F377973

General Info

Members Datasets Scaffolds Average Seq Length
271 184 542 124

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0555603|Ga0501080_0555603_137_571
Length 144
Sequence MIRPFGPARCRQVFQAEDVMATVKYTDEHEWISVEDGVGTVGITDYAQEQLGDVVFVEVPEVGRIIAKGEAVAVVESVKAASDIYAPVSGEVVAANGALADAPGDVNLEPTGKGWFFKVRLADPAELDGLMDQAKYDAFVKSLA

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
178 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
179 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
180 2643221583 Caulobacter sp. Root655 Isolate Unclassified
181 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
182 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
183 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
184 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.94
Metatranscriptomes 1.11
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.55
Nodule 0
Rhizoplane 4.06
Rhizosphere 77.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0555603 3300049742 Bacteria 1022
2 SwRhRL2b_contig_450426 2162886007 Bacteria 816
3 rootH2_10030369 3300003320 Bacteria 1261
4 rootH2_10066745 3300003320 Bacteria 1072
5 rootL2_10103993 3300003322 Bacteria 2280
6 rootH1_10092116 3300003323 Bacteria 1161
7 rootH1_10108294 3300003323 Bacteria 2175
8 Ga0070658_10802296 3300005327 Bacteria 818
9 Ga0070676_10242143 3300005328 Bacteria 1200
10 Ga0070670_100754832 3300005331 Bacteria 877
11 Ga0068868_100241766 3300005338 Bacteria 1517
12 Ga0070691_10012273 3300005341 Bacteria 3921
13 Ga0070692_11105791 3300005345 Bacteria 560
14 Ga0070675_100492255 3300005354 Bacteria 1104
15 Ga0070671_101689477 3300005355 Bacteria 562
16 Ga0070674_100335163 3300005356 Bacteria 1217
17 Ga0070674_100693613 3300005356 Bacteria 870
18 Ga0070673_101202530 3300005364 Bacteria 710
19 Ga0070667_100205678 3300005367 Bacteria 1748
20 Ga0070700_100134587 3300005441 Bacteria 1672
21 Ga0070694_101056431 3300005444 Bacteria 676
22 Ga0070663_100265996 3300005455 Bacteria 1361
23 Ga0068867_100033854 3300005459 Bacteria 3703
24 Ga0070706_100921147 3300005467 Bacteria 807
25 Ga0070686_100959568 3300005544 Bacteria 699
26 Ga0070695_100673197 3300005545 Bacteria 819
27 Ga0070665_100462721 3300005548 Bacteria 1278
28 Ga0068854_100005628 3300005578 Bacteria 7916
29 Ga0068852_102257887 3300005616 Bacteria 565
30 Ga0068859_100475754 3300005617 Bacteria 1345
31 Ga0068864_101058568 3300005618 Bacteria 806
32 Ga0068866_11231515 3300005718 Bacteria 541
33 Ga0068861_100189512 3300005719 Bacteria 1718
34 Ga0068861_101174791 3300005719 Bacteria 741
35 Ga0068860_100539141 3300005843 Bacteria 1168
36 Ga0068862_100166299 3300005844 Bacteria 1972
37 Ga0068862_101411834 3300005844 Bacteria 700
38 Ga0075365_10025021 3300006038 Bacteria 3774
39 Ga0075365_10102119 3300006038 Bacteria 1965
40 Ga0075368_10007830 3300006042 Bacteria 3786
41 Ga0075368_10023505 3300006042 Bacteria 2355
42 Ga0075363_100019108 3300006048 Bacteria 3422
43 Ga0075364_10020066 3300006051 Bacteria 4202
44 Ga0075362_10055627 3300006177 Bacteria 1780
45 Ga0075367_10035888 3300006178 Bacteria 2872
46 Ga0075367_10049961 3300006178 Bacteria 2467
47 Ga0075367_10093675 3300006178 Bacteria 1830
48 Ga0075428_100151239 3300006844 Bacteria 2521
49 Ga0075431_100184941 3300006847 Bacteria 2137
50 Ga0075436_100150126 3300006914 Bacteria 1640
51 Ga0097620_100475746 3300006931 Bacteria 1345
52 Ga0114129_10311172 3300009147 Bacteria 2096
53 Ga0105243_11008820 3300009148 Bacteria 835
54 Ga0105246_10467272 3300011119 Bacteria 1064
55 Ga0157370_10223925 3300013104 Bacteria 1742
56 Ga0157370_10979553 3300013104 Bacteria 766
57 Ga0157378_11614242 3300013297 Bacteria 694
58 Ga0163162_11588927 3300013306 Bacteria 746
59 Ga0157372_11297348 3300013307 Bacteria 840
60 Ga0163163_10772608 3300014325 Bacteria 1024
61 Ga0163163_11134021 3300014325 Bacteria 845
62 Ga0157380_10123402 3300014326 Bacteria 2198
63 Ga0157380_10152824 3300014326 Bacteria 1997
64 Ga0157380_10276932 3300014326 Bacteria 1533
65 Ga0157380_10832739 3300014326 Bacteria 943
66 Ga0213872_10006973 3300021361 Bacteria 5605
67 Ga0213872_10056208 3300021361 Bacteria 1783
68 Ga0213876_10022276 3300021384 Bacteria 3351
69 Ga0207645_10215756 3300025907 Bacteria 1264
70 Ga0207649_10303461 3300025920 Bacteria 1168
71 Ga0207706_10433967 3300025933 Bacteria 1137
72 Ga0207669_10109213 3300025937 Bacteria 1849
73 Ga0207669_10396231 3300025937 Bacteria 1080
74 Ga0207669_11505932 3300025937 Bacteria 574
75 Ga0207689_10311862 3300025942 Bacteria 1305
76 Ga0207689_11439332 3300025942 Bacteria 577
77 Ga0207668_10203039 3300025972 Bacteria 1580
78 Ga0207668_11938772 3300025972 Bacteria 531
79 Ga0207640_10026282 3300025981 Bacteria 3533
80 Ga0207658_10161716 3300025986 Bacteria 1836
81 Ga0207677_10344441 3300026023 Bacteria 1246
82 Ga0207678_10213616 3300026067 Bacteria 1650
83 Ga0207702_10634589 3300026078 Bacteria 1050
84 Ga0207676_10897622 3300026095 Bacteria 869
85 Ga0207675_100075948 3300026118 Bacteria 3146
86 Ga0207675_101254545 3300026118 Bacteria 761
87 Ga0207698_10312698 3300026142 Bacteria 1468
88 Ga0209813_10010384 3300027866 Bacteria 2407
89 Ga0209813_10032139 3300027866 Bacteria 1553
90 Ga0209813_10204444 3300027866 Bacteria 732
91 Ga0268266_10138833 3300028379 Bacteria 2180
92 Ga0268266_10627813 3300028379 Bacteria 1033
93 Ga0268265_10145033 3300028380 Bacteria 1993
94 Ga0268265_11421223 3300028380 Bacteria 696
95 Ga0268264_10602849 3300028381 Bacteria 1082
96 Ga0307515_10026083 3300028794 Bacteria 10075
97 Ga0265327_10070295 3300031251 Bacteria 1754
98 Ga0307405_10899158 3300031731 Bacteria 749
99 Ga0307410_10524466 3300031852 Bacteria 978
100 Ga0307406_11058568 3300031901 Bacteria 699
101 Ga0307406_12034407 3300031901 Bacteria 514
102 Ga0307409_100319749 3300031995 Bacteria 1452
103 Ga0307409_100515367 3300031995 Bacteria 1167
104 Ga0307416_101737590 3300032002 Bacteria 728
105 Ga0307416_101863314 3300032002 Bacteria 705
106 Ga0307414_11042990 3300032004 Bacteria 754
107 Ga0307411_10076284 3300032005 Bacteria 2291
108 Ga0307411_10288439 3300032005 Bacteria 1310
109 Ga0307411_10481850 3300032005 Bacteria 1045
110 Ga0307415_100627683 3300032126 Bacteria 960
111 Ga0316593_10134757 3300032168 Bacteria 893
112 Ga0395899_0025604 3300037312 Bacteria 4453
113 Ga0395900_0022350 3300037418 Bacteria 6470
114 Ga0395900_0095287 3300037418 Bacteria 3058
115 Ga0395898_0003601 3300037466 Bacteria 17261
116 Ga0395898_0250052 3300037466 Bacteria 1691
117 Ga0395898_1685858 3300037466 Bacteria 557
118 Ga0395905_0001346 3300037471 Bacteria 29919
119 Ga0395905_0002924 3300037471 Bacteria 18610
120 Ga0395905_0056654 3300037471 Bacteria 3666
121 Ga0436364_1125036 3300037853 Bacteria 39298
122 Ga0395901_0038797 3300038443 Bacteria 4926
123 Ga0395901_0040374 3300038443 Bacteria 4833
124 Ga0395901_0134765 3300038443 Bacteria 2596
125 Ga0436365_0552116 3300039437 Bacteria 1957
126 Ga0436360_0618704 3300039438 Bacteria 679
127 Ga0436361_0246264 3300039447 Bacteria 4243
128 Ga0436361_0623371 3300039447 Bacteria 9164
129 Ga0436363_0001639 3300039450 Bacteria 1252
130 Ga0439445_0003057 3300042004 Bacteria 3745
131 Ga0450893_0089433 3300042532 Bacteria 617
132 Ga0466969_0000099 3300044656 Bacteria 45600
133 Ga0466966_0000192 3300044684 Bacteria 40833
134 Ga0466966_0058297 3300044684 Bacteria 2441
135 Ga0466961_0005140 3300044693 Bacteria 8231
136 Ga0466963_0208919 3300044694 Bacteria 1366
137 Ga0466971_0004493 3300044719 Bacteria 6027
138 Ga0466971_0159101 3300044719 Bacteria 1057
139 Ga0466970_0024135 3300044765 Bacteria 3179
140 Ga0466957_0004265 3300044842 Bacteria 7926
141 Ga0466957_0053559 3300044842 Bacteria 2460
142 Ga0466959_0000526 3300045049 Bacteria 22194
143 Ga0466959_0087089 3300045049 Bacteria 2247
144 Ga0466958_0007685 3300045836 Bacteria 5945
145 Ga0495617_060792 3300046452 Bacteria 1250
146 Ga0495603_0342302 3300046455 Bacteria 858
147 Ga0495638_0002444 3300046460 Bacteria 15164
148 Ga0495638_0358099 3300046460 Bacteria 768
149 Ga0495639_0284003 3300046475 Bacteria 823
150 Ga0495610_0000078 3300046512 Bacteria 116266
151 Ga0495610_0031570 3300046512 Bacteria 2762
152 Ga0495616_0073071 3300046513 Bacteria 1655
153 Ga0495631_0195946 3300046518 Bacteria 864
154 Ga0495637_0061870 3300046520 Bacteria 1533
155 Ga0495663_0061509 3300046525 Bacteria 1181
156 Ga0495668_0363251 3300046616 Bacteria 795
157 Ga0495625_0000398 3300046660 Bacteria 66474
158 Ga0495625_0014861 3300046660 Bacteria 6192
159 Ga0495671_0112877 3300046692 Bacteria 1327
160 Ga0495660_0270024 3300046810 Bacteria 782
161 Ga0495604_0000071 3300047317 Bacteria 89185
162 Ga0495672_0000799 3300047320 Bacteria 33977
163 Ga0495673_0000348 3300047469 Bacteria 58039
164 Ga0495673_0070968 3300047469 Bacteria 1465
165 Ga0495686_0003845 3300047472 Bacteria 12704
166 Ga0495686_0064910 3300047472 Bacteria 2258
167 Ga0496102_0381377 3300048905 Bacteria 1327
168 Ga0496102_0839169 3300048905 Bacteria 841
169 Ga0496104_0001301 3300048907 Bacteria 21525
170 Ga0496105_0001938 3300048908 Bacteria 14867
171 Ga0496108_0014568 3300048911 Bacteria 6418
172 Ga0496109_0011068 3300048912 Bacteria 7735
173 Ga0496109_0328091 3300048912 Bacteria 1445
174 Ga0496110_0009420 3300048913 Bacteria 7909
175 Ga0496111_0040689 3300048914 Bacteria 3334
176 Ga0496111_0902263 3300048914 Bacteria 636
177 Ga0496113_0005945 3300048916 Bacteria 7672
178 Ga0501031_0141602 3300049568 Bacteria 1572
179 Ga0501031_0787357 3300049568 Bacteria 610
180 Ga0501034_0069488 3300049571 Bacteria 3533
181 Ga0501036_1372974 3300049572 Bacteria 573
182 Ga0501038_0684968 3300049574 Bacteria 769
183 Ga0501039_0634273 3300049575 Bacteria 837
184 Ga0501039_0902557 3300049575 Bacteria 688
185 Ga0501042_0917683 3300049578 Bacteria 638
186 Ga0501046_0158718 3300049580 Bacteria 1702
187 Ga0501047_0562957 3300049581 Bacteria 963
188 Ga0501048_0064119 3300049582 Bacteria 2599
189 Ga0501048_0151787 3300049582 Bacteria 1639
190 Ga0501048_0230442 3300049582 Bacteria 1314
191 Ga0501067_0318540 3300049583 Bacteria 866
192 Ga0501069_0160514 3300049585 Bacteria 1294
193 Ga0501069_0684518 3300049585 Bacteria 618
194 Ga0501070_0014957 3300049586 Bacteria 6529
195 Ga0501070_0470796 3300049586 Bacteria 1011
196 Ga0501071_0208095 3300049587 Bacteria 1471
197 Ga0501071_1220589 3300049587 Bacteria 581
198 Ga0501072_0013244 3300049588 Bacteria 6316
199 Ga0501072_0358872 3300049588 Bacteria 1157
200 Ga0501073_0029783 3300049589 Bacteria 3901
201 Ga0501073_0522904 3300049589 Bacteria 820
202 Ga0501074_0172745 3300049590 Bacteria 1542
203 Ga0501074_0369098 3300049590 Bacteria 1018
204 Ga0501074_1262060 3300049590 Bacteria 518
205 Ga0501075_0031353 3300049591 Bacteria 3945
206 Ga0501075_0480506 3300049591 Bacteria 948
207 Ga0501075_0971317 3300049591 Bacteria 645
208 Ga0501076_0293950 3300049592 Bacteria 1331
209 Ga0501076_0491596 3300049592 Bacteria 1011
210 Ga0501076_1158052 3300049592 Bacteria 636
211 Ga0501077_0625251 3300049593 Bacteria 692
212 Ga0501079_0283037 3300049741 Bacteria 1297
213 Ga0501079_0675221 3300049741 Bacteria 813
214 Ga0501079_0814677 3300049741 Bacteria 735
215 Ga0501080_0072072 3300049742 Bacteria 3214
216 Ga0501080_0213390 3300049742 Bacteria 1768
217 Ga0501080_1125290 3300049742 Bacteria 677
218 Ga0501080_1791985 3300049742 Bacteria 516
219 Ga0501081_0023538 3300049743 Bacteria 4129
220 Ga0501081_0558790 3300049743 Bacteria 855
221 Ga0501083_0054715 3300049744 Bacteria 2677
222 Ga0501083_0195073 3300049744 Bacteria 1321
223 Ga0501083_0852944 3300049744 Bacteria 593
224 Ga0501035_0464919 3300049822 Bacteria 1045
225 Ga0501035_0859013 3300049822 Bacteria 721
226 Ga0501044_0512608 3300049823 Bacteria 1100
227 Ga0501045_0177663 3300049824 Bacteria 1586
228 nmdc:mga03n38_68064_c1 3300050490 Bacteria 1641
229 nmdc:mga03n38_7001_c1 3300050490 Bacteria 3963
230 nmdc:mga00v17_9953_c1 3300050491 Bacteria 5172
231 nmdc:mga0yw44_127275_c1 3300050492 Bacteria 1646
232 nmdc:mga0yw44_32299_c1 3300050492 Bacteria 1980
233 nmdc:mga06z11_11416_c1 3300050494 Bacteria 3830
234 nmdc:mga06z11_74434_c1 3300050494 Bacteria 1806
235 nmdc:mga06z11_78088_c1 3300050494 Bacteria 1769
236 nmdc:mga04h51_14034_c1 3300050495 Bacteria 2281
237 nmdc:mga04h51_23759_c1 3300050495 Bacteria 1870
238 nmdc:mga05p37_375306_c1 3300050507 Bacteria 1668
239 nmdc:mga0qj67_474816_c1 3300050509 Bacteria 1006
240 nmdc:mga06r32_92624_c1 3300050510 Bacteria 2955
241 Ga0500556_0000577 3300053104 Bacteria 24364
242 Ga0500592_004647 3300053116 Bacteria 2183
243 Ga0500618_000120 3300053125 Bacteria 64103
244 Ga0500658_0006510 3300053134 Bacteria 4332
245 Ga0500559_0000140 3300053136 Bacteria 56230
246 Ga0500568_0005930 3300053139 Bacteria 6220
247 Ga0500573_0276743 3300053140 Bacteria 851
248 Ga0500611_048917 3300053727 Bacteria 961
249 Ga0500611_050134 3300053727 Bacteria 953
250 Ga0500645_019424 3300053730 Bacteria 2113
251 Ga0500599_104540 3300053736 Bacteria 500
252 Ga0501084_0017109 3300054114 Bacteria 6023
253 Ga0501084_0045014 3300054114 Bacteria 3695
254 Ga0501084_1346776 3300054114 Bacteria 598
255 Ga0587111_0076279 3300060346 Bacteria 793
256 Ga0587111_0103696 3300060346 Bacteria 712
257 Ga0501082_0006277 3300060353 Bacteria 10314
258 Ga0501082_0086954 3300060353 Bacteria 2696
259 Ga0501082_0625425 3300060353 Bacteria 942
260 Ga0501082_0907487 3300060353 Bacteria 771
261 Ga0466962_0003868 3300061719 Bacteria 7154
262 Ga0530510_0056419 3300061734 Bacteria 2838
263 Ga0530510_0120369 3300061734 Bacteria 1927
264 2599102430 2597490356 Bacteria 7030811
265 2643747205 2643221545 Bacteria 5083237
266 2643771870 2643221550 Bacteria 4619371
267 2643924364 2643221583 Bacteria 5218014
268 2846954508 2846952575 Bacteria 6587527
269 2848859230 2848858292 Bacteria 7391279
270 2896430637 2896429255 Bacteria 2557483
271 2897803858 2897803580 Bacteria 7000062
272 Ga0501080_0555603
273 SwRhRL2b_contig_450426
274 rootH2_10030369
275 rootH2_10066745
276 rootL2_10103993
277 rootH1_10092116
278 rootH1_10108294
279 Ga0070658_10802296
280 Ga0070676_10242143
281 Ga0070670_100754832
282 Ga0068868_100241766
283 Ga0070691_10012273
284 Ga0070692_11105791
285 Ga0070675_100492255
286 Ga0070671_101689477
287 Ga0070674_100335163
288 Ga0070674_100693613
289 Ga0070673_101202530
290 Ga0070667_100205678
291 Ga0070700_100134587
292 Ga0070694_101056431
293 Ga0070663_100265996
294 Ga0068867_100033854
295 Ga0070706_100921147
296 Ga0070686_100959568
297 Ga0070695_100673197
298 Ga0070665_100462721
299 Ga0068854_100005628
300 Ga0068852_102257887
301 Ga0068859_100475754
302 Ga0068864_101058568
303 Ga0068866_11231515
304 Ga0068861_100189512
305 Ga0068861_101174791
306 Ga0068860_100539141
307 Ga0068862_100166299
308 Ga0068862_101411834
309 Ga0075365_10025021
310 Ga0075365_10102119
311 Ga0075368_10007830
312 Ga0075368_10023505
313 Ga0075363_100019108
314 Ga0075364_10020066
315 Ga0075362_10055627
316 Ga0075367_10035888
317 Ga0075367_10049961
318 Ga0075367_10093675
319 Ga0075428_100151239
320 Ga0075431_100184941
321 Ga0075436_100150126
322 Ga0097620_100475746
323 Ga0114129_10311172
324 Ga0105243_11008820
325 Ga0105246_10467272
326 Ga0157370_10223925
327 Ga0157370_10979553
328 Ga0157378_11614242
329 Ga0163162_11588927
330 Ga0157372_11297348
331 Ga0163163_10772608
332 Ga0163163_11134021
333 Ga0157380_10123402
334 Ga0157380_10152824
335 Ga0157380_10276932
336 Ga0157380_10832739
337 Ga0213872_10006973
338 Ga0213872_10056208
339 Ga0213876_10022276
340 Ga0207645_10215756
341 Ga0207649_10303461
342 Ga0207706_10433967
343 Ga0207669_10109213
344 Ga0207669_10396231
345 Ga0207669_11505932
346 Ga0207689_10311862
347 Ga0207689_11439332
348 Ga0207668_10203039
349 Ga0207668_11938772
350 Ga0207640_10026282
351 Ga0207658_10161716
352 Ga0207677_10344441
353 Ga0207678_10213616
354 Ga0207702_10634589
355 Ga0207676_10897622
356 Ga0207675_100075948
357 Ga0207675_101254545
358 Ga0207698_10312698
359 Ga0209813_10010384
360 Ga0209813_10032139
361 Ga0209813_10204444
362 Ga0268266_10138833
363 Ga0268266_10627813
364 Ga0268265_10145033
365 Ga0268265_11421223
366 Ga0268264_10602849
367 Ga0307515_10026083
368 Ga0265327_10070295
369 Ga0307405_10899158
370 Ga0307410_10524466
371 Ga0307406_11058568
372 Ga0307406_12034407
373 Ga0307409_100319749
374 Ga0307409_100515367
375 Ga0307416_101737590
376 Ga0307416_101863314
377 Ga0307414_11042990
378 Ga0307411_10076284
379 Ga0307411_10288439
380 Ga0307411_10481850
381 Ga0307415_100627683
382 Ga0316593_10134757
383 Ga0395899_0025604
384 Ga0395900_0022350
385 Ga0395900_0095287
386 Ga0395898_0003601
387 Ga0395898_0250052
388 Ga0395898_1685858
389 Ga0395905_0001346
390 Ga0395905_0002924
391 Ga0395905_0056654
392 Ga0436364_1125036
393 Ga0395901_0038797
394 Ga0395901_0040374
395 Ga0395901_0134765
396 Ga0436365_0552116
397 Ga0436360_0618704
398 Ga0436361_0246264
399 Ga0436361_0623371
400 Ga0436363_0001639
401 Ga0439445_0003057
402 Ga0450893_0089433
403 Ga0466969_0000099
404 Ga0466966_0000192
405 Ga0466966_0058297
406 Ga0466961_0005140
407 Ga0466963_0208919
408 Ga0466971_0004493
409 Ga0466971_0159101
410 Ga0466970_0024135
411 Ga0466957_0004265
412 Ga0466957_0053559
413 Ga0466959_0000526
414 Ga0466959_0087089
415 Ga0466958_0007685
416 Ga0495617_060792
417 Ga0495603_0342302
418 Ga0495638_0002444
419 Ga0495638_0358099
420 Ga0495639_0284003
421 Ga0495610_0000078
422 Ga0495610_0031570
423 Ga0495616_0073071
424 Ga0495631_0195946
425 Ga0495637_0061870
426 Ga0495663_0061509
427 Ga0495668_0363251
428 Ga0495625_0000398
429 Ga0495625_0014861
430 Ga0495671_0112877
431 Ga0495660_0270024
432 Ga0495604_0000071
433 Ga0495672_0000799
434 Ga0495673_0000348
435 Ga0495673_0070968
436 Ga0495686_0003845
437 Ga0495686_0064910
438 Ga0496102_0381377
439 Ga0496102_0839169
440 Ga0496104_0001301
441 Ga0496105_0001938
442 Ga0496108_0014568
443 Ga0496109_0011068
444 Ga0496109_0328091
445 Ga0496110_0009420
446 Ga0496111_0040689
447 Ga0496111_0902263
448 Ga0496113_0005945
449 Ga0501031_0141602
450 Ga0501031_0787357
451 Ga0501034_0069488
452 Ga0501036_1372974
453 Ga0501038_0684968
454 Ga0501039_0634273
455 Ga0501039_0902557
456 Ga0501042_0917683
457 Ga0501046_0158718
458 Ga0501047_0562957
459 Ga0501048_0064119
460 Ga0501048_0151787
461 Ga0501048_0230442
462 Ga0501067_0318540
463 Ga0501069_0160514
464 Ga0501069_0684518
465 Ga0501070_0014957
466 Ga0501070_0470796
467 Ga0501071_0208095
468 Ga0501071_1220589
469 Ga0501072_0013244
470 Ga0501072_0358872
471 Ga0501073_0029783
472 Ga0501073_0522904
473 Ga0501074_0172745
474 Ga0501074_0369098
475 Ga0501074_1262060
476 Ga0501075_0031353
477 Ga0501075_0480506
478 Ga0501075_0971317
479 Ga0501076_0293950
480 Ga0501076_0491596
481 Ga0501076_1158052
482 Ga0501077_0625251
483 Ga0501079_0283037
484 Ga0501079_0675221
485 Ga0501079_0814677
486 Ga0501080_0072072
487 Ga0501080_0213390
488 Ga0501080_1125290
489 Ga0501080_1791985
490 Ga0501081_0023538
491 Ga0501081_0558790
492 Ga0501083_0054715
493 Ga0501083_0195073
494 Ga0501083_0852944
495 Ga0501035_0464919
496 Ga0501035_0859013
497 Ga0501044_0512608
498 Ga0501045_0177663
499 nmdc:mga03n38_68064_c1
500 nmdc:mga03n38_7001_c1
501 nmdc:mga00v17_9953_c1
502 nmdc:mga0yw44_127275_c1
503 nmdc:mga0yw44_32299_c1
504 nmdc:mga06z11_11416_c1
505 nmdc:mga06z11_74434_c1
506 nmdc:mga06z11_78088_c1
507 nmdc:mga04h51_14034_c1
508 nmdc:mga04h51_23759_c1
509 nmdc:mga05p37_375306_c1
510 nmdc:mga0qj67_474816_c1
511 nmdc:mga06r32_92624_c1
512 Ga0500556_0000577
513 Ga0500592_004647
514 Ga0500618_000120
515 Ga0500658_0006510
516 Ga0500559_0000140
517 Ga0500568_0005930
518 Ga0500573_0276743
519 Ga0500611_048917
520 Ga0500611_050134
521 Ga0500645_019424
522 Ga0500599_104540
523 Ga0501084_0017109
524 Ga0501084_0045014
525 Ga0501084_1346776
526 Ga0587111_0076279
527 Ga0587111_0103696
528 Ga0501082_0006277
529 Ga0501082_0086954
530 Ga0501082_0625425
531 Ga0501082_0907487
532 Ga0466962_0003868
533 Ga0530510_0056419
534 Ga0530510_0120369
535 2599102430
536 2643747205
537 2643771870
538 2643924364
539 2846954508
540 2848859230
541 2896430637
542 2897803858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

23

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9978 2 119
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.991 2 123
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9896 1 122
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9674 2 123
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9671 2 121
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9977 3 119 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.99 1 122 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9846 2 120 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.981 2 120 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9799 1 122 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3M1JW41-F1-model_v4 Glycine cleavage system protein GcvH 1.003 4 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A2S6TJJ3-F1-model_v4 Glycine cleavage system H protein 1.002 1 124 GO:0005829
GO:0005960
GO:0019464
AF-A0A0S3PS46-F1-model_v4 Glycine cleavage system H protein 1.002 1 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A6I4UL61-F1-model_v4 Glycine cleavage system H protein 1.002 3 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A6A8QNK0-F1-model_v4 Glycine cleavage system H protein 1.002 2 124 GO:0005737
GO:0005960
GO:0019464

Map