F377585

General Info

Members Datasets Scaffolds Average Seq Length
271 101 536 104

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100803127|Ga0075430_1008031271
Length 109
Sequence MNIWLVMLLGGLITFGMRFSLIYLFGRFQVPETMRKALHYVPPAVLSAIIFPELFLHDGAINLSLDNVRLLAGLIAIGVAWFSKNTLITIIVGMLALFLLQGLLGAVGG

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
68 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
69 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.11
Rhizosphere 98.89
Stem 0
Stem Tuber 0
Unclassified 30.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100803127 3300006846 Bacteria 775
2 SwRhRL3b_contig_1587191 2162886006 Bacteria 972
3 SwRhRL3b_contig_3866114 2162886006 Bacteria 1522
4 SwRhRL2b_contig_487625 2162886007 Bacteria 9829
5 JGI25406J46586_10048837 3300003203 Unclassified 1432
6 JGI25406J46586_10057627 3300003203 Bacteria 1269
7 Ga0065704_10070293 3300005289 Bacteria 38157
8 Ga0065704_10087259 3300005289 Bacteria 3041
9 Ga0065704_10100580 3300005289 Bacteria 2226
10 Ga0065712_10261060 3300005290 Bacteria 937
11 Ga0065707_10000469 3300005295 Bacteria 35239
12 Ga0065707_10083756 3300005295 Bacteria 8314
13 Ga0065707_10089410 3300005295 Bacteria 4379
14 Ga0065707_10190735 3300005295 Unclassified 1363
15 Ga0070680_100792016 3300005336 Bacteria 817
16 Ga0070680_101483874 3300005336 Bacteria 587
17 Ga0070689_100075893 3300005340 Bacteria 2632
18 Ga0070689_100263948 3300005340 Unclassified 1424
19 Ga0070689_100292432 3300005340 Unclassified 1354
20 Ga0070689_101320996 3300005340 Unclassified 650
21 Ga0070691_10362968 3300005341 Unclassified 807
22 Ga0070687_100621063 3300005343 Bacteria 745
23 Ga0070688_100203961 3300005365 Bacteria 1385
24 Ga0070705_100052862 3300005440 Unclassified 2375
25 Ga0070705_100203858 3300005440 Bacteria 1358
26 Ga0070705_100849247 3300005440 Bacteria 730
27 Ga0070694_100100799 3300005444 Bacteria 2043
28 Ga0070694_100102143 3300005444 Bacteria 2030
29 Ga0068867_101217259 3300005459 Unclassified 692
30 Ga0070706_100629696 3300005467 Bacteria 996
31 Ga0070706_101063858 3300005467 Unclassified 745
32 Ga0070707_100075645 3300005468 Bacteria 3248
33 Ga0070707_100121095 3300005468 Bacteria 2541
34 Ga0070698_100053560 3300005471 Bacteria 4100
35 Ga0070698_100118845 3300005471 Bacteria 2604
36 Ga0070698_100132128 3300005471 Bacteria 2451
37 Ga0070698_100324793 3300005471 Bacteria 1470
38 Ga0070698_101766514 3300005471 Bacteria 571
39 Ga0070699_100048811 3300005518 Bacteria 3664
40 Ga0070699_100093843 3300005518 Bacteria 2626
41 Ga0070697_100205463 3300005536 Bacteria 1675
42 Ga0070697_100426517 3300005536 Unclassified 1153
43 Ga0070695_100080413 3300005545 Bacteria 2154
44 Ga0070695_100567363 3300005545 Bacteria 887
45 Ga0070695_100983577 3300005545 Unclassified 685
46 Ga0070695_101129252 3300005545 Unclassified 642
47 Ga0070696_100201876 3300005546 Unclassified 1485
48 Ga0070696_100704620 3300005546 Unclassified 823
49 Ga0070696_100844530 3300005546 Unclassified 756
50 Ga0070704_100329812 3300005549 Unclassified 1281
51 Ga0070704_100388968 3300005549 Bacteria 1187
52 Ga0070704_100499353 3300005549 Unclassified 1055
53 Ga0070704_100513078 3300005549 Unclassified 1042
54 Ga0070704_101041776 3300005549 Unclassified 741
55 Ga0070664_100673440 3300005564 Unclassified 962
56 Ga0068857_100898521 3300005577 Bacteria 849
57 Ga0068857_101459339 3300005577 Unclassified 666
58 Ga0068857_102354033 3300005577 Viruses 523
59 Ga0068859_100206435 3300005617 Bacteria 2050
60 Ga0068859_100364953 3300005617 Bacteria 1539
61 Ga0068859_101029802 3300005617 Bacteria 904
62 Ga0068859_102009014 3300005617 Bacteria 638
63 Ga0068864_100940045 3300005618 Bacteria 855
64 Ga0068870_10334025 3300005840 Bacteria 967
65 Ga0068862_100029007 3300005844 Bacteria 4661
66 Ga0068862_100166107 3300005844 Bacteria 1973
67 Ga0068862_100963006 3300005844 Bacteria 842
68 Ga0068862_102192434 3300005844 Unclassified 564
69 Ga0081539_10003090 3300005985 Bacteria 21387
70 Ga0081539_10012871 3300005985 Bacteria 6375
71 Ga0075428_100258826 3300006844 Unclassified 1874
72 Ga0075428_101058917 3300006844 Unclassified 857
73 Ga0075428_101427004 3300006844 Unclassified 726
74 Ga0075428_102158222 3300006844 Unclassified 575
75 Ga0075430_100413760 3300006846 Bacteria 1113
76 Ga0075430_100432968 3300006846 Unclassified 1086
77 Ga0075431_100125686 3300006847 Unclassified 2646
78 Ga0075431_100261169 3300006847 Bacteria 1757
79 Ga0075431_100942564 3300006847 Unclassified 832
80 Ga0075431_101228615 3300006847 Unclassified 712
81 Ga0075433_10066025 3300006852 Bacteria 3174
82 Ga0075433_10327937 3300006852 Bacteria 1354
83 Ga0075434_100192034 3300006871 Unclassified 2063
84 Ga0075434_100213245 3300006871 Unclassified 1951
85 Ga0075434_102035449 3300006871 Unclassified 579
86 Ga0075434_102189169 3300006871 Unclassified 557
87 Ga0075429_100030716 3300006880 Bacteria 4667
88 Ga0075429_100052011 3300006880 Bacteria 3563
89 Ga0075429_100091581 3300006880 Bacteria 2652
90 Ga0075429_100097134 3300006880 Unclassified 2570
91 Ga0075429_100139346 3300006880 Bacteria 2123
92 Ga0075429_100366980 3300006880 Bacteria 1261
93 Ga0097620_100206439 3300006931 Bacteria 2050
94 Ga0097620_100364953 3300006931 Bacteria 1539
95 Ga0097620_101029805 3300006931 Bacteria 904
96 Ga0097620_102008474 3300006931 Bacteria 638
97 Ga0075435_101480852 3300007076 Bacteria 595
98 Ga0111539_10338374 3300009094 Bacteria 1752
99 Ga0105245_10903397 3300009098 Bacteria 925
100 Ga0114129_10056188 3300009147 Bacteria 5514
101 Ga0114129_10062623 3300009147 Bacteria 5196
102 Ga0114129_10071034 3300009147 Bacteria 4854
103 Ga0114129_10161969 3300009147 Bacteria 3055
104 Ga0114129_10301023 3300009147 Bacteria 2137
105 Ga0114129_10307363 3300009147 Bacteria 2111
106 Ga0105243_10050922 3300009148 Bacteria 3273
107 Ga0105242_10116590 3300009176 Bacteria 2285
108 Ga0105249_10116430 3300009553 Bacteria 2533
109 Ga0105249_10136909 3300009553 Bacteria 2344
110 Ga0105249_10238511 3300009553 Bacteria 1797
111 Ga0105249_12568098 3300009553 Bacteria 582
112 Ga0105246_10075036 3300011119 Bacteria 2393
113 Ga0105246_10409835 3300011119 Bacteria 1128
114 Ga0157380_10087002 3300014326 Bacteria 2569
115 Ga0213872_10011189 3300021361 Bacteria 4250
116 Ga0213872_10071862 3300021361 Bacteria 1559
117 Ga0207684_10722914 3300025910 Unclassified 845
118 Ga0207660_10173159 3300025917 Bacteria 1672
119 Ga0207646_10109454 3300025922 Bacteria 2479
120 Ga0207646_11277221 3300025922 Unclassified 642
121 Ga0207686_10573350 3300025934 Unclassified 885
122 Ga0207670_10023006 3300025936 Bacteria 3872
123 Ga0207670_10219520 3300025936 Bacteria 1454
124 Ga0207712_10077582 3300025961 Bacteria 2408
125 Ga0207640_10692879 3300025981 Unclassified 873
126 Ga0207674_10515263 3300026116 Bacteria 1155
127 Ga0207674_11086614 3300026116 Bacteria 769
128 Ga0207675_100103989 3300026118 Unclassified 2676
129 Ga0207675_101038955 3300026118 Bacteria 838
130 Ga0268265_10040928 3300028380 Bacteria 3425
131 Ga0268265_10332151 3300028380 Bacteria 1381
132 Ga0307408_101055716 3300031548 Unclassified 751
133 Ga0307405_10080204 3300031731 Unclassified 2130
134 Ga0307413_10198292 3300031824 Unclassified 1447
135 Ga0307410_10085643 3300031852 Bacteria 2224
136 Ga0307406_10566446 3300031901 Bacteria 932
137 Ga0307407_10064777 3300031903 Bacteria 2149
138 Ga0307412_10089542 3300031911 Bacteria 2149
139 Ga0307412_11461443 3300031911 Unclassified 620
140 Ga0307416_100822479 3300032002 Bacteria 1026
141 Ga0307411_11029010 3300032005 Unclassified 739
142 Ga0307415_100052760 3300032126 Bacteria 2767
143 Ga0307415_100577394 3300032126 Bacteria 997
144 Ga0373928_0115973 3300035084 Unclassified 713
145 Ga0373949_0069722 3300035090 Bacteria 919
146 Ga0242420_092640 3300038996 Bacteria 636
147 Ga0436361_0401437 3300039447 Bacteria 14937
148 Ga0436361_1106694 3300039447 Bacteria 2958
149 Ga0451800_1206769 3300041459 Unclassified 534
150 Ga0451807_2436851 3300041486 Unclassified 501
151 Ga0451577_0007473 3300042876 Bacteria 10732
152 Ga0451577_0050340 3300042876 Bacteria 3719
153 Ga0451577_0054616 3300042876 Unclassified 3565
154 Ga0451577_0080895 3300042876 Bacteria 2897
155 Ga0451577_0084708 3300042876 Bacteria 2828
156 Ga0451577_0236122 3300042876 Bacteria 1654
157 Ga0451577_0237656 3300042876 Bacteria 1648
158 Ga0451577_0404285 3300042876 Bacteria 1239
159 Ga0451577_0454798 3300042876 Unclassified 1163
160 Ga0451577_0582248 3300042876 Unclassified 1016
161 Ga0451577_0893023 3300042876 Unclassified 800
162 Ga0451577_0931588 3300042876 Unclassified 782
163 Ga0453683_0007880 3300044673 Bacteria 7185
164 Ga0453683_0040846 3300044673 Bacteria 2912
165 Ga0453683_0046708 3300044673 Bacteria 2714
166 Ga0453683_0054232 3300044673 Unclassified 2509
167 Ga0453683_0082264 3300044673 Bacteria 2018
168 Ga0453683_0286914 3300044673 Unclassified 1052
169 Ga0453683_0358568 3300044673 Bacteria 937
170 Ga0453683_0365365 3300044673 Bacteria 928
171 Ga0453683_0461813 3300044673 Bacteria 822
172 Ga0453683_0518153 3300044673 Bacteria 774
173 Ga0453683_0556692 3300044673 Bacteria 746
174 Ga0453684_0000023 3300044712 Bacteria 857153
175 Ga0453684_0000157 3300044712 Bacteria 304259
176 Ga0453684_0001080 3300044712 Bacteria 86823
177 Ga0453684_0010920 3300044712 Bacteria 15366
178 Ga0453684_0013934 3300044712 Bacteria 12965
179 Ga0453684_0021474 3300044712 Bacteria 9644
180 Ga0453684_0024579 3300044712 Bacteria 8799
181 Ga0453684_0026064 3300044712 Bacteria 8463
182 Ga0453684_0035082 3300044712 Bacteria 6943
183 Ga0453684_0046860 3300044712 Bacteria 5742
184 Ga0453684_0057108 3300044712 Bacteria 5056
185 Ga0453684_0059347 3300044712 Bacteria 4933
186 Ga0453684_0060042 3300044712 Bacteria 4896
187 Ga0453684_0060525 3300044712 Bacteria 4869
188 Ga0453684_0072742 3300044712 Bacteria 4338
189 Ga0453684_0091200 3300044712 Bacteria 3762
190 Ga0453684_0113406 3300044712 Bacteria 3288
191 Ga0453684_0150745 3300044712 Bacteria 2763
192 Ga0453684_0182278 3300044712 Bacteria 2464
193 Ga0453684_0199044 3300044712 Bacteria 2336
194 Ga0453684_0246974 3300044712 Bacteria 2051
195 Ga0453684_0257785 3300044712 Bacteria 1999
196 Ga0453684_0349119 3300044712 Bacteria 1669
197 Ga0453684_0395422 3300044712 Unclassified 1549
198 Ga0453684_0425626 3300044712 Bacteria 1482
199 Ga0453684_0485502 3300044712 Bacteria 1370
200 Ga0453684_0586589 3300044712 Unclassified 1223
201 Ga0453684_0717871 3300044712 Unclassified 1085
202 Ga0453684_0950580 3300044712 Bacteria 917
203 Ga0453684_1633637 3300044712 Unclassified 660
204 Ga0453684_1978595 3300044712 Bacteria 588
205 Ga0453684_2524311 3300044712 Unclassified 507
206 Ga0451576_0076737 3300045051 Bacteria 3478
207 Ga0451576_0082368 3300045051 Bacteria 3346
208 Ga0451576_0101423 3300045051 Bacteria 2993
209 Ga0451576_0279976 3300045051 Bacteria 1744
210 Ga0451576_0796422 3300045051 Unclassified 992
211 Ga0451576_0832887 3300045051 Unclassified 969
212 Ga0451576_0979534 3300045051 Unclassified 886
213 Ga0451576_0981977 3300045051 Bacteria 885
214 Ga0451576_1155563 3300045051 Unclassified 809
215 Ga0451576_1524024 3300045051 Bacteria 694
216 Ga0496106_0106777 3300048909 Bacteria 2177
217 Ga0501031_0289558 3300049568 Bacteria 1062
218 Ga0501036_0279667 3300049572 Unclassified 1397
219 Ga0501037_0327563 3300049573 Unclassified 1060
220 Ga0501039_0235088 3300049575 Unclassified 1441
221 Ga0501039_0298411 3300049575 Unclassified 1267
222 Ga0501041_0536447 3300049577 Bacteria 745
223 Ga0501048_0627178 3300049582 Unclassified 772
224 Ga0501071_0091411 3300049587 Bacteria 2236
225 Ga0501072_0144130 3300049588 Bacteria 1899
226 Ga0501072_0200248 3300049588 Bacteria 1592
227 Ga0501075_0016641 3300049591 Bacteria 5302
228 Ga0501075_0172008 3300049591 Bacteria 1653
229 Ga0501075_0458703 3300049591 Unclassified 972
230 Ga0501076_0065361 3300049592 Bacteria 2900
231 Ga0501076_0089469 3300049592 Bacteria 2475
232 Ga0501076_1232440 3300049592 Unclassified 616
233 Ga0501079_0493997 3300049741 Unclassified 962
234 Ga0501081_0064086 3300049743 Bacteria 2552
235 Ga0501081_0097575 3300049743 Bacteria 2074
236 Ga0501081_0466495 3300049743 Bacteria 939
237 Ga0501045_0304120 3300049824 Unclassified 1187
238 nmdc:mga05p37_107905_c1 3300050507 Bacteria 3425
239 nmdc:mga05p37_117557_c1 3300050507 Bacteria 3267
240 nmdc:mga05p37_242612_c1 3300050507 Bacteria 2165
241 nmdc:mga05p37_285389_c1 3300050507 Bacteria 1967
242 nmdc:mga05p37_31976_c1 3300050507 Bacteria 6433
243 nmdc:mga05p37_75435_c1 3300050507 Bacteria 4151
244 nmdc:mga09592_151478_c1 3300050508 Bacteria 2001
245 nmdc:mga09592_256625_c1 3300050508 Bacteria 1516
246 nmdc:mga09592_383495_c1 3300050508 Unclassified 1215
247 nmdc:mga09592_528789_c1 3300050508 Unclassified 1014
248 nmdc:mga09592_665045_c1 3300050508 Unclassified 888
249 nmdc:mga09592_93559_c1 3300050508 Unclassified 2570
250 nmdc:mga0qj67_264674_c1 3300050509 Bacteria 1394
251 nmdc:mga0qj67_44933_c1 3300050509 Bacteria 3484
252 nmdc:mga06r32_238936_c1 3300050510 Unclassified 1804
253 nmdc:mga06r32_312833_c1 3300050510 Bacteria 1556
254 nmdc:mga06r32_433430_c1 3300050510 Bacteria 1295
255 nmdc:mga06r32_769786_c1 3300050510 Bacteria 925
256 nmdc:mga08y16_413837_c1 3300050511 Bacteria 1378
257 nmdc:mga0n895_1028360_c1 3300050512 Unclassified 804
258 nmdc:mga0n895_1479771_c1 3300050512 Unclassified 646
259 nmdc:mga0a205_138759_c1 3300050515 Bacteria 2331
260 nmdc:mga0a205_19194_c1 3300050515 Bacteria 6443
261 nmdc:mga0a205_88880_c1 3300050515 Bacteria 2986
262 Ga0501084_0028657 3300054114 Bacteria 4656
263 Ga0501084_0179280 3300054114 Bacteria 1788
264 Ga0501084_1242817 3300054114 Unclassified 625
265 Ga0590075_176926 3300059424 Unclassified 564
266 Ga0501082_0022499 3300060353 Bacteria 5430
267 Ga0501082_0123828 3300060353 Bacteria 2242
268 Ga0530510_0055248 3300061734 Bacteria 2869
269 Ga0075430_100803127
270 SwRhRL3b_contig_1587191
271 SwRhRL3b_contig_3866114
272 SwRhRL2b_contig_487625
273 JGI25406J46586_10048837
274 JGI25406J46586_10057627
275 Ga0065704_10070293
276 Ga0065704_10087259
277 Ga0065704_10100580
278 Ga0065712_10261060
279 Ga0065707_10000469
280 Ga0065707_10083756
281 Ga0065707_10089410
282 Ga0065707_10190735
283 Ga0070680_100792016
284 Ga0070680_101483874
285 Ga0070689_100075893
286 Ga0070689_100263948
287 Ga0070689_100292432
288 Ga0070689_101320996
289 Ga0070691_10362968
290 Ga0070687_100621063
291 Ga0070688_100203961
292 Ga0070705_100052862
293 Ga0070705_100203858
294 Ga0070705_100849247
295 Ga0070694_100100799
296 Ga0070694_100102143
297 Ga0068867_101217259
298 Ga0070706_100629696
299 Ga0070706_101063858
300 Ga0070707_100075645
301 Ga0070707_100121095
302 Ga0070698_100053560
303 Ga0070698_100118845
304 Ga0070698_100132128
305 Ga0070698_100324793
306 Ga0070698_101766514
307 Ga0070699_100048811
308 Ga0070699_100093843
309 Ga0070697_100205463
310 Ga0070697_100426517
311 Ga0070695_100080413
312 Ga0070695_100567363
313 Ga0070695_100983577
314 Ga0070695_101129252
315 Ga0070696_100201876
316 Ga0070696_100704620
317 Ga0070696_100844530
318 Ga0070704_100329812
319 Ga0070704_100388968
320 Ga0070704_100499353
321 Ga0070704_100513078
322 Ga0070704_101041776
323 Ga0070664_100673440
324 Ga0068857_100898521
325 Ga0068857_101459339
326 Ga0068857_102354033
327 Ga0068859_100206435
328 Ga0068859_100364953
329 Ga0068859_101029802
330 Ga0068859_102009014
331 Ga0068864_100940045
332 Ga0068870_10334025
333 Ga0068862_100029007
334 Ga0068862_100166107
335 Ga0068862_100963006
336 Ga0068862_102192434
337 Ga0081539_10003090
338 Ga0081539_10012871
339 Ga0075428_100258826
340 Ga0075428_101058917
341 Ga0075428_101427004
342 Ga0075428_102158222
343 Ga0075430_100413760
344 Ga0075430_100432968
345 Ga0075431_100125686
346 Ga0075431_100261169
347 Ga0075431_100942564
348 Ga0075431_101228615
349 Ga0075433_10066025
350 Ga0075433_10327937
351 Ga0075434_100192034
352 Ga0075434_100213245
353 Ga0075434_102035449
354 Ga0075434_102189169
355 Ga0075429_100030716
356 Ga0075429_100052011
357 Ga0075429_100091581
358 Ga0075429_100097134
359 Ga0075429_100139346
360 Ga0075429_100366980
361 Ga0097620_100206439
362 Ga0097620_100364953
363 Ga0097620_101029805
364 Ga0097620_102008474
365 Ga0075435_101480852
366 Ga0111539_10338374
367 Ga0105245_10903397
368 Ga0114129_10056188
369 Ga0114129_10062623
370 Ga0114129_10071034
371 Ga0114129_10161969
372 Ga0114129_10301023
373 Ga0114129_10307363
374 Ga0105243_10050922
375 Ga0105242_10116590
376 Ga0105249_10116430
377 Ga0105249_10136909
378 Ga0105249_10238511
379 Ga0105249_12568098
380 Ga0105246_10075036
381 Ga0105246_10409835
382 Ga0157380_10087002
383 Ga0213872_10011189
384 Ga0213872_10071862
385 Ga0207684_10722914
386 Ga0207660_10173159
387 Ga0207646_10109454
388 Ga0207646_11277221
389 Ga0207686_10573350
390 Ga0207670_10023006
391 Ga0207670_10219520
392 Ga0207712_10077582
393 Ga0207640_10692879
394 Ga0207674_10515263
395 Ga0207674_11086614
396 Ga0207675_100103989
397 Ga0207675_101038955
398 Ga0268265_10040928
399 Ga0268265_10332151
400 Ga0307408_101055716
401 Ga0307405_10080204
402 Ga0307413_10198292
403 Ga0307410_10085643
404 Ga0307406_10566446
405 Ga0307407_10064777
406 Ga0307412_10089542
407 Ga0307412_11461443
408 Ga0307416_100822479
409 Ga0307411_11029010
410 Ga0307415_100052760
411 Ga0307415_100577394
412 Ga0373928_0115973
413 Ga0373949_0069722
414 Ga0242420_092640
415 Ga0436361_0401437
416 Ga0436361_1106694
417 Ga0451800_1206769
418 Ga0451807_2436851
419 Ga0451577_0007473
420 Ga0451577_0050340
421 Ga0451577_0054616
422 Ga0451577_0080895
423 Ga0451577_0084708
424 Ga0451577_0236122
425 Ga0451577_0237656
426 Ga0451577_0404285
427 Ga0451577_0454798
428 Ga0451577_0582248
429 Ga0451577_0893023
430 Ga0451577_0931588
431 Ga0453683_0007880
432 Ga0453683_0040846
433 Ga0453683_0046708
434 Ga0453683_0054232
435 Ga0453683_0082264
436 Ga0453683_0286914
437 Ga0453683_0358568
438 Ga0453683_0365365
439 Ga0453683_0461813
440 Ga0453683_0518153
441 Ga0453683_0556692
442 Ga0453684_0000023
443 Ga0453684_0000157
444 Ga0453684_0001080
445 Ga0453684_0010920
446 Ga0453684_0013934
447 Ga0453684_0021474
448 Ga0453684_0024579
449 Ga0453684_0026064
450 Ga0453684_0035082
451 Ga0453684_0046860
452 Ga0453684_0057108
453 Ga0453684_0059347
454 Ga0453684_0060042
455 Ga0453684_0060525
456 Ga0453684_0072742
457 Ga0453684_0091200
458 Ga0453684_0113406
459 Ga0453684_0150745
460 Ga0453684_0182278
461 Ga0453684_0199044
462 Ga0453684_0246974
463 Ga0453684_0257785
464 Ga0453684_0349119
465 Ga0453684_0395422
466 Ga0453684_0425626
467 Ga0453684_0485502
468 Ga0453684_0586589
469 Ga0453684_0717871
470 Ga0453684_0950580
471 Ga0453684_1633637
472 Ga0453684_1978595
473 Ga0453684_2524311
474 Ga0451576_0076737
475 Ga0451576_0082368
476 Ga0451576_0101423
477 Ga0451576_0279976
478 Ga0451576_0796422
479 Ga0451576_0832887
480 Ga0451576_0979534
481 Ga0451576_0981977
482 Ga0451576_1155563
483 Ga0451576_1524024
484 Ga0496106_0106777
485 Ga0501031_0289558
486 Ga0501036_0279667
487 Ga0501037_0327563
488 Ga0501039_0235088
489 Ga0501039_0298411
490 Ga0501041_0536447
491 Ga0501048_0627178
492 Ga0501071_0091411
493 Ga0501072_0144130
494 Ga0501072_0200248
495 Ga0501075_0016641
496 Ga0501075_0172008
497 Ga0501075_0458703
498 Ga0501076_0065361
499 Ga0501076_0089469
500 Ga0501076_1232440
501 Ga0501079_0493997
502 Ga0501081_0064086
503 Ga0501081_0097575
504 Ga0501081_0466495
505 Ga0501045_0304120
506 nmdc:mga05p37_107905_c1
507 nmdc:mga05p37_117557_c1
508 nmdc:mga05p37_242612_c1
509 nmdc:mga05p37_285389_c1
510 nmdc:mga05p37_31976_c1
511 nmdc:mga05p37_75435_c1
512 nmdc:mga09592_151478_c1
513 nmdc:mga09592_256625_c1
514 nmdc:mga09592_383495_c1
515 nmdc:mga09592_528789_c1
516 nmdc:mga09592_665045_c1
517 nmdc:mga09592_93559_c1
518 nmdc:mga0qj67_264674_c1
519 nmdc:mga0qj67_44933_c1
520 nmdc:mga06r32_238936_c1
521 nmdc:mga06r32_312833_c1
522 nmdc:mga06r32_433430_c1
523 nmdc:mga06r32_769786_c1
524 nmdc:mga08y16_413837_c1
525 nmdc:mga0n895_1028360_c1
526 nmdc:mga0n895_1479771_c1
527 nmdc:mga0a205_138759_c1
528 nmdc:mga0a205_19194_c1
529 nmdc:mga0a205_88880_c1
530 Ga0501084_0028657
531 Ga0501084_0179280
532 Ga0501084_1242817
533 Ga0590075_176926
534 Ga0501082_0022499
535 Ga0501082_0123828
536 Ga0530510_0055248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

3

101

0.99

Map