F377367

General Info

Members Datasets Scaffolds Average Seq Length
271 126 542 130

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10003952|JGI25406J46586_100039527
Length 131
Sequence MSVQYYEAVGRRKESTARVRVMGGSGRFIVNEKEAAVYFPRVGDLQDILRAFVAVGQDAKKYDITVKVNGGGVSGQTEAVRLGVARALVLLNGDWISALRKHGLLTRDARVKERKKPGLKKARKAPTYTKR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
86 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
95 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 2.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003952 3300003203 Bacteria 6931
2 SwRhRL2b_contig_192538 2162886007 Unclassified 1965
3 SwRhRL2b_contig_3816391 2162886007 Unclassified 1965
4 Ga0065707_10082110 3300005295 Bacteria 21594
5 Ga0070692_10316311 3300005345 Bacteria 958
6 Ga0070668_101057130 3300005347 Bacteria 731
7 Ga0070703_10102086 3300005406 Bacteria 1013
8 Ga0070701_11174968 3300005438 Bacteria 543
9 Ga0070705_101897449 3300005440 Bacteria 507
10 Ga0070700_100311957 3300005441 Bacteria 1152
11 Ga0070700_101021815 3300005441 Bacteria 681
12 Ga0070694_100712485 3300005444 Bacteria 817
13 Ga0070706_100100349 3300005467 Bacteria 2689
14 Ga0070707_100195189 3300005468 Bacteria 1974
15 Ga0070707_100201225 3300005468 Bacteria 1941
16 Ga0070707_100353193 3300005468 Bacteria 1428
17 Ga0070698_100033151 3300005471 Bacteria 5350
18 Ga0070698_100132224 3300005471 Bacteria 2450
19 Ga0070698_100134679 3300005471 Bacteria 2425
20 Ga0070699_100002160 3300005518 Bacteria 17784
21 Ga0070699_100041215 3300005518 Bacteria 3997
22 Ga0070679_101643922 3300005530 Bacteria 590
23 Ga0070697_100469473 3300005536 Bacteria 1098
24 Ga0070672_101425733 3300005543 Bacteria 620
25 Ga0070695_100432805 3300005545 Bacteria 1004
26 Ga0070704_100742066 3300005549 Bacteria 873
27 Ga0070704_101132288 3300005549 Bacteria 712
28 Ga0068859_100260123 3300005617 Bacteria 1827
29 Ga0068861_100459548 3300005719 Bacteria 1143
30 Ga0068861_102708683 3300005719 Bacteria 500
31 Ga0068870_10271706 3300005840 Bacteria 1059
32 Ga0068870_10373561 3300005840 Bacteria 921
33 Ga0068862_100055728 3300005844 Bacteria 3386
34 Ga0068862_100297231 3300005844 Bacteria 1484
35 Ga0068862_100606463 3300005844 Bacteria 1052
36 Ga0081539_10003413 3300005985 Bacteria 19564
37 Ga0081539_10006485 3300005985 Bacteria 11200
38 Ga0081539_10193867 3300005985 Bacteria 944
39 Ga0075428_100004783 3300006844 Bacteria 15000
40 Ga0075428_100022609 3300006844 Bacteria 6961
41 Ga0075428_102233557 3300006844 Bacteria 564
42 Ga0075430_100628783 3300006846 Bacteria 885
43 Ga0075431_100003767 3300006847 Bacteria 14739
44 Ga0075431_101127309 3300006847 Bacteria 749
45 Ga0075433_10024641 3300006852 Bacteria 5081
46 Ga0075433_10323993 3300006852 Bacteria 1363
47 Ga0075434_100151801 3300006871 Bacteria 2337
48 Ga0075429_100011278 3300006880 Bacteria 7736
49 Ga0075429_100028742 3300006880 Bacteria 4829
50 Ga0075429_100054334 3300006880 Bacteria 3484
51 Ga0075429_100099389 3300006880 Bacteria 2539
52 Ga0075429_100295809 3300006880 Bacteria 1417
53 Ga0075429_100355795 3300006880 Bacteria 1282
54 Ga0075429_100362197 3300006880 Bacteria 1270
55 Ga0097620_100260127 3300006931 Bacteria 1827
56 Ga0111539_10024178 3300009094 Bacteria 7460
57 Ga0111539_10180946 3300009094 Bacteria 2462
58 Ga0111539_12064228 3300009094 Unclassified 661
59 Ga0114129_10002710 3300009147 Bacteria 24665
60 Ga0114129_10017603 3300009147 Bacteria 10172
61 Ga0114129_10031948 3300009147 Bacteria 7443
62 Ga0114129_10045348 3300009147 Bacteria 6181
63 Ga0114129_10078841 3300009147 Bacteria 4581
64 Ga0114129_10379310 3300009147 Bacteria 1868
65 Ga0114129_11148558 3300009147 Bacteria 970
66 Ga0114129_11158735 3300009147 Bacteria 965
67 Ga0114129_11256329 3300009147 Bacteria 920
68 Ga0114129_12995982 3300009147 Bacteria 555
69 Ga0105243_10541135 3300009148 Bacteria 1111
70 Ga0105241_10737007 3300009174 Bacteria 902
71 Ga0105237_10044262 3300009545 Bacteria 4482
72 Ga0105249_10212476 3300009553 Bacteria 1899
73 Ga0105249_10685603 3300009553 Bacteria 1084
74 Ga0105239_13346969 3300010375 Bacteria 522
75 Ga0105246_10214675 3300011119 Bacteria 1504
76 Ga0105246_11147900 3300011119 Bacteria 712
77 Ga0157380_10145162 3300014326 Bacteria 2044
78 Ga0157380_11412304 3300014326 Bacteria 747
79 Ga0157377_10643330 3300014745 Bacteria 762
80 Ga0157379_12087381 3300014968 Unclassified 561
81 Ga0182007_10236172 3300015262 Bacteria 651
82 Ga0206354_10441531 3300020081 Bacteria 571
83 Ga0207643_10045961 3300025908 Bacteria 2467
84 Ga0207684_10067344 3300025910 Bacteria 3043
85 Ga0207671_10074669 3300025914 Bacteria 2534
86 Ga0207662_10487955 3300025918 Unclassified 847
87 Ga0207646_10624796 3300025922 Bacteria 966
88 Ga0207646_10722052 3300025922 Bacteria 890
89 Ga0207706_11360527 3300025933 Bacteria 584
90 Ga0207709_10408656 3300025935 Bacteria 1040
91 Ga0207709_10478527 3300025935 Bacteria 968
92 Ga0207670_10028054 3300025936 Bacteria 3568
93 Ga0207712_10687380 3300025961 Bacteria 892
94 Ga0207708_10344878 3300026075 Bacteria 1221
95 Ga0207674_10142310 3300026116 Bacteria 2358
96 Ga0207675_100328948 3300026118 Bacteria 1493
97 Ga0207675_100391665 3300026118 Bacteria 1368
98 Ga0207428_10670670 3300027907 Bacteria 743
99 Ga0268265_10067892 3300028380 Bacteria 2762
100 Ga0268265_10095788 3300028380 Unclassified 2384
101 Ga0265323_10012122 3300028653 Unclassified 3463
102 Ga0265316_10767582 3300031344 Bacteria 677
103 Ga0265316_10962433 3300031344 Bacteria 595
104 Ga0307408_100449583 3300031548 Bacteria 1117
105 Ga0316575_10026570 3300031665 Bacteria 2250
106 Ga0316579_10142788 3300031691 Bacteria 1154
107 Ga0316579_10162121 3300031691 Unclassified 1080
108 Ga0316576_10106359 3300031727 Bacteria 2101
109 Ga0316576_10208546 3300031727 Bacteria 1471
110 Ga0316576_10378061 3300031727 Bacteria 1052
111 Ga0316576_10939926 3300031727 Bacteria 618
112 Ga0316578_10149760 3300031728 Bacteria 1406
113 Ga0316578_10611581 3300031728 Unclassified 638
114 Ga0307405_10472471 3300031731 Bacteria 999
115 Ga0316577_10003396 3300031733 Bacteria 8034
116 Ga0316577_10012751 3300031733 Unclassified 4583
117 Ga0316577_10039412 3300031733 Bacteria 2643
118 Ga0316577_10077368 3300031733 Unclassified 1858
119 Ga0316577_10443929 3300031733 Bacteria 737
120 Ga0316577_10489620 3300031733 Bacteria 699
121 Ga0307413_10744975 3300031824 Bacteria 818
122 Ga0307410_10916558 3300031852 Bacteria 751
123 Ga0307410_11087735 3300031852 Bacteria 693
124 Ga0307407_10252245 3300031903 Bacteria 1209
125 Ga0307412_10359227 3300031911 Bacteria 1172
126 Ga0307409_100444470 3300031995 Bacteria 1250
127 Ga0307409_100650753 3300031995 Bacteria 1048
128 Ga0307416_100357766 3300032002 Bacteria 1480
129 Ga0307416_102510205 3300032002 Bacteria 614
130 Ga0307415_100466107 3300032126 Bacteria 1096
131 Ga0307415_100902687 3300032126 Bacteria 815
132 Ga0316593_10061896 3300032168 Bacteria 1281
133 Ga0316593_10173843 3300032168 Unclassified 790
134 Ga0316592_1062769 3300033524 Bacteria 835
135 Ga0316592_1136079 3300033524 Bacteria 575
136 Ga0316588_1178715 3300033528 Bacteria 550
137 Ga0373949_0017281 3300035090 Bacteria 1625
138 Ga0373961_0076496 3300035241 Bacteria 1045
139 Ga0316574_0020625 3300035398 Unclassified 3902
140 Ga0316574_0544288 3300035398 Bacteria 721
141 Ga0316582_0125491 3300036647 Bacteria 1720
142 Ga0316582_0131772 3300036647 Bacteria 1680
143 Ga0316582_0189140 3300036647 Bacteria 1402
144 Ga0316582_0242824 3300036647 Bacteria 1234
145 Ga0316582_0707427 3300036647 Unclassified 692
146 Ga0316582_0831681 3300036647 Unclassified 632
147 Ga0316584_0030324 3300036712 Bacteria 3995
148 Ga0316584_0118845 3300036712 Unclassified 1976
149 Ga0316584_0140796 3300036712 Bacteria 1799
150 Ga0316584_0204357 3300036712 Bacteria 1456
151 Ga0373925_0699487 3300037068 Unclassified 836
152 Ga0395905_0007085 3300037471 Bacteria 11208
153 Ga0316581_0023882 3300037588 Bacteria 1810
154 Ga0242420_020376 3300038996 Bacteria 1180
155 Ga0436360_0566840 3300039438 Bacteria 3155
156 Ga0436362_1251345 3300039453 Bacteria 524
157 Ga0439439_0230428 3300041406 Bacteria 545
158 Ga0451577_0000216 3300042876 Bacteria 119613
159 Ga0451577_0109360 3300042876 Bacteria 2472
160 Ga0451577_0270044 3300042876 Bacteria 1540
161 Ga0451577_0437107 3300042876 Bacteria 1188
162 Ga0451577_0980171 3300042876 Bacteria 759
163 Ga0451577_1072677 3300042876 Bacteria 722
164 Ga0451577_1335173 3300042876 Unclassified 637
165 Ga0453683_0013294 3300044673 Bacteria 5379
166 Ga0453683_0131782 3300044673 Bacteria 1575
167 Ga0453683_0252703 3300044673 Bacteria 1124
168 Ga0453683_0430584 3300044673 Bacteria 852
169 Ga0453683_0804917 3300044673 Bacteria 619
170 Ga0453684_0001076 3300044712 Bacteria 86924
171 Ga0453684_0002161 3300044712 Bacteria 49180
172 Ga0453684_0006496 3300044712 Bacteria 22177
173 Ga0453684_0011274 3300044712 Bacteria 15038
174 Ga0453684_0013080 3300044712 Bacteria 13551
175 Ga0453684_0029003 3300044712 Bacteria 7874
176 Ga0453684_0035054 3300044712 Bacteria 6947
177 Ga0453684_0048493 3300044712 Bacteria 5615
178 Ga0453684_0057639 3300044712 Bacteria 5025
179 Ga0453684_0093354 3300044712 Bacteria 3707
180 Ga0453684_0130913 3300044712 Bacteria 3010
181 Ga0453684_0175549 3300044712 Bacteria 2520
182 Ga0453684_0242466 3300044712 Bacteria 2074
183 Ga0453684_0251943 3300044712 Bacteria 2027
184 Ga0453684_0266912 3300044712 Bacteria 1958
185 Ga0453684_0286502 3300044712 Bacteria 1877
186 Ga0453684_0319714 3300044712 Bacteria 1758
187 Ga0453684_0369289 3300044712 Unclassified 1613
188 Ga0453684_1150576 3300044712 Unclassified 817
189 Ga0453684_2219595 3300044712 Bacteria 548
190 Ga0453684_2576661 3300044712 Bacteria 500
191 Ga0451576_0000317 3300045051 Bacteria 116977
192 Ga0451576_0091748 3300045051 Bacteria 3159
193 Ga0451576_0112230 3300045051 Bacteria 2837
194 Ga0451576_0360497 3300045051 Bacteria 1522
195 Ga0451576_1079605 3300045051 Bacteria 840
196 Ga0451576_1152570 3300045051 Bacteria 810
197 Ga0451576_1402732 3300045051 Bacteria 727
198 Ga0451576_1621245 3300045051 Bacteria 671
199 Ga0451576_1707125 3300045051 Bacteria 652
200 Ga0501290_058041 3300049513 Bacteria 618
201 Ga0501292_106994 3300049515 Bacteria 559
202 Ga0501031_0904696 3300049568 Bacteria 565
203 Ga0501036_0982900 3300049572 Bacteria 691
204 Ga0501038_0373769 3300049574 Bacteria 1107
205 Ga0501039_0474818 3300049575 Bacteria 982
206 Ga0501040_0325336 3300049576 Bacteria 1100
207 Ga0501040_0986068 3300049576 Bacteria 611
208 Ga0501041_0223258 3300049577 Bacteria 1182
209 Ga0501042_0817096 3300049578 Bacteria 678
210 Ga0501042_0904263 3300049578 Bacteria 643
211 Ga0501043_1146925 3300049579 Bacteria 548
212 Ga0501046_0072358 3300049580 Bacteria 2677
213 Ga0501048_0223227 3300049582 Bacteria 1337
214 Ga0501048_0827542 3300049582 Bacteria 665
215 Ga0501068_0586671 3300049584 Bacteria 726
216 Ga0501069_0552825 3300049585 Bacteria 689
217 Ga0501071_0138008 3300049587 Bacteria 1815
218 Ga0501072_0245669 3300049588 Bacteria 1426
219 Ga0501074_0042809 3300049590 Bacteria 3276
220 Ga0501075_0296002 3300049591 Bacteria 1233
221 Ga0501075_0548185 3300049591 Bacteria 883
222 Ga0501075_0764629 3300049591 Unclassified 735
223 Ga0501075_0766128 3300049591 Bacteria 735
224 Ga0501075_1076755 3300049591 Bacteria 610
225 Ga0501076_0016433 3300049592 Bacteria 5611
226 Ga0501076_0177236 3300049592 Bacteria 1737
227 Ga0501076_0299162 3300049592 Bacteria 1319
228 Ga0501076_0487644 3300049592 Bacteria 1016
229 Ga0501076_0524086 3300049592 Bacteria 977
230 Ga0501076_0908979 3300049592 Bacteria 726
231 Ga0501242_087243 3300049674 Unclassified 508
232 Ga0501079_0461166 3300049741 Bacteria 998
233 Ga0501079_0537102 3300049741 Bacteria 919
234 Ga0501079_1393694 3300049741 Bacteria 552
235 Ga0501079_1595346 3300049741 Bacteria 513
236 Ga0501081_0146336 3300049743 Bacteria 1696
237 Ga0501081_1205972 3300049743 Unclassified 573
238 Ga0501283_086106 3300049779 Unclassified 597
239 Ga0501045_0282448 3300049824 Bacteria 1236
240 Ga0501045_0809496 3300049824 Bacteria 690
241 Ga0501045_1076231 3300049824 Bacteria 588
242 nmdc:mga05p37_100874_c1 3300050507 Bacteria 3556
243 nmdc:mga05p37_44854_c1 3300050507 Bacteria 5439
244 nmdc:mga05p37_4654_c1 3300050507 Bacteria 16043
245 nmdc:mga05p37_5158_c1 3300050507 Bacteria 15309
246 nmdc:mga05p37_9621_c1 3300050507 Bacteria 11450
247 nmdc:mga05p37_977230_c1 3300050507 Unclassified 903
248 nmdc:mga09592_1025903_c1 3300050508 Unclassified 689
249 nmdc:mga09592_1218008_c1 3300050508 Unclassified 622
250 nmdc:mga09592_263346_c1 3300050508 Bacteria 1495
251 nmdc:mga09592_275643_c1 3300050508 Bacteria 1459
252 nmdc:mga09592_316220_c1 3300050508 Bacteria 1353
253 nmdc:mga09592_44017_c1 3300050508 Bacteria 3756
254 nmdc:mga09592_54275_c2 3300050508 Bacteria 2236
255 nmdc:mga09592_781719_c1 3300050508 Bacteria 808
256 nmdc:mga09592_9964_c1 3300050508 Bacteria 7731
257 nmdc:mga0qj67_585909_c1 3300050509 Unclassified 893
258 nmdc:mga0qj67_666937_c1 3300050509 Bacteria 829
259 nmdc:mga06r32_1384927_c1 3300050510 Unclassified 645
260 nmdc:mga06r32_34681_c1 3300050510 Bacteria 4759
261 nmdc:mga06r32_736286_c1 3300050510 Bacteria 950
262 nmdc:mga08y16_1540897_c1 3300050511 Bacteria 624
263 nmdc:mga0n895_657019_c1 3300050512 Bacteria 1047
264 nmdc:mga0a205_131677_c1 3300050515 Bacteria 2401
265 nmdc:mga0a205_424505_c1 3300050515 Bacteria 1191
266 nmdc:mga0a205_425312_c1 3300050515 Bacteria 1190
267 Ga0501084_0028743 3300054114 Bacteria 4649
268 Ga0501084_0540108 3300054114 Bacteria 985
269 Ga0501084_1039563 3300054114 Bacteria 688
270 Ga0501084_1284342 3300054114 Bacteria 614
271 Ga0501082_1675096 3300060353 Bacteria 555
272 JGI25406J46586_10003952
273 SwRhRL2b_contig_192538
274 SwRhRL2b_contig_3816391
275 Ga0065707_10082110
276 Ga0070692_10316311
277 Ga0070668_101057130
278 Ga0070703_10102086
279 Ga0070701_11174968
280 Ga0070705_101897449
281 Ga0070700_100311957
282 Ga0070700_101021815
283 Ga0070694_100712485
284 Ga0070706_100100349
285 Ga0070707_100195189
286 Ga0070707_100201225
287 Ga0070707_100353193
288 Ga0070698_100033151
289 Ga0070698_100132224
290 Ga0070698_100134679
291 Ga0070699_100002160
292 Ga0070699_100041215
293 Ga0070679_101643922
294 Ga0070697_100469473
295 Ga0070672_101425733
296 Ga0070695_100432805
297 Ga0070704_100742066
298 Ga0070704_101132288
299 Ga0068859_100260123
300 Ga0068861_100459548
301 Ga0068861_102708683
302 Ga0068870_10271706
303 Ga0068870_10373561
304 Ga0068862_100055728
305 Ga0068862_100297231
306 Ga0068862_100606463
307 Ga0081539_10003413
308 Ga0081539_10006485
309 Ga0081539_10193867
310 Ga0075428_100004783
311 Ga0075428_100022609
312 Ga0075428_102233557
313 Ga0075430_100628783
314 Ga0075431_100003767
315 Ga0075431_101127309
316 Ga0075433_10024641
317 Ga0075433_10323993
318 Ga0075434_100151801
319 Ga0075429_100011278
320 Ga0075429_100028742
321 Ga0075429_100054334
322 Ga0075429_100099389
323 Ga0075429_100295809
324 Ga0075429_100355795
325 Ga0075429_100362197
326 Ga0097620_100260127
327 Ga0111539_10024178
328 Ga0111539_10180946
329 Ga0111539_12064228
330 Ga0114129_10002710
331 Ga0114129_10017603
332 Ga0114129_10031948
333 Ga0114129_10045348
334 Ga0114129_10078841
335 Ga0114129_10379310
336 Ga0114129_11148558
337 Ga0114129_11158735
338 Ga0114129_11256329
339 Ga0114129_12995982
340 Ga0105243_10541135
341 Ga0105241_10737007
342 Ga0105237_10044262
343 Ga0105249_10212476
344 Ga0105249_10685603
345 Ga0105239_13346969
346 Ga0105246_10214675
347 Ga0105246_11147900
348 Ga0157380_10145162
349 Ga0157380_11412304
350 Ga0157377_10643330
351 Ga0157379_12087381
352 Ga0182007_10236172
353 Ga0206354_10441531
354 Ga0207643_10045961
355 Ga0207684_10067344
356 Ga0207671_10074669
357 Ga0207662_10487955
358 Ga0207646_10624796
359 Ga0207646_10722052
360 Ga0207706_11360527
361 Ga0207709_10408656
362 Ga0207709_10478527
363 Ga0207670_10028054
364 Ga0207712_10687380
365 Ga0207708_10344878
366 Ga0207674_10142310
367 Ga0207675_100328948
368 Ga0207675_100391665
369 Ga0207428_10670670
370 Ga0268265_10067892
371 Ga0268265_10095788
372 Ga0265323_10012122
373 Ga0265316_10767582
374 Ga0265316_10962433
375 Ga0307408_100449583
376 Ga0316575_10026570
377 Ga0316579_10142788
378 Ga0316579_10162121
379 Ga0316576_10106359
380 Ga0316576_10208546
381 Ga0316576_10378061
382 Ga0316576_10939926
383 Ga0316578_10149760
384 Ga0316578_10611581
385 Ga0307405_10472471
386 Ga0316577_10003396
387 Ga0316577_10012751
388 Ga0316577_10039412
389 Ga0316577_10077368
390 Ga0316577_10443929
391 Ga0316577_10489620
392 Ga0307413_10744975
393 Ga0307410_10916558
394 Ga0307410_11087735
395 Ga0307407_10252245
396 Ga0307412_10359227
397 Ga0307409_100444470
398 Ga0307409_100650753
399 Ga0307416_100357766
400 Ga0307416_102510205
401 Ga0307415_100466107
402 Ga0307415_100902687
403 Ga0316593_10061896
404 Ga0316593_10173843
405 Ga0316592_1062769
406 Ga0316592_1136079
407 Ga0316588_1178715
408 Ga0373949_0017281
409 Ga0373961_0076496
410 Ga0316574_0020625
411 Ga0316574_0544288
412 Ga0316582_0125491
413 Ga0316582_0131772
414 Ga0316582_0189140
415 Ga0316582_0242824
416 Ga0316582_0707427
417 Ga0316582_0831681
418 Ga0316584_0030324
419 Ga0316584_0118845
420 Ga0316584_0140796
421 Ga0316584_0204357
422 Ga0373925_0699487
423 Ga0395905_0007085
424 Ga0316581_0023882
425 Ga0242420_020376
426 Ga0436360_0566840
427 Ga0436362_1251345
428 Ga0439439_0230428
429 Ga0451577_0000216
430 Ga0451577_0109360
431 Ga0451577_0270044
432 Ga0451577_0437107
433 Ga0451577_0980171
434 Ga0451577_1072677
435 Ga0451577_1335173
436 Ga0453683_0013294
437 Ga0453683_0131782
438 Ga0453683_0252703
439 Ga0453683_0430584
440 Ga0453683_0804917
441 Ga0453684_0001076
442 Ga0453684_0002161
443 Ga0453684_0006496
444 Ga0453684_0011274
445 Ga0453684_0013080
446 Ga0453684_0029003
447 Ga0453684_0035054
448 Ga0453684_0048493
449 Ga0453684_0057639
450 Ga0453684_0093354
451 Ga0453684_0130913
452 Ga0453684_0175549
453 Ga0453684_0242466
454 Ga0453684_0251943
455 Ga0453684_0266912
456 Ga0453684_0286502
457 Ga0453684_0319714
458 Ga0453684_0369289
459 Ga0453684_1150576
460 Ga0453684_2219595
461 Ga0453684_2576661
462 Ga0451576_0000317
463 Ga0451576_0091748
464 Ga0451576_0112230
465 Ga0451576_0360497
466 Ga0451576_1079605
467 Ga0451576_1152570
468 Ga0451576_1402732
469 Ga0451576_1621245
470 Ga0451576_1707125
471 Ga0501290_058041
472 Ga0501292_106994
473 Ga0501031_0904696
474 Ga0501036_0982900
475 Ga0501038_0373769
476 Ga0501039_0474818
477 Ga0501040_0325336
478 Ga0501040_0986068
479 Ga0501041_0223258
480 Ga0501042_0817096
481 Ga0501042_0904263
482 Ga0501043_1146925
483 Ga0501046_0072358
484 Ga0501048_0223227
485 Ga0501048_0827542
486 Ga0501068_0586671
487 Ga0501069_0552825
488 Ga0501071_0138008
489 Ga0501072_0245669
490 Ga0501074_0042809
491 Ga0501075_0296002
492 Ga0501075_0548185
493 Ga0501075_0764629
494 Ga0501075_0766128
495 Ga0501075_1076755
496 Ga0501076_0016433
497 Ga0501076_0177236
498 Ga0501076_0299162
499 Ga0501076_0487644
500 Ga0501076_0524086
501 Ga0501076_0908979
502 Ga0501242_087243
503 Ga0501079_0461166
504 Ga0501079_0537102
505 Ga0501079_1393694
506 Ga0501079_1595346
507 Ga0501081_0146336
508 Ga0501081_1205972
509 Ga0501283_086106
510 Ga0501045_0282448
511 Ga0501045_0809496
512 Ga0501045_1076231
513 nmdc:mga05p37_100874_c1
514 nmdc:mga05p37_44854_c1
515 nmdc:mga05p37_4654_c1
516 nmdc:mga05p37_5158_c1
517 nmdc:mga05p37_9621_c1
518 nmdc:mga05p37_977230_c1
519 nmdc:mga09592_1025903_c1
520 nmdc:mga09592_1218008_c1
521 nmdc:mga09592_263346_c1
522 nmdc:mga09592_275643_c1
523 nmdc:mga09592_316220_c1
524 nmdc:mga09592_44017_c1
525 nmdc:mga09592_54275_c2
526 nmdc:mga09592_781719_c1
527 nmdc:mga09592_9964_c1
528 nmdc:mga0qj67_585909_c1
529 nmdc:mga0qj67_666937_c1
530 nmdc:mga06r32_1384927_c1
531 nmdc:mga06r32_34681_c1
532 nmdc:mga06r32_736286_c1
533 nmdc:mga08y16_1540897_c1
534 nmdc:mga0n895_657019_c1
535 nmdc:mga0a205_131677_c1
536 nmdc:mga0a205_424505_c1
537 nmdc:mga0a205_425312_c1
538 Ga0501084_0028743
539 Ga0501084_0540108
540 Ga0501084_1039563
541 Ga0501084_1284342
542 Ga0501082_1675096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

10

131

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8k-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 2) 0.9586 4 113
8d8l-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 3) 0.9579 4 113
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9526 5 102
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9503 3 108
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9416 3 108
ID Description Score Start End Superfamily
af_Q4DEW9_314_445_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9111 12 109 3.30.230.10
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8899 5 122 3.30.230.10
af_P34388_249_392_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8788 3 116 3.30.230.10
af_Q7XAM9_269_415_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8456 4 130 3.30.230.10
af_O94150_208_336_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8429 4 130 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A1F8TT01-F1-model_v4 30S ribosomal protein S9 1.002 2 106 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A3B9KM30-F1-model_v4 30S ribosomal protein S9 0.9872 1 94 GO:0003723
GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A660YEQ7-F1-model_v4 30S ribosomal protein S9 0.9841 1 108 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A7K3KQE2-F1-model_v4 30S ribosomal protein S9 0.9802 1 94 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A7S3Z5Y3-F1-model_v4 30S ribosomal protein S9, chloroplastic 0.9779 4 109 GO:0003723
GO:0003735
GO:0006412
GO:0015935

Map