F377983

General Info

Members Datasets Scaffolds Average Seq Length
271 199 254 318

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_14486_c1|nmdc:mga09592_14486_c1_804_1928
Length 358
Sequence MKVCIYGAGAIGGYRAAGLAQVEAAGSGDVAYRAQPHHPAGTRIVVLDRGTFGPAVELRRPSFAHDWAEHDRTAPADVIRRLDGAHIAITNKVPIRRAQLEELPALRMVAVAATGYDVIDIDACRERGIVVSNVKGYAVNTVPEHTFALILALRRGIAVYRQAVIDGAWQQASQFCFHAYPIRDLNGSTLGIVGEGAIGQAVARLGQAFGMRTLYAAHKGVSGLGPLYTPFDEVLETSDVITLHSPLLPTTRDMIRMAEFRKMKRRPLLINTARGGLVVEKDLVQALDEGLISGAGFDCLTAEPPPPNHPLLAILGRPNVIVTPHVGWASQEAMQECWSQVIGHIECFHNGQPYDIAT

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
4 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
5 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
6 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
7 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
8 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
9 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
10 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
11 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
12 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
13 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
14 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
15 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
16 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
17 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.73
Metatranscriptomes 0
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.76
Nodule 1.85
Rhizoplane 15.13
Rhizosphere 63.1
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007655 3300003203 Bacteria 4915
2 JGI25404J52841_10000096 3300003659 Bacteria 8524
3 Ga0065165_1001551 3300005262 Bacteria 23972
4 Ga0068869_100008388 3300005334 Bacteria 6660
5 Ga0070680_100021580 3300005336 Bacteria 5120
6 Ga0070682_100026814 3300005337 Bacteria 3452
7 Ga0070692_10030456 3300005345 Bacteria 2698
8 Ga0070668_100114496 3300005347 Bacteria 2149
9 Ga0070659_100079358 3300005366 Bacteria 2620
10 Ga0070703_10006182 3300005406 Bacteria 3351
11 Ga0070701_10005932 3300005438 Bacteria 5099
12 Ga0070705_100000831 3300005440 Bacteria 17347
13 Ga0070708_100001583 3300005445 Bacteria 17435
14 Ga0070662_100020841 3300005457 Bacteria 4470
15 Ga0070681_10018167 3300005458 Bacteria 7030
16 Ga0070681_10022479 3300005458 Bacteria 6332
17 Ga0070706_100042068 3300005467 Bacteria 4220
18 Ga0070707_100110492 3300005468 Bacteria 2666
19 Ga0070679_100039141 3300005530 Bacteria 4713
20 Ga0068853_100014353 3300005539 Bacteria 6485
21 Ga0070695_100049622 3300005545 Bacteria 2687
22 Ga0070696_100000623 3300005546 Bacteria 22585
23 Ga0070693_100021464 3300005547 Bacteria 3422
24 Ga0070693_100160061 3300005547 Bacteria 1433
25 Ga0070665_100086013 3300005548 Bacteria 3150
26 Ga0070704_100000700 3300005549 Bacteria 16321
27 Ga0068857_100097013 3300005577 Bacteria 2642
28 Ga0070702_100028943 3300005615 Bacteria 3007
29 Ga0068859_100008106 3300005617 Bacteria 10654
30 Ga0068864_100005752 3300005618 Bacteria 10173
31 Ga0068860_100003751 3300005843 Bacteria 15627
32 Ga0068862_100023394 3300005844 Bacteria 5177
33 Ga0081455_10106348 3300005937 Bacteria 2239
34 Ga0081540_1000055 3300005983 Bacteria 122642
35 Ga0081539_10002333 3300005985 Bacteria 27314
36 Ga0075368_10018334 3300006042 Bacteria 2629
37 Ga0075368_10030309 3300006042 Bacteria 2094
38 Ga0075368_10035941 3300006042 Bacteria 1934
39 Ga0075363_100011806 3300006048 Bacteria 4193
40 Ga0075363_100132374 3300006048 Bacteria 1399
41 Ga0075364_10000635 3300006051 Bacteria 18139
42 Ga0075364_10007609 3300006051 Bacteria 6441
43 Ga0075364_10036576 3300006051 Bacteria 3174
44 Ga0075364_10165689 3300006051 Bacteria 1493
45 Ga0075362_10002726 3300006177 Bacteria 6017
46 Ga0075367_10025812 3300006178 Bacteria 3325
47 Ga0075367_10085483 3300006178 Bacteria 1914
48 Ga0075367_10139760 3300006178 Bacteria 1500
49 Ga0075367_10176017 3300006178 Bacteria 1333
50 Ga0075369_10037344 3300006186 Bacteria 2069
51 Ga0075366_10017055 3300006195 Bacteria 4175
52 Ga0075370_10032622 3300006353 Bacteria 2912
53 Ga0075370_10104447 3300006353 Bacteria 1642
54 Ga0075428_100024550 3300006844 Bacteria 6670
55 Ga0075428_100071182 3300006844 Bacteria 3801
56 Ga0075431_100001157 3300006847 Bacteria 23736
57 Ga0075431_100001262 3300006847 Bacteria 23036
58 Ga0075431_100039841 3300006847 Bacteria 4840
59 Ga0075429_100023426 3300006880 Bacteria 5358
60 Ga0097620_100008106 3300006931 Bacteria 10654
61 Ga0079104_1000033 3300006946 Bacteria 202636
62 Ga0105240_10089697 3300009093 Bacteria 3760
63 Ga0105241_10019569 3300009174 Bacteria 4993
64 Ga0105249_10001321 3300009553 Bacteria 21710
65 Ga0105239_10149010 3300010375 Bacteria 2611
66 Ga0157373_10016004 3300013100 Bacteria 5476
67 Ga0157370_10018911 3300013104 Bacteria 6927
68 Ga0157372_10009740 3300013307 Bacteria 10220
69 Ga0157380_10055078 3300014326 Bacteria 3157
70 Ga0207653_10008166 3300025885 Bacteria 3262
71 Ga0207707_10058986 3300025912 Bacteria 3339
72 Ga0207707_10115775 3300025912 Bacteria 2342
73 Ga0207646_10207320 3300025922 Bacteria 1770
74 Ga0207690_10091773 3300025932 Bacteria 2147
75 Ga0207689_10012619 3300025942 Bacteria 7218
76 Ga0207712_10001597 3300025961 Bacteria 15257
77 Ga0207703_10193975 3300026035 Bacteria 1801
78 Ga0207639_10016618 3300026041 Bacteria 5210
79 Ga0207678_10005882 3300026067 Bacteria 10934
80 Ga0207708_10001517 3300026075 Bacteria 17300
81 Ga0207708_10212913 3300026075 Bacteria 1545
82 Ga0207676_10013736 3300026095 Bacteria 5814
83 Ga0207674_10021511 3300026116 Bacteria 6944
84 Ga0207674_10023928 3300026116 Bacteria 6533
85 Ga0209281_1000043 3300027111 Bacteria 341543
86 Ga0209813_10000843 3300027866 Bacteria 6921
87 Ga0209813_10004341 3300027866 Bacteria 3383
88 Ga0268266_10063203 3300028379 Bacteria 3196
89 Ga0268265_10004176 3300028380 Bacteria 10114
90 Ga0268264_10309124 3300028381 Bacteria 1491
91 Ga0265332_10000004 3300031238 Bacteria 426592
92 Ga0265331_10016492 3300031250 Bacteria 3876
93 Ga0307509_10000054 3300031507 Bacteria 163301
94 Ga0316576_10087287 3300031727 Bacteria 2321
95 Ga0316584_0093065 3300036712 Bacteria 2257
96 Ga0395899_0017131 3300037312 Bacteria 5521
97 Ga0395900_0061653 3300037418 Bacteria 3855
98 Ga0395898_0022408 3300037466 Bacteria 6397
99 Ga0395901_0074500 3300038443 Bacteria 3541
100 Ga0400483_248775 3300039062 Bacteria 2798
101 Ga0436361_0618672 3300039447 Bacteria 2214
102 Ga0436361_0698917 3300039447 Bacteria 8507
103 Ga0436361_0830563 3300039447 Bacteria 9430
104 Ga0451577_0032449 3300042876 Bacteria 4705
105 Ga0451577_0199757 3300042876 Bacteria 1805
106 Ga0466969_0004530 3300044656 Bacteria 7397
107 Ga0466966_0006830 3300044684 Bacteria 7560
108 Ga0466961_0000995 3300044693 Bacteria 17488
109 Ga0453684_0010292 3300044712 Bacteria 16016
110 Ga0466970_0080911 3300044765 Bacteria 1756
111 Ga0466959_0004491 3300045049 Bacteria 9346
112 Ga0466959_0197587 3300045049 Bacteria 1401
113 Ga0451576_0044974 3300045051 Bacteria 4652
114 Ga0495629_0000918 3300046459 Bacteria 23666
115 Ga0495650_0002956 3300046471 Bacteria 12863
116 Ga0495580_0014541 3300046472 Bacteria 5966
117 Ga0495582_0013934 3300046473 Bacteria 4428
118 Ga0495639_0029296 3300046475 Bacteria 2443
119 Ga0495583_0031902 3300046506 Bacteria 2548
120 Ga0495608_0042844 3300046511 Bacteria 3026
121 Ga0495642_0001086 3300046528 Bacteria 12547
122 Ga0495654_0002083 3300046530 Bacteria 13111
123 Ga0495654_0014950 3300046530 Bacteria 4123
124 Ga0495654_0041135 3300046530 Bacteria 2300
125 Ga0495645_0000632 3300046543 Bacteria 24216
126 Ga0495667_0020199 3300046559 Bacteria 4494
127 Ga0495668_0018898 3300046616 Bacteria 3980
128 Ga0495668_0022825 3300046616 Bacteria 3574
129 Ga0495646_0015267 3300046680 Bacteria 4876
130 Ga0495669_0019779 3300046684 Bacteria 2908
131 Ga0495613_0006448 3300046689 Bacteria 8773
132 Ga0495589_0004700 3300046794 Bacteria 7248
133 Ga0495589_0018966 3300046794 Bacteria 3528
134 Ga0495600_0121519 3300046809 Bacteria 1698
135 Ga0495672_0042690 3300047320 Unclassified 2733
136 Ga0495672_0145393 3300047320 Bacteria 1234
137 Ga0495680_0104700 3300047322 Bacteria 2104
138 Ga0495680_0173584 3300047322 Unclassified 1560
139 Ga0495675_0089249 3300047444 Bacteria 1935
140 Ga0495685_066520 3300047447 Bacteria 1211
141 Ga0495681_0101499 3300047470 Bacteria 1257
142 Ga0495593_0038985 3300047673 Bacteria 2564
143 Ga0495602_0265165 3300048088 Bacteria 1272
144 Ga0495626_0089811 3300048091 Bacteria 1353
145 Ga0496100_0007577 3300048903 Bacteria 6000
146 Ga0496100_0036834 3300048903 Bacteria 3089
147 Ga0496101_0022739 3300048904 Bacteria 4320
148 Ga0496101_0050608 3300048904 Bacteria 2992
149 Ga0496102_0006979 3300048905 Bacteria 9635
150 Ga0496102_0013984 3300048905 Bacteria 6968
151 Ga0496102_0043327 3300048905 Bacteria 4080
152 Ga0496103_0019651 3300048906 Bacteria 4055
153 Ga0496103_0122542 3300048906 Unclassified 1657
154 Ga0496104_0003028 3300048907 Bacteria 14481
155 Ga0496104_0020737 3300048907 Bacteria 6027
156 Ga0496104_0033033 3300048907 Unclassified 4817
157 Ga0496105_0000291 3300048908 Bacteria 33071
158 Ga0496105_0023927 3300048908 Bacteria 4960
159 Ga0496105_0024547 3300048908 Bacteria 4899
160 Ga0496105_0107459 3300048908 Bacteria 2303
161 Ga0496105_0121013 3300048908 Bacteria 2158
162 Ga0496106_0024671 3300048909 Bacteria 4471
163 Ga0496106_0044342 3300048909 Unclassified 3338
164 Ga0496106_0044976 3300048909 Bacteria 3315
165 Ga0496107_0005101 3300048910 Bacteria 8954
166 Ga0496107_0011361 3300048910 Bacteria 6199
167 Ga0496108_0020045 3300048911 Bacteria 5495
168 Ga0496108_0026016 3300048911 Bacteria 4826
169 Ga0496109_0031610 3300048912 Bacteria 4753
170 Ga0496109_0039585 3300048912 Bacteria 4267
171 Ga0496109_0198748 3300048912 Bacteria 1885
172 Ga0496109_0514962 3300048912 Bacteria 1129
173 Ga0496110_0006997 3300048913 Bacteria 8973
174 Ga0496110_0015678 3300048913 Bacteria 6314
175 Ga0496110_0027429 3300048913 Bacteria 4883
176 Ga0496111_0010756 3300048914 Bacteria 6152
177 Ga0496111_0029320 3300048914 Bacteria 3908
178 Ga0496111_0135254 3300048914 Unclassified 1825
179 Ga0496113_0014488 3300048916 Bacteria 5381
180 Ga0496113_0286894 3300048916 Unclassified 1316
181 Ga0496114_0006683 3300048917 Bacteria 9089
182 Ga0496115_0049548 3300048918 Unclassified 3363
183 Ga0496115_0080368 3300048918 Bacteria 2654
184 Ga0496115_0095729 3300048918 Bacteria 2430
185 Ga0496119_0001626 3300048922 Bacteria 26533
186 Ga0496121_0015752 3300048924 Bacteria 7877
187 Ga0496122_0000018 3300048925 Bacteria 426350
188 Ga0496123_0000015 3300048926 Bacteria 426088
189 Ga0496124_0014926 3300048927 Bacteria 7479
190 Ga0496126_0004422 3300048929 Bacteria 16821
191 Ga0501031_0100928 3300049568 Bacteria 1883
192 Ga0501032_0069340 3300049569 Bacteria 2353
193 Ga0501033_0015129 3300049570 Bacteria 5855
194 Ga0501033_0056723 3300049570 Bacteria 2895
195 Ga0501036_0017052 3300049572 Bacteria 6070
196 Ga0501037_0021520 3300049573 Bacteria 4767
197 Ga0501038_0016427 3300049574 Bacteria 6708
198 Ga0501038_0029883 3300049574 Bacteria 4827
199 Ga0501039_0018617 3300049575 Bacteria 5331
200 Ga0501039_0035490 3300049575 Bacteria 3848
201 Ga0501040_0101189 3300049576 Bacteria 2010
202 Ga0501041_0032844 3300049577 Bacteria 3137
203 Ga0501042_0019499 3300049578 Bacteria 4711
204 Ga0501043_0053375 3300049579 Bacteria 3174
205 Ga0501043_0238698 3300049579 Bacteria 1402
206 Ga0501046_0013990 3300049580 Bacteria 6777
207 Ga0501046_0158958 3300049580 Bacteria 1701
208 Ga0501047_0013711 3300049581 Bacteria 7695
209 Ga0501048_0097995 3300049582 Bacteria 2069
210 Ga0501067_0017834 3300049583 Bacteria 3930
211 Ga0501069_0010864 3300049585 Bacteria 4824
212 Ga0501069_0023711 3300049585 Bacteria 3345
213 Ga0501070_0046511 3300049586 Bacteria 3608
214 Ga0501070_0058735 3300049586 Bacteria 3188
215 Ga0501071_0130911 3300049587 Bacteria 1863
216 Ga0501072_0007510 3300049588 Bacteria 8274
217 Ga0501073_0018570 3300049589 Bacteria 5027
218 Ga0501073_0316250 3300049589 Bacteria 1077
219 Ga0501074_0172278 3300049590 Bacteria 1545
220 Ga0501075_0076164 3300049591 Bacteria 2537
221 Ga0501076_0395395 3300049592 Bacteria 1136
222 Ga0501079_0074545 3300049741 Bacteria 2623
223 Ga0501080_0124244 3300049742 Bacteria 2390
224 Ga0501080_0194327 3300049742 Bacteria 1864
225 Ga0501081_0049884 3300049743 Bacteria 2883
226 Ga0501083_0262235 3300049744 Bacteria 1124
227 Ga0501035_0001092 3300049822 Bacteria 28444
228 Ga0501035_0038260 3300049822 Bacteria 4344
229 Ga0501045_0053231 3300049824 Bacteria 2958
230 nmdc:mga03683_13467_c1 3300050489 Bacteria 3011
231 nmdc:mga03n38_24934_c1 3300050490 Bacteria 2450
232 nmdc:mga03n38_9248_c1 3300050490 Bacteria 3574
233 nmdc:mga00v17_145054_c1 3300050491 Bacteria 1523
234 nmdc:mga00v17_6194_c1 3300050491 Bacteria 6342
235 nmdc:mga00v17_9206_c1 3300050491 Bacteria 5334
236 nmdc:mga0k408_4240_c1 3300050493 Bacteria 7607
237 nmdc:mga06z11_1623_c1 3300050494 Bacteria 8412
238 nmdc:mga06z11_65820_c1 3300050494 Bacteria 1903
239 nmdc:mga04h51_10781_c1 3300050495 Bacteria 2520
240 nmdc:mga04h51_720_c1 3300050495 Bacteria 7682
241 nmdc:mga07m45_146061_c1 3300050496 Bacteria 1371
242 nmdc:mga09592_14486_c1 3300050508 Bacteria 6436
243 nmdc:mga06r32_18517_c1 3300050510 Bacteria 6378
244 nmdc:mga06r32_3701_c1 3300050510 Bacteria 13660
245 nmdc:mga0sz30_64507_c1 3300050516 Bacteria 1569
246 Ga0495619_0069715 3300053085 Bacteria 2351
247 Ga0500592_000373 3300053116 Bacteria 7501
248 Ga0500592_000731 3300053116 Bacteria 5384
249 Ga0500618_016912 3300053125 Bacteria 1819
250 Ga0500604_0015021 3300053151 Bacteria 2114
251 Ga0500627_0000053 3300053158 Bacteria 55273
252 Ga0500627_0005193 3300053158 Bacteria 4294
253 Ga0501082_0103786 3300060353 Bacteria 2459
254 Ga0530510_0060002 3300061734 Bacteria 2752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_016912 Ga0500618_016912_502_1374 290
2 3300048903 Ga0496100_0007577 Ga0496100_0007577_3150_4031 293
3 3300048904 Ga0496101_0022739 Ga0496101_0022739_3210_4091 293
4 3300048905 Ga0496102_0006979 Ga0496102_0006979_1897_2778 293
5 3300048905 Ga0496102_0013984 Ga0496102_0013984_5566_6447 293
6 3300048906 Ga0496103_0122542 Ga0496103_0122542_122_1003 293
7 3300048907 Ga0496104_0033033 Ga0496104_0033033_1760_2641 293
8 3300048908 Ga0496105_0024547 Ga0496105_0024547_3940_4821 293
9 3300048909 Ga0496106_0044342 Ga0496106_0044342_2138_3019 293
10 3300048909 Ga0496106_0044976 Ga0496106_0044976_1184_2065 293
11 3300048910 Ga0496107_0005101 Ga0496107_0005101_6396_7277 293
12 3300048911 Ga0496108_0020045 Ga0496108_0020045_1479_2360 293
13 3300048911 Ga0496108_0026016 Ga0496108_0026016_2354_3235 293
14 3300048912 Ga0496109_0031610 Ga0496109_0031610_1722_2603 293
15 3300048912 Ga0496109_0039585 Ga0496109_0039585_1154_2035 293
16 3300048913 Ga0496110_0006997 Ga0496110_0006997_1814_2695 293
17 3300048913 Ga0496110_0015678 Ga0496110_0015678_2505_3386 293
18 3300048914 Ga0496111_0010756 Ga0496111_0010756_1658_2539 293
19 3300048914 Ga0496111_0135254 Ga0496111_0135254_176_1057 293
20 3300048916 Ga0496113_0286894 Ga0496113_0286894_82_963 293
21 3300048918 Ga0496115_0049548 Ga0496115_0049548_1787_2668 293
22 3300048929 Ga0496126_0004422 Ga0496126_0004422_4606_5505 299
23 3300048088 Ga0495602_0265165 Ga0495602_0265165_16_930 302
24 3300039447 Ga0436361_0830563 Ga0436361_0830563_6052_7005 310
25 3300049589 Ga0501073_0316250 Ga0501073_0316250_99_1031 310
26 iso_pu_bacteria 2889415604 2889419198 310
27 iso_pu_bacteria 2911138879 2911139752 311
28 3300005334 Ga0068869_100008388 Ga0068869_1000083882 312
29 3300005345 Ga0070692_10030456 Ga0070692_100304562 312
30 3300005406 Ga0070703_10006182 Ga0070703_100061822 312
31 3300005438 Ga0070701_10005932 Ga0070701_100059326 312
32 3300005440 Ga0070705_100000831 Ga0070705_1000008315 312
33 3300005445 Ga0070708_100001583 Ga0070708_10000158312 312
34 3300005458 Ga0070681_10022479 Ga0070681_100224793 312
35 3300005467 Ga0070706_100042068 Ga0070706_1000420682 312
36 3300005468 Ga0070707_100110492 Ga0070707_1001104922 312
37 3300005530 Ga0070679_100039141 Ga0070679_1000391412 312
38 3300005545 Ga0070695_100049622 Ga0070695_1000496222 312
39 3300005546 Ga0070696_100000623 Ga0070696_10000062310 312
40 3300005547 Ga0070693_100160061 Ga0070693_1001600612 312
41 3300005549 Ga0070704_100000700 Ga0070704_1000007004 312
42 3300005577 Ga0068857_100097013 Ga0068857_1000970132 312
43 3300005615 Ga0070702_100028943 Ga0070702_1000289431 312
44 3300005617 Ga0068859_100008106 Ga0068859_1000081068 312
45 3300005618 Ga0068864_100005752 Ga0068864_1000057526 312
46 3300005843 Ga0068860_100003751 Ga0068860_10000375110 312
47 3300005844 Ga0068862_100023394 Ga0068862_1000233943 312
48 3300006931 Ga0097620_100008106 Ga0097620_1000081068 312
49 3300009553 Ga0105249_10001321 Ga0105249_100013218 312
50 3300025885 Ga0207653_10008166 Ga0207653_100081664 312
51 3300025912 Ga0207707_10058986 Ga0207707_100589863 312
52 3300025922 Ga0207646_10207320 Ga0207646_102073202 312
53 3300025942 Ga0207689_10012619 Ga0207689_100126192 312
54 3300025961 Ga0207712_10001597 Ga0207712_100015973 312
55 3300026035 Ga0207703_10193975 Ga0207703_101939751 312
56 3300026067 Ga0207678_10005882 Ga0207678_100058825 312
57 3300026075 Ga0207708_10001517 Ga0207708_100015171 312
58 3300026095 Ga0207676_10013736 Ga0207676_100137364 312
59 3300026116 Ga0207674_10023928 Ga0207674_100239282 312
60 3300028380 Ga0268265_10004176 Ga0268265_100041769 312
61 3300048904 Ga0496101_0050608 Ga0496101_0050608_1808_2806 312
62 3300048905 Ga0496102_0043327 Ga0496102_0043327_640_1638 312
63 3300048906 Ga0496103_0019651 Ga0496103_0019651_1296_2294 312
64 3300048909 Ga0496106_0024671 Ga0496106_0024671_366_1364 312
65 3300048910 Ga0496107_0011361 Ga0496107_0011361_1671_2669 312
66 iso_pu_bacteria 2547132103 2547374033 312
67 iso_pu_bacteria 2547132512 2548847042 312
68 iso_pu_bacteria 2843690924 2843694797 312
69 iso_pu_bacteria 2846033681 2846033731 312
70 iso_pu_bacteria 2846037992 2846040246 312
71 3300009093 Ga0105240_10089697 Ga0105240_100896972 313
72 3300031250 Ga0265331_10016492 Ga0265331_100164923 313
73 3300039447 Ga0436361_0618672 Ga0436361_0618672_249_1205 313
74 iso_pu_bacteria 2600254933 2600376538 313
75 iso_pu_bacteria 2821123053 2821123453 313
76 iso_pu_bacteria 2838736955 2838739524 313
77 iso_pu_bacteria 2841840854 2841844352 313
78 iso_pu_bacteria 2842140634 2842144073 313
79 iso_pu_bacteria 2854896431 2854898036 313
80 iso_pu_bacteria 2854916844 2854919732 313
81 iso_pu_bacteria 2857531043 2857533597 313
82 iso_pu_bacteria 2998344455 2998348209 314
83 3300042876 Ga0451577_0199757 Ga0451577_0199757_509_1462 315
84 3300045051 Ga0451576_0044974 Ga0451576_0044974_2176_3129 315
85 3300031238 Ga0265332_10000004 Ga0265332_10000004392 316
86 3300031507 Ga0307509_10000054 Ga0307509_1000005480 316
87 3300039447 Ga0436361_0698917 Ga0436361_0698917_4865_5818 316
88 3300042876 Ga0451577_0032449 Ga0451577_0032449_2319_3275 316
89 3300044656 Ga0466969_0004530 Ga0466969_0004530_1676_2626 316
90 3300044684 Ga0466966_0006830 Ga0466966_0006830_232_1182 316
91 3300044693 Ga0466961_0000995 Ga0466961_0000995_13777_14727 316
92 3300044712 Ga0453684_0010292 Ga0453684_0010292_11475_12431 316
93 3300045049 Ga0466959_0004491 Ga0466959_0004491_7879_8829 316
94 3300045049 Ga0466959_0197587 Ga0466959_0197587_407_1357 316
95 3300046530 Ga0495654_0014950 Ga0495654_0014950_895_1845 316
96 3300046616 Ga0495668_0018898 Ga0495668_0018898_210_1160 316
97 3300046616 Ga0495668_0022825 Ga0495668_0022825_443_1393 316
98 3300046794 Ga0495589_0018966 Ga0495589_0018966_1074_2024 316
99 3300047447 Ga0495685_066520 Ga0495685_066520_97_1047 316
100 3300048091 Ga0495626_0089811 Ga0495626_0089811_256_1206 316
101 3300053116 Ga0500592_000373 Ga0500592_000373_3833_4783 316
102 3300053116 Ga0500592_000731 Ga0500592_000731_3010_3960 316
103 3300053151 Ga0500604_0015021 Ga0500604_0015021_842_1792 316
104 3300053158 Ga0500627_0000053 Ga0500627_0000053_15071_16021 316
105 3300053158 Ga0500627_0005193 Ga0500627_0005193_3163_4113 316
106 3300005262 Ga0065165_1001551 Ga0065165_10015518 317
107 3300005548 Ga0070665_100086013 Ga0070665_1000860134 317
108 3300006051 Ga0075364_10165689 Ga0075364_101656892 317
109 3300006847 Ga0075431_100001262 Ga0075431_1000012624 317
110 3300006946 Ga0079104_1000033 Ga0079104_1000033184 317
111 3300027111 Ga0209281_1000043 Ga0209281_1000043318 317
112 3300028379 Ga0268266_10063203 Ga0268266_100632034 317
113 3300039062 Ga0400483_248775 Ga0400483_248775_598_1551 317
114 3300044765 Ga0466970_0080911 Ga0466970_0080911_347_1300 317
115 3300046530 Ga0495654_0002083 Ga0495654_0002083_8507_9460 317
116 3300047322 Ga0495680_0173584 Ga0495680_0173584_320_1273 317
117 3300048907 Ga0496104_0003028 Ga0496104_0003028_10036_10989 317
118 3300048907 Ga0496104_0020737 Ga0496104_0020737_4095_5048 317
119 3300048908 Ga0496105_0000291 Ga0496105_0000291_22083_23036 317
120 3300048908 Ga0496105_0023927 Ga0496105_0023927_995_1948 317
121 3300048908 Ga0496105_0121013 Ga0496105_0121013_982_1935 317
122 3300048913 Ga0496110_0027429 Ga0496110_0027429_1732_2685 317
123 3300048914 Ga0496111_0029320 Ga0496111_0029320_2367_3320 317
124 3300048916 Ga0496113_0014488 Ga0496113_0014488_3140_4093 317
125 3300048924 Ga0496121_0015752 Ga0496121_0015752_5240_6193 317
126 3300048925 Ga0496122_0000018 Ga0496122_0000018_66814_67767 317
127 3300048926 Ga0496123_0000015 Ga0496123_0000015_66814_67767 317
128 3300048927 Ga0496124_0014926 Ga0496124_0014926_5975_6928 317
129 3300050491 nmdc:mga00v17_145054_c1 nmdc:mga00v17_145054_c1_410_1363 317
130 3300050510 nmdc:mga06r32_18517_c1 nmdc:mga06r32_18517_c1_2509_3498 317
131 3300053085 Ga0495619_0069715 Ga0495619_0069715_1137_2090 317
132 3300005336 Ga0070680_100021580 Ga0070680_1000215804 318
133 3300005337 Ga0070682_100026814 Ga0070682_1000268142 318
134 3300005347 Ga0070668_100114496 Ga0070668_1001144961 318
135 3300005457 Ga0070662_100020841 Ga0070662_1000208414 318
136 3300005458 Ga0070681_10018167 Ga0070681_100181675 318
137 3300005539 Ga0068853_100014353 Ga0068853_1000143536 318
138 3300005547 Ga0070693_100021464 Ga0070693_1000214642 318
139 3300006042 Ga0075368_10018334 Ga0075368_100183342 318
140 3300006042 Ga0075368_10030309 Ga0075368_100303092 318
141 3300006042 Ga0075368_10035941 Ga0075368_100359412 318
142 3300006048 Ga0075363_100132374 Ga0075363_1001323742 318
143 3300006051 Ga0075364_10000635 Ga0075364_100006353 318
144 3300006178 Ga0075367_10025812 Ga0075367_100258122 318
145 3300006178 Ga0075367_10139760 Ga0075367_101397602 318
146 3300006847 Ga0075431_100039841 Ga0075431_1000398414 318
147 3300014326 Ga0157380_10055078 Ga0157380_100550782 318
148 3300025912 Ga0207707_10115775 Ga0207707_101157752 318
149 3300025932 Ga0207690_10091773 Ga0207690_100917733 318
150 3300026041 Ga0207639_10016618 Ga0207639_100166184 318
151 3300026075 Ga0207708_10212913 Ga0207708_102129132 318
152 3300026116 Ga0207674_10021511 Ga0207674_100215114 318
153 3300027866 Ga0209813_10000843 Ga0209813_100008432 318
154 3300027866 Ga0209813_10004341 Ga0209813_100043414 318
155 3300028381 Ga0268264_10309124 Ga0268264_103091242 318
156 3300031727 Ga0316576_10087287 Ga0316576_100872872 318
157 3300047320 Ga0495672_0042690 Ga0495672_0042690_1628_2584 318
158 3300047320 Ga0495672_0145393 Ga0495672_0145393_103_1059 318
159 3300048918 Ga0496115_0095729 Ga0496115_0095729_770_1834 318
160 3300048922 Ga0496119_0001626 Ga0496119_0001626_7932_9116 318
161 3300049568 Ga0501031_0100928 Ga0501031_0100928_793_1749 318
162 3300049569 Ga0501032_0069340 Ga0501032_0069340_13_969 318
163 3300049570 Ga0501033_0015129 Ga0501033_0015129_3471_4427 318
164 3300049570 Ga0501033_0056723 Ga0501033_0056723_1574_2530 318
165 3300049572 Ga0501036_0017052 Ga0501036_0017052_4272_5228 318
166 3300049573 Ga0501037_0021520 Ga0501037_0021520_3382_4338 318
167 3300049574 Ga0501038_0016427 Ga0501038_0016427_4067_5023 318
168 3300049574 Ga0501038_0029883 Ga0501038_0029883_3577_4533 318
169 3300049575 Ga0501039_0018617 Ga0501039_0018617_1698_2654 318
170 3300049575 Ga0501039_0035490 Ga0501039_0035490_2129_3085 318
171 3300049576 Ga0501040_0101189 Ga0501040_0101189_431_1387 318
172 3300049577 Ga0501041_0032844 Ga0501041_0032844_258_1214 318
173 3300049578 Ga0501042_0019499 Ga0501042_0019499_1052_2008 318
174 3300049579 Ga0501043_0053375 Ga0501043_0053375_2133_3089 318
175 3300049579 Ga0501043_0238698 Ga0501043_0238698_261_1217 318
176 3300049580 Ga0501046_0013990 Ga0501046_0013990_1013_1969 318
177 3300049580 Ga0501046_0158958 Ga0501046_0158958_271_1227 318
178 3300049581 Ga0501047_0013711 Ga0501047_0013711_3845_4801 318
179 3300049582 Ga0501048_0097995 Ga0501048_0097995_351_1307 318
180 3300049583 Ga0501067_0017834 Ga0501067_0017834_1974_2930 318
181 3300049587 Ga0501071_0130911 Ga0501071_0130911_435_1391 318
182 3300049588 Ga0501072_0007510 Ga0501072_0007510_1300_2256 318
183 3300049589 Ga0501073_0018570 Ga0501073_0018570_1088_2044 318
184 3300049590 Ga0501074_0172278 Ga0501074_0172278_202_1158 318
185 3300049591 Ga0501075_0076164 Ga0501075_0076164_801_1757 318
186 3300049592 Ga0501076_0395395 Ga0501076_0395395_44_1000 318
187 3300049741 Ga0501079_0074545 Ga0501079_0074545_1633_2589 318
188 3300049742 Ga0501080_0124244 Ga0501080_0124244_1046_2002 318
189 3300049743 Ga0501081_0049884 Ga0501081_0049884_113_1069 318
190 3300049744 Ga0501083_0262235 Ga0501083_0262235_103_1059 318
191 3300049822 Ga0501035_0038260 Ga0501035_0038260_1633_2589 318
192 3300049824 Ga0501045_0053231 Ga0501045_0053231_385_1341 318
193 3300050490 nmdc:mga03n38_24934_c1 nmdc:mga03n38_24934_c1_724_1680 318
194 3300050490 nmdc:mga03n38_9248_c1 nmdc:mga03n38_9248_c1_1127_2083 318
195 3300050491 nmdc:mga00v17_9206_c1 nmdc:mga00v17_9206_c1_1091_2047 318
196 3300050494 nmdc:mga06z11_1623_c1 nmdc:mga06z11_1623_c1_1872_2828 318
197 3300050494 nmdc:mga06z11_65820_c1 nmdc:mga06z11_65820_c1_601_1557 318
198 3300050495 nmdc:mga04h51_10781_c1 nmdc:mga04h51_10781_c1_1108_2064 318
199 3300050495 nmdc:mga04h51_720_c1 nmdc:mga04h51_720_c1_6463_7419 318
200 3300060353 Ga0501082_0103786 Ga0501082_0103786_1322_2278 318
201 3300061734 Ga0530510_0060002 Ga0530510_0060002_1219_2175 318
202 iso_pu_bacteria 2818991461 2819686057 318
203 3300003659 JGI25404J52841_10000096 JGI25404J52841_100000964 319
204 3300005366 Ga0070659_100079358 Ga0070659_1000793582 319
205 3300005983 Ga0081540_1000055 Ga0081540_100005580 319
206 3300006844 Ga0075428_100024550 Ga0075428_1000245505 319
207 3300006844 Ga0075428_100071182 Ga0075428_1000711822 319
208 3300006847 Ga0075431_100001157 Ga0075431_10000115712 319
209 3300006880 Ga0075429_100023426 Ga0075429_1000234262 319
210 3300009174 Ga0105241_10019569 Ga0105241_100195693 319
211 3300010375 Ga0105239_10149010 Ga0105239_101490102 319
212 3300013100 Ga0157373_10016004 Ga0157373_100160045 319
213 3300013104 Ga0157370_10018911 Ga0157370_100189115 319
214 3300013307 Ga0157372_10009740 Ga0157372_100097402 319
215 3300037312 Ga0395899_0017131 Ga0395899_0017131_596_1573 319
216 3300037418 Ga0395900_0061653 Ga0395900_0061653_2563_3540 319
217 3300037466 Ga0395898_0022408 Ga0395898_0022408_2128_3105 319
218 3300038443 Ga0395901_0074500 Ga0395901_0074500_444_1421 319
219 3300046459 Ga0495629_0000918 Ga0495629_0000918_2584_3549 319
220 3300046471 Ga0495650_0002956 Ga0495650_0002956_2560_3525 319
221 3300046472 Ga0495580_0014541 Ga0495580_0014541_2575_3540 319
222 3300046473 Ga0495582_0013934 Ga0495582_0013934_342_1307 319
223 3300046475 Ga0495639_0029296 Ga0495639_0029296_1106_2071 319
224 3300046506 Ga0495583_0031902 Ga0495583_0031902_472_1437 319
225 3300046511 Ga0495608_0042844 Ga0495608_0042844_153_1118 319
226 3300046528 Ga0495642_0001086 Ga0495642_0001086_828_1793 319
227 3300046530 Ga0495654_0041135 Ga0495654_0041135_401_1366 319
228 3300046543 Ga0495645_0000632 Ga0495645_0000632_20670_21635 319
229 3300046559 Ga0495667_0020199 Ga0495667_0020199_2563_3528 319
230 3300046680 Ga0495646_0015267 Ga0495646_0015267_2086_3051 319
231 3300046684 Ga0495669_0019779 Ga0495669_0019779_671_1636 319
232 3300046689 Ga0495613_0006448 Ga0495613_0006448_1001_1966 319
233 3300046794 Ga0495589_0004700 Ga0495589_0004700_3894_4859 319
234 3300046809 Ga0495600_0121519 Ga0495600_0121519_226_1191 319
235 3300047322 Ga0495680_0104700 Ga0495680_0104700_234_1199 319
236 3300047444 Ga0495675_0089249 Ga0495675_0089249_341_1306 319
237 3300047470 Ga0495681_0101499 Ga0495681_0101499_240_1205 319
238 3300047673 Ga0495593_0038985 Ga0495593_0038985_233_1198 319
239 3300048903 Ga0496100_0036834 Ga0496100_0036834_1714_2679 319
240 3300048908 Ga0496105_0107459 Ga0496105_0107459_539_1504 319
241 3300048912 Ga0496109_0198748 Ga0496109_0198748_63_1028 319
242 3300048912 Ga0496109_0514962 Ga0496109_0514962_17_1018 319
243 3300048917 Ga0496114_0006683 Ga0496114_0006683_7373_8338 319
244 3300048918 Ga0496115_0080368 Ga0496115_0080368_1262_2227 319
245 3300050508 nmdc:mga09592_14486_c1 nmdc:mga09592_14486_c1_804_1928 319
246 3300050510 nmdc:mga06r32_3701_c1 nmdc:mga06r32_3701_c1_1416_2540 319
247 3300003203 JGI25406J46586_10007655 JGI25406J46586_100076553 320
248 3300005937 Ga0081455_10106348 Ga0081455_101063482 320
249 3300005985 Ga0081539_10002333 Ga0081539_1000233312 320
250 3300006048 Ga0075363_100011806 Ga0075363_1000118063 320
251 3300006051 Ga0075364_10007609 Ga0075364_100076093 320
252 3300006051 Ga0075364_10036576 Ga0075364_100365763 320
253 3300006177 Ga0075362_10002726 Ga0075362_100027264 320
254 3300006178 Ga0075367_10085483 Ga0075367_100854832 320
255 3300006178 Ga0075367_10176017 Ga0075367_101760171 320
256 3300006186 Ga0075369_10037344 Ga0075369_100373442 320
257 3300006195 Ga0075366_10017055 Ga0075366_100170554 320
258 3300006353 Ga0075370_10032622 Ga0075370_100326222 320
259 3300006353 Ga0075370_10104447 Ga0075370_101044472 320
260 3300036712 Ga0316584_0093065 Ga0316584_0093065_213_1181 320
261 3300049585 Ga0501069_0010864 Ga0501069_0010864_3151_4113 320
262 3300049585 Ga0501069_0023711 Ga0501069_0023711_2327_3334 320
263 3300049586 Ga0501070_0046511 Ga0501070_0046511_179_1186 320
264 3300049586 Ga0501070_0058735 Ga0501070_0058735_762_1724 320
265 3300049742 Ga0501080_0194327 Ga0501080_0194327_322_1329 320
266 3300049822 Ga0501035_0001092 Ga0501035_0001092_4537_5499 320
267 3300050489 nmdc:mga03683_13467_c1 nmdc:mga03683_13467_c1_17_979 320
268 3300050491 nmdc:mga00v17_6194_c1 nmdc:mga00v17_6194_c1_3118_4080 320
269 3300050493 nmdc:mga0k408_4240_c1 nmdc:mga0k408_4240_c1_4689_5651 320
270 3300050496 nmdc:mga07m45_146061_c1 nmdc:mga07m45_146061_c1_126_1088 320
271 3300050516 nmdc:mga0sz30_64507_c1 nmdc:mga0sz30_64507_c1_46_1008 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

55

357

0.96

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

147

327

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cuk-assembly2.cif.gz_D crystal structure of tt0316 protein from thermus thermophilus hb8 0.8871 4 318
5tx7-assembly1.cif.gz_B crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from desulfovibrio vulgaris 0.8827 4 320
2cuk-assembly2.cif.gz_D crystal structure of tt0316 protein from thermus thermophilus hb8 0.8789 4 318
6cwa-assembly1.cif.gz_B crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution 0.8726 37 304
5tx7-assembly1.cif.gz_B crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from desulfovibrio vulgaris 0.8721 4 320
ID Description Score Start End Superfamily
af_Q2FZW9_11_72_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.958 37 96 3.40.50.720
af_O88712_64_123_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9226 43 95 3.90.180.10
af_K7L0E3_28_115_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9163 44 96 3.40.50.720
af_Q2FZW9_11_72_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9142 37 96 3.40.50.720
af_Q9EQ76_1_173_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8982 148 179 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7W9Y7K1-F1-model_v4 Glycerate dehydrogenase (EC 1.1.1.29) 0.9882 3 318 GO:0008465
GO:0051287
AF-A0A351CY37-F1-model_v4 Glycerate dehydrogenase 0.9855 1 163 GO:0016616
GO:0051287
AF-A0A2E6VZB5-F1-model_v4 Glycerate dehydrogenase (EC 1.1.1.29) 0.9838 6 318 GO:0008465
GO:0051287
AF-A0A2M7GQ77-F1-model_v4 Glycerate dehydrogenase (EC 1.1.1.29) 0.9836 1 318 GO:0008465
GO:0051287
AF-A0A0P0RIU0-F1-model_v4 Hydroxypyruvate reductase (EC 1.1.1.29) 0.9835 40 320 GO:0008465
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.5 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map