteria 1729
109 Ga0207687_10318842 3300025927 Bacteria 1257
110 Ga0207664_10188145 3300025929 Bacteria 1776
111 Ga0207664_10360800 3300025929 Bacteria 1287
112 Ga0207664_10439864 3300025929 Bacteria 1163
113 Ga0207709_10319078 3300025935 Bacteria 1162
114 Ga0207665_10114147 3300025939 Bacteria 1901
115 Ga0207711_10473435 3300025941 Bacteria 1167
116 Ga0207667_11236445 3300025949 Bacteria 725
117 Ga0207668_12068682 3300025972 Bacteria 513
118 Ga0207703_10790403 3300026035 Bacteria 906
119 Ga0207648_10332634 3300026089 Bacteria 1367
120 Ga0207698_10671769 3300026142 Bacteria 1028
121 Ga0209588_1004306 3300027671 Bacteria 4006
122 Ga0209813_10079639 3300027866 Bacteria 1081
123 Ga0209813_10188721 3300027866 Bacteria 758
124 Ga0268266_10009478 3300028379 Bacteria 8567
125 Ga0268266_10334882 3300028379 Bacteria 1419
126 Ga0268264_10253706 3300028381 Bacteria 1635
127 Ga0265334_10138120 3300028573 Bacteria 864
128 Ga0265328_10038066 3300031239 Bacteria 1775
129 Ga0265331_10182913 3300031250 Bacteria 946
130 Ga0265316_10115259 3300031344 Bacteria 2032
131 Ga0316053_119673 3300032120 Bacteria 523
132 Ga0316593_10167638 3300032168 Bacteria 804
133 Ga0373954_0247141 3300035118 Bacteria 878
134 Ga0373924_0391404 3300035410 Bacteria 621
135 Ga0373933_0996063 3300035724 Bacteria 552
136 Ga0373937_0352163 3300036401 Bacteria 1395
137 Ga0373937_0769623 3300036401 Bacteria 910
138 Ga0395900_0954947 3300037418 Bacteria 779
139 Ga0436364_1079826 3300037853 Bacteria 821
140 Ga0436364_1397655 3300037853 Bacteria 20949
141 Ga0436365_0287657 3300039437 Bacteria 1059
142 Ga0436365_0538469 3300039437 Bacteria 601
143 Ga0436365_0711852 3300039437 Bacteria 546
144 Ga0436365_1009699 3300039437 Bacteria 761
145 Ga0436365_1097277 3300039437 Bacteria 523
146 Ga0436365_1452392 3300039437 Bacteria 1201
147 Ga0436360_0489373 3300039438 Bacteria 743
148 Ga0436360_1054160 3300039438 Bacteria 710
149 Ga0436361_1115467 3300039447 Bacteria 2521
150 Ga0436362_0356948 3300039453 Bacteria 608
151 Ga0436362_0868038 3300039453 Bacteria 821
152 Ga0436362_0993883 3300039453 Bacteria 571
153 Ga0439435_0142711 3300042436 Bacteria 764
154 Ga0495631_0055519 3300046518 Bacteria 1726
155 Ga0495632_0534304 3300046519 Bacteria 504
156 Ga0495640_0049685 3300046533 Bacteria 2891
157 Ga0495587_0123406 3300046536 Bacteria 1483
158 Ga0495667_0229720 3300046559 Bacteria 1183
159 Ga0495667_0505679 3300046559 Bacteria 757
160 Ga0495667_0787963 3300046559 Bacteria 586
161 Ga0495635_0123943 3300046663 Bacteria 1762
162 Ga0495600_0296343 3300046809 Bacteria 1021
163 Ga0495604_0330090 3300047317 Bacteria 1018
164 Ga0495604_0734225 3300047317 Bacteria 625
165 Ga0495604_1019964 3300047317 Bacteria 511
166 Ga0495674_0495144 3300047319 Bacteria 978
167 Ga0495684_0081409 3300047471 Bacteria 2457
168 Ga0495684_0538835 3300047471 Bacteria 796
169 Ga0495602_0350822 3300048088 Bacteria 1065
170 Ga0495602_0614942 3300048088 Bacteria 746
171 Ga0496118_0036826 3300048921 Bacteria 3949
172 Ga0496120_0452258 3300048923 Bacteria 559
173 Ga0496125_0249242 3300048928 Bacteria 1122
174 Ga0496125_0410042 3300048928 Bacteria 789
175 Ga0496126_0101738 3300048929 Bacteria 2513
176 Ga0501032_0661808 3300049569 Bacteria 663
177 Ga0501033_0161089 3300049570 Bacteria 1615
178 Ga0501034_0040361 3300049571 Bacteria 4724
179 Ga0501034_0211632 3300049571 Bacteria 1894
180 Ga0501034_0459086 3300049571 Bacteria 1191
181 Ga0501034_0536755 3300049571 Bacteria 1080
182 Ga0501036_0210288 3300049572 Bacteria 1635
183 Ga0501036_0227145 3300049572 Bacteria 1567
184 Ga0501036_0876383 3300049572 Bacteria 737
185 Ga0501037_0294542 3300049573 Bacteria 1128
186 Ga0501038_0047118 3300049574 Bacteria 3735
187 Ga0501038_0891601 3300049574 Bacteria 657
188 Ga0501038_1074724 3300049574 Bacteria 588
189 Ga0501039_0156239 3300049575 Bacteria 1792
190 Ga0501041_0658623 3300049577 Bacteria 669
191 Ga0501042_1309155 3300049578 Bacteria 528
192 Ga0501043_0203768 3300049579 Bacteria 1534
193 Ga0501043_0407657 3300049579 Bacteria 1026
194 Ga0501046_0699988 3300049580 Bacteria 714
195 Ga0501046_1252705 3300049580 Bacteria 508
196 Ga0501047_1183172 3300049581 Bacteria 578
197 Ga0501067_0814078 3300049583 Bacteria 526
198 Ga0501070_0044350 3300049586 Bacteria 3701
199 Ga0501071_0140871 3300049587 Bacteria 1796
200 Ga0501072_0876583 3300049588 Bacteria 701
201 Ga0501072_1085523 3300049588 Bacteria 623
202 Ga0501073_0016086 3300049589 Bacteria 5423
203 Ga0501073_0019769 3300049589 Bacteria 4860
204 Ga0501073_0112883 3300049589 Bacteria 1885
205 Ga0501073_0118201 3300049589 Bacteria 1837
206 Ga0501073_0200696 3300049589 Bacteria 1379
207 Ga0501073_0424000 3300049589 Bacteria 919
208 Ga0501074_0287910 3300049590 Bacteria 1168
209 Ga0501075_0127821 3300049591 Bacteria 1935
210 Ga0501075_0296504 3300049591 Bacteria 1232
211 Ga0501075_0716809 3300049591 Bacteria 762
212 Ga0501076_0987988 3300049592 Bacteria 693
213 Ga0501077_0476964 3300049593 Bacteria 799
214 Ga0501079_0071254 3300049741 Bacteria 2685
215 Ga0501079_0654425 3300049741 Bacteria 827
216 Ga0501080_0010559 3300049742 Bacteria 8457
217 Ga0501080_0086692 3300049742 Bacteria 2910
218 Ga0501080_0166246 3300049742 Bacteria 2035
219 Ga0501080_0307996 3300049742 Bacteria 1436
220 Ga0501080_1105267 3300049742 Bacteria 684
221 Ga0501083_0004218 3300049744 Bacteria 10122
222 Ga0501083_0094340 3300049744 Bacteria 1975
223 Ga0501083_0357318 3300049744 Bacteria 950
224 Ga0501035_0642887 3300049822 Bacteria 861
225 Ga0501035_0851362 3300049822 Bacteria 725
226 Ga0501044_0010995 3300049823 Bacteria 9826
227 Ga0501044_0153786 3300049823 Bacteria 2281
228 Ga0501044_0270140 3300049823 Bacteria 1636
229 Ga0501044_0594962 3300049823 Bacteria 1000
230 nmdc:mga03683_245836_c1 3300050489 Bacteria 830
231 nmdc:mga03n38_545708_c1 3300050490 Bacteria 655
232 nmdc:mga03n38_947477_c1 3300050490 Bacteria 508
233 nmdc:mga0yw44_115150_c1 3300050492 Bacteria 1726
234 nmdc:mga0yw44_480454_c1 3300050492 Bacteria 843
235 nmdc:mga0k408_231956_c1 3300050493 Bacteria 1102
236 nmdc:mga0k408_516725_c1 3300050493 Bacteria 707
237 nmdc:mga07m45_268979_c1 3300050496 Bacteria 992
238 nmdc:mga09592_299541_c1 3300050508 Bacteria 1394
239 nmdc:mga09592_429757_c1 3300050508 Bacteria 1140
240 nmdc:mga0qj67_66446_c1 3300050509 Bacteria 2872
241 nmdc:mga06r32_112029_c1 3300050510 Bacteria 2685
242 nmdc:mga06r32_485586_c1 3300050510 Bacteria 1213
243 nmdc:mga08x19_679526_c1 3300050514 Bacteria 730
244 nmdc:mga0sz30_318048_c1 3300050516 Bacteria 695
245 Ga0500643_183364 3300053087 Bacteria 561
246 Ga0500644_0471286 3300053088 Bacteria 551
247 Ga0500646_0196880 3300053090 Bacteria 689
248 Ga0500647_0053948 3300053091 Bacteria 1934
249 Ga0500641_0347252 3300053096 Bacteria 597
250 Ga0500595_137722 3300053119 Bacteria 685
251 Ga0500642_0131718 3300053130 Bacteria 1172
252 Ga0500568_0088857 3300053139 Bacteria 1167
253 Ga0500616_0040351 3300053153 Bacteria 2511
254 Ga0500616_0045538 3300053153 Bacteria 2336
255 Ga0500616_0181759 3300053153 Bacteria 946
256 Ga0500616_0447412 3300053153 Bacteria 509
257 Ga0501084_0803015 3300054114 Bacteria 792
258 Ga0501084_0973203 3300054114 Bacteria 713
259 Ga0587066_146191 3300059490 Bacteria 582
260 Ga0587073_0171029 3300059492 Bacteria 631
261 Ga0587073_0298506 3300059492 Bacteria 523
262 Ga0587086_061093 3300059507 Bacteria 629
263 Ga0587101_073664 3300059623 Bacteria 634
264 Ga0587111_0208083 3300060346 Bacteria 558
265 Ga0501082_0134767 3300060353 Bacteria 2143
266 Ga0501082_0223397 3300060353 Bacteria 1639
267 2599105391 2597490356 Bacteria 7030811
268 2837679402 2837678835 Bacteria 5252418
269 2837682880 2837678835 Bacteria 5252418
270 2846954927 2846952575 Bacteria 6587527
271 2848860551 2848858292 Bacteria 7391279
272 Ga0501084_1867681
273 Ga0006778J45830_1076892
274 JGI25153J46596_10003979
275 Ga0058861_11793751
276 Ga0058862_12576960
277 Ga0070680_100349739
278 Ga0070680_101173586
279 Ga0070682_100097574
280 Ga0070689_100226958
281 Ga0070669_101991545
282 Ga0070674_100820276
283 Ga0070714_100280483
284 Ga0070714_100410658
285 Ga0070711_101371711
286 Ga0070681_11083987
287 Ga0070681_11802532
288 Ga0070706_100040715
289 Ga0070679_100124507
290 Ga0070679_100747162
291 Ga0068853_100696430
292 Ga0070665_100393321
293 Ga0068855_100211740
294 Ga0068852_100317154
295 Ga0068870_10920901
296 Ga0068858_100873501
297 Ga0068860_100263713
298 Ga0068862_101284789
299 Ga0081455_10228560
300 Ga0081455_10233113
301 Ga0081455_10463829
302 Ga0081538_10013498
303 Ga0081538_10023314
304 Ga0070717_10220743
305 Ga0070717_10224553
306 Ga0075365_10133847
307 Ga0075365_10419610
308 Ga0075368_10122253
309 Ga0075368_10149681
310 Ga0075363_100106771
311 Ga0075363_100207888
312 Ga0075364_10184239
313 Ga0075364_10238255
314 Ga0075364_10637484
315 Ga0070715_10053415
316 Ga0070716_100178340
317 Ga0070712_100182899
318 Ga0075362_10174759
319 Ga0075367_10237030
320 Ga0075367_10250649
321 Ga0075367_10824949
322 Ga0075369_10475926
323 Ga0075366_10068115
324 Ga0097621_100290664
325 Ga0068871_100678277
326 Ga0068871_101141515
327 Ga0075430_101134948
328 Ga0075433_11466387
329 Ga0075429_100592173
330 Ga0075429_101243384
331 Ga0075436_100908387
332 Ga0099794_10069794
333 Ga0099795_10009364
334 Ga0105240_10494392
335 Ga0105240_10567952
336 Ga0111539_12573333
337 Ga0105245_10762167
338 Ga0105247_10386211
339 Ga0114129_10165394
340 Ga0114129_11381900
341 Ga0105243_10228057
342 Ga0105248_10228239
343 Ga0105248_11010430
344 Ga0105248_11580184
345 Ga0105238_12267726
346 Ga0105249_10806788
347 Ga0105249_12259351
348 Ga0105249_12939322
349 Ga0105239_10409855
350 Ga0105246_11210142
351 Ga0157374_10198558
352 Ga0157378_10498778
353 Ga0157372_10992743
354 Ga0157380_10449865
355 Ga0157379_10493884
356 Ga0157376_10384059
357 Ga0197907_10638728
358 Ga0206356_10916460
359 Ga0206356_11445123
360 Ga0206349_1076069
361 Ga0206350_10368273
362 Ga0206353_10145036
363 Ga0154015_1422482
364 Ga0154015_1633464
365 Ga0213876_10127081
366 Ga0213875_10000007
367 Ga0213871_10012959
368 Ga0224712_10015137
369 Ga0224712_10468069
370 Ga0209758_1000060
371 Ga0209758_1000158
372 Ga0207710_10308824
373 Ga0207685_10019789
374 Ga0207645_11000850
375 Ga0207684_10070884
376 Ga0207671_10514757
377 Ga0207693_10078748
378 Ga0207652_10660223
379 Ga0207694_10177003
380 Ga0207687_10318842
381 Ga0207664_10188145
382 Ga0207664_10360800
383 Ga0207664_10439864
384 Ga0207709_10319078
385 Ga0207665_10114147
386 Ga0207711_10473435
387 Ga0207667_11236445
388 Ga0207668_12068682
389 Ga0207703_10790403
390 Ga0207648_10332634
391 Ga0207698_10671769
392 Ga0209588_1004306
393 Ga0209813_10079639
394 Ga0209813_10188721
395 Ga0268266_10009478
396 Ga0268266_10334882
397 Ga0268264_10253706
398 Ga0265334_10138120
399 Ga0265328_10038066
400 Ga0265331_10182913
401 Ga0265316_10115259
402 Ga0316053_119673
403 Ga0316593_10167638
404 Ga0373954_0247141
405 Ga0373924_0391404
406 Ga0373933_0996063
407 Ga0373937_0352163
408 Ga0373937_0769623
409 Ga0395900_0954947
410 Ga0436364_1079826
411 Ga0436364_1397655
412 Ga0436365_0287657
413 Ga0436365_0538469
414 Ga0436365_0711852
415 Ga0436365_1009699
416 Ga0436365_1097277
417 Ga0436365_1452392
418 Ga0436360_0489373
419 Ga0436360_1054160
420 Ga0436361_1115467
421 Ga0436362_0356948
422 Ga0436362_0868038
423 Ga0436362_0993883
424 Ga0439435_0142711
425 Ga0495631_0055519
426 Ga0495632_0534304
427 Ga0495640_0049685
428 Ga0495587_0123406
429 Ga0495667_0229720
430 Ga0495667_0505679
431 Ga0495667_0787963
432 Ga0495635_0123943
433 Ga0495600_0296343
434 Ga0495604_0330090
435 Ga0495604_0734225
436 Ga0495604_1019964
437 Ga0495674_0495144
438 Ga0495684_0081409
439 Ga0495684_0538835
440 Ga0495602_0350822
441 Ga0495602_0614942
442 Ga0496118_0036826
443 Ga0496120_0452258
444 Ga0496125_0249242
445 Ga0496125_0410042
446 Ga0496126_0101738
447 Ga0501032_0661808
448 Ga0501033_0161089
449 Ga0501034_0040361
450 Ga0501034_0211632
451 Ga0501034_0459086
452 Ga0501034_0536755
453 Ga0501036_0210288
454 Ga0501036_0227145
455 Ga0501036_0876383
456 Ga0501037_0294542
457 Ga0501038_0047118
458 Ga0501038_0891601
459 Ga0501038_1074724
460 Ga0501039_0156239
461 Ga0501041_0658623
462 Ga0501042_1309155
463 Ga0501043_0203768
464 Ga0501043_0407657
465 Ga0501046_0699988
466 Ga0501046_1252705
467 Ga0501047_1183172
468 Ga0501067_0814078
469 Ga0501070_0044350
470 Ga0501071_0140871
471 Ga0501072_0876583
472 Ga0501072_1085523
473 Ga0501073_0016086
474 Ga0501073_0019769
475 Ga0501073_0112883
476 Ga0501073_0118201
477 Ga0501073_0200696
478 Ga0501073_0424000
479 Ga0501074_0287910
480 Ga0501075_0127821
481 Ga0501075_0296504
482 Ga0501075_0716809
483 Ga0501076_0987988
484 Ga0501077_0476964
485 Ga0501079_0071254
486 Ga0501079_0654425
487 Ga0501080_0010559
488 Ga0501080_0086692
489 Ga0501080_0166246
490 Ga0501080_0307996
491 Ga0501080_1105267
492 Ga0501083_0004218
493 Ga0501083_0094340
494 Ga0501083_0357318
495 Ga0501035_0642887
496 Ga0501035_0851362
497 Ga0501044_0010995
498 Ga0501044_0153786
499 Ga0501044_0270140
500 Ga0501044_0594962
501 nmdc:mga03683_245836_c1
502 nmdc:mga03n38_545708_c1
503 nmdc:mga03n38_947477_c1
504 nmdc:mga0yw44_115150_c1
505 nmdc:mga0yw44_480454_c1
506 nmdc:mga0k408_231956_c1
507 nmdc:mga0k408_516725_c1
508 nmdc:mga07m45_268979_c1
509 nmdc:mga09592_299541_c1
510 nmdc:mga09592_429757_c1
511 nmdc:mga0qj67_66446_c1
512 nmdc:mga06r32_112029_c1
513 nmdc:mga06r32_485586_c1
514 nmdc:mga08x19_679526_c1
515 nmdc:mga0sz30_318048_c1
516 Ga0500643_183364
517 Ga0500644_0471286
518 Ga0500646_0196880
519 Ga0500647_0053948
520 Ga0500641_0347252
521 Ga0500595_137722
522 Ga0500642_0131718
523 Ga0500568_0088857
524 Ga0500616_0040351
525 Ga0500616_0045538
526 Ga0500616_0181759
527 Ga0500616_0447412
528 Ga0501084_0803015
529 Ga0501084_0973203
530 Ga0587066_146191
531 Ga0587073_0171029
532 Ga0587073_0298506
533 Ga0587086_061093
534 Ga0587101_073664
535 Ga0587111_0208083
536 Ga0501082_0134767
537 Ga0501082_0223397
538 2599105391
539 2837679402
540 2837682880
541 2846954927
542 2848860551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

40

104

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9716 5 104
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9587 6 112
2wci-assembly1.cif.gz_A structure of e. coli monothiol glutaredoxin grx4 homodimer 0.9547 3 104
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9458 5 109
4tr1-assembly2.cif.gz_B crystal structure of gsh-bound cgrx2/c15s 0.9361 16 102
ID Description Score Start End Superfamily
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9918 8 99 3.40.30.10
af_O97232_76_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9888 9 99 3.40.30.10
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9852 10 95 3.40.30.10
af_A0A1D6H817_56_131_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9816 33 107 3.40.30.10
af_B6TEC7_84_191_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9787 9 103 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A529M835-F1-model_v4 Grx4 family monothiol glutaredoxin 1.003 5 91 GO:0015036
GO:0046872
GO:0051537
AF-A0A3S6R0B6-F1-model_v4 Glutaredoxin 1 5 101 GO:0015036
GO:0046872
GO:0051537
AF-H3G770-F1-model_v4 Glutaredoxin 1 5 102 GO:0005759
GO:0015036
GO:0046872
GO:0051537
AF-A0A8A9QGL4-F1-model_v4 deleted 0.9996 5 102
AF-A0A2A5DR34-F1-model_v4 Glutaredoxin 0.9993 3 110 GO:0015036
GO:0046872
GO:0051537

Map