F377138

General Info

Members Datasets Scaffolds Average Seq Length
270 168 540 287

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0065446|Ga0466959_0065446_186_1052
Length 288
Sequence VIERQSFGRTGHDSTRTIFGAAALMYEHVTQADADATLELLLRYGVNHIDTAASYGDSELRLAPWLADRRDDFFLATKTGERTKRRAQDEIRRSLERLGTDRVDLIQLHNLVARDEWETAFDDGGALEAAIDARAEGLVRFIGVTGHGLDVARRHIESLERFDFDSVLFPYNYAQLLDDAYAADVEELIALCEQRGVAMQTIKSLSKGRWRSVEHHSDPWYEPITDPNAIADAVAWTLARPGLFLNTVSDLGLLPHVLEAATHAGAAPSEERMRELGTQPLFDAANPA

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
98 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
99 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
100 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
112 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
113 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
117 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 2.22
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.59
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0065446 3300045049 Bacteria 2638
2 JGI25406J46586_10019576 3300003203 Bacteria 2753
3 JGI25406J46586_10048476 3300003203 Bacteria 1440
4 Ga0070689_100128575 3300005340 Bacteria 2030
5 Ga0070674_100069218 3300005356 Bacteria 2489
6 Ga0070688_100112234 3300005365 Bacteria 1814
7 Ga0070667_100243625 3300005367 Bacteria 1606
8 Ga0070714_100091317 3300005435 Bacteria 2668
9 Ga0070700_100067614 3300005441 Bacteria 2270
10 Ga0070678_100005095 3300005456 Bacteria 7542
11 Ga0070678_100132798 3300005456 Bacteria 1981
12 Ga0068867_100201071 3300005459 Unclassified 1595
13 Ga0068867_100331440 3300005459 Bacteria 1264
14 Ga0070684_100240530 3300005535 Bacteria 1654
15 Ga0070684_100299321 3300005535 Bacteria 1476
16 Ga0070665_100113922 3300005548 Bacteria 2707
17 Ga0068854_100488325 3300005578 Bacteria 1035
18 Ga0070702_100016648 3300005615 Bacteria 3776
19 Ga0070702_100045856 3300005615 Bacteria 2475
20 Ga0068866_10204532 3300005718 Bacteria 1182
21 Ga0068861_100025388 3300005719 Bacteria 4296
22 Ga0068870_10120791 3300005840 Bacteria 1509
23 Ga0068858_100513061 3300005842 Bacteria 1159
24 Ga0068858_100604605 3300005842 Unclassified 1064
25 Ga0068860_100075725 3300005843 Bacteria 3201
26 Ga0068860_100109820 3300005843 Bacteria 2636
27 Ga0068860_100297452 3300005843 Bacteria 1580
28 Ga0068862_100594171 3300005844 Bacteria 1062
29 Ga0081455_10002399 3300005937 Bacteria 22364
30 Ga0081455_10004570 3300005937 Bacteria 15456
31 Ga0081455_10006076 3300005937 Bacteria 13070
32 Ga0081455_10121942 3300005937 Bacteria 2053
33 Ga0081539_10000111 3300005985 Bacteria 190245
34 Ga0081539_10002079 3300005985 Bacteria 29947
35 Ga0075432_10000223 3300006058 Bacteria 15124
36 Ga0075432_10007673 3300006058 Bacteria 3678
37 Ga0070715_10136033 3300006163 Bacteria 1188
38 Ga0075428_100133986 3300006844 Bacteria 2694
39 Ga0075431_100119382 3300006847 Bacteria 2721
40 Ga0075433_10024534 3300006852 Bacteria 5091
41 Ga0075433_10040866 3300006852 Bacteria 4016
42 Ga0075433_10139137 3300006852 Bacteria 2158
43 Ga0075434_100073457 3300006871 Bacteria 3412
44 Ga0075434_100083033 3300006871 Bacteria 3201
45 Ga0075434_100156803 3300006871 Bacteria 2296
46 Ga0075436_100049266 3300006914 Bacteria 2906
47 Ga0075435_100000271 3300007076 Bacteria 32231
48 Ga0075435_100032068 3300007076 Bacteria 4147
49 Ga0111539_10001308 3300009094 Bacteria 33281
50 Ga0111539_10055656 3300009094 Bacteria 4703
51 Ga0105245_10031968 3300009098 Bacteria 4659
52 Ga0105245_10152690 3300009098 Bacteria 2185
53 Ga0105245_10948258 3300009098 Bacteria 903
54 Ga0105247_10093604 3300009101 Bacteria 1910
55 Ga0114129_10153371 3300009147 Bacteria 3152
56 Ga0114129_10710416 3300009147 Bacteria 1291
57 Ga0105243_10031088 3300009148 Bacteria 4116
58 Ga0105243_10119174 3300009148 Bacteria 2222
59 Ga0105242_10006573 3300009176 Bacteria 8953
60 Ga0105242_10272279 3300009176 Bacteria 1534
61 Ga0105242_10359653 3300009176 Bacteria 1347
62 Ga0105248_10009236 3300009177 Bacteria 10847
63 Ga0105248_10778048 3300009177 Unclassified 1080
64 Ga0105238_10470180 3300009551 Unclassified 1256
65 Ga0105249_10015353 3300009553 Bacteria 6778
66 Ga0105249_10059413 3300009553 Bacteria 3506
67 Ga0105239_10020681 3300010375 Bacteria 7261
68 Ga0105246_10200460 3300011119 Bacteria 1551
69 Ga0157378_10006561 3300013297 Bacteria 10164
70 Ga0163162_10114814 3300013306 Bacteria 2792
71 Ga0163162_10186468 3300013306 Bacteria 2202
72 Ga0163162_10727280 3300013306 Bacteria 1113
73 Ga0157372_10154660 3300013307 Bacteria 2649
74 Ga0163163_10020321 3300014325 Bacteria 6251
75 Ga0157380_10040347 3300014326 Bacteria 3635
76 Ga0157380_10041197 3300014326 Bacteria 3602
77 Ga0157376_10027922 3300014969 Bacteria 4480
78 Ga0157376_10029712 3300014969 Bacteria 4356
79 Ga0197907_10537467 3300020069 Bacteria 1257
80 Ga0206350_10022915 3300020080 Bacteria 1021
81 Ga0206350_10511498 3300020080 Bacteria 1338
82 Ga0224712_10092080 3300022467 Bacteria 1272
83 Ga0207688_10005728 3300025901 Bacteria 6760
84 Ga0207688_10061157 3300025901 Bacteria 2122
85 Ga0207699_10085859 3300025906 Bacteria 1964
86 Ga0207643_10106723 3300025908 Bacteria 1646
87 Ga0207694_10454416 3300025924 Unclassified 1069
88 Ga0207706_10007054 3300025933 Bacteria 10388
89 Ga0207686_10018257 3300025934 Bacteria 3969
90 Ga0207686_10193049 3300025934 Bacteria 1453
91 Ga0207709_10041153 3300025935 Bacteria 2772
92 Ga0207709_10491859 3300025935 Bacteria 956
93 Ga0207704_10050207 3300025938 Bacteria 2515
94 Ga0207704_10123810 3300025938 Unclassified 1775
95 Ga0207665_10193126 3300025939 Bacteria 1480
96 Ga0207711_10099993 3300025941 Bacteria 2565
97 Ga0207661_10082459 3300025944 Bacteria 2659
98 Ga0207668_10345774 3300025972 Bacteria 1242
99 Ga0207668_10550458 3300025972 Unclassified 999
100 Ga0207658_10044170 3300025986 Bacteria 3244
101 Ga0207703_10052736 3300026035 Bacteria 3304
102 Ga0207703_10401085 3300026035 Bacteria 1272
103 Ga0207639_10168238 3300026041 Unclassified 1854
104 Ga0207678_10262937 3300026067 Bacteria 1479
105 Ga0207708_10102527 3300026075 Bacteria 2215
106 Ga0207648_10383851 3300026089 Bacteria 1270
107 Ga0207675_100015657 3300026118 Bacteria 7072
108 Ga0207675_100206159 3300026118 Bacteria 1889
109 Ga0207683_10001727 3300026121 Bacteria 19485
110 Ga0207698_10097700 3300026142 Bacteria 2424
111 Ga0207428_10001129 3300027907 Bacteria 28965
112 Ga0207428_10004315 3300027907 Bacteria 13578
113 Ga0268265_10396921 3300028380 Bacteria 1274
114 Ga0268264_10089325 3300028381 Bacteria 2653
115 Ga0265336_10045919 3300028666 Bacteria 1328
116 Ga0265330_10026728 3300031235 Bacteria 2609
117 Ga0265330_10067759 3300031235 Bacteria 1546
118 Ga0265340_10064614 3300031247 Bacteria 1744
119 Ga0265331_10091481 3300031250 Bacteria 1405
120 Ga0265316_10023532 3300031344 Bacteria 5173
121 Ga0307408_100235375 3300031548 Unclassified 1502
122 Ga0316575_10006605 3300031665 Unclassified 4179
123 Ga0316575_10071781 3300031665 Bacteria 1391
124 Ga0316579_10000732 3300031691 Bacteria 11252
125 Ga0316579_10001662 3300031691 Bacteria 8159
126 Ga0265314_10006192 3300031711 Bacteria 10623
127 Ga0316576_10008398 3300031727 Bacteria 6582
128 Ga0316576_10013989 3300031727 Bacteria 5351
129 Ga0316576_10121942 3300031727 Unclassified 1958
130 Ga0316576_10137806 3300031727 Unclassified 1836
131 Ga0316576_10170217 3300031727 Bacteria 1644
132 Ga0316578_10001885 3300031728 Bacteria 8850
133 Ga0316578_10002255 3300031728 Bacteria 8348
134 Ga0316578_10014690 3300031728 Unclassified 4190
135 Ga0307405_10039776 3300031731 Bacteria 2844
136 Ga0307405_10285464 3300031731 Bacteria 1245
137 Ga0316577_10001081 3300031733 Bacteria 12327
138 Ga0316577_10002286 3300031733 Bacteria 9442
139 Ga0307410_10163185 3300031852 Bacteria 1672
140 Ga0307406_10056285 3300031901 Bacteria 2517
141 Ga0307406_10236067 3300031901 Bacteria 1368
142 Ga0307407_10001942 3300031903 Bacteria 7832
143 Ga0307412_10047428 3300031911 Bacteria 2822
144 Ga0307409_100000340 3300031995 Bacteria 19383
145 Ga0307409_100007453 3300031995 Bacteria 6546
146 Ga0307409_100273106 3300031995 Bacteria 1558
147 Ga0307416_100072027 3300032002 Unclassified 2874
148 Ga0307416_100143427 3300032002 Unclassified 2175
149 Ga0307414_10004144 3300032004 Bacteria 7827
150 Ga0307414_10079919 3300032004 Bacteria 2389
151 Ga0307414_10193165 3300032004 Bacteria 1649
152 Ga0307411_10014563 3300032005 Bacteria 4381
153 Ga0307415_100000801 3300032126 Bacteria 14293
154 Ga0307415_100112829 3300032126 Unclassified 2020
155 Ga0316583_10013647 3300032133 Unclassified 2932
156 Ga0316585_10000302 3300032137 Bacteria 10982
157 Ga0316580_10084447 3300032139 Bacteria 971
158 Ga0316596_1000419 3300033541 Bacteria 7085
159 Ga0316596_1069213 3300033541 Unclassified 945
160 Ga0373943_0023186 3300035170 Bacteria 2884
161 Ga0373955_0307104 3300035172 Bacteria 957
162 Ga0316574_0009994 3300035398 Bacteria 5338
163 Ga0373947_0034817 3300035725 Bacteria 2979
164 Ga0316582_0000579 3300036647 Bacteria 14143
165 Ga0316582_0007735 3300036647 Bacteria 5740
166 Ga0316582_0302998 3300036647 Unclassified 1098
167 Ga0316584_0000543 3300036712 Bacteria 20235
168 Ga0316584_0004510 3300036712 Bacteria 9216
169 Ga0316584_0047231 3300036712 Bacteria 3216
170 Ga0316584_0076513 3300036712 Bacteria 2508
171 Ga0316584_0185012 3300036712 Unclassified 1541
172 Ga0316584_0276199 3300036712 Unclassified 1222
173 Ga0373925_0266831 3300037068 Bacteria 1376
174 Ga0395898_0041939 3300037466 Bacteria 4518
175 Ga0395898_0436994 3300037466 Bacteria 1247
176 Ga0316581_0000021 3300037588 Bacteria 16014
177 Ga0395901_0008618 3300038443 Bacteria 10305
178 Ga0395901_0652916 3300038443 Bacteria 1055
179 Ga0400490_34255 3300038726 Bacteria 3459
180 Ga0400483_022913 3300039062 Unclassified 3451
181 Ga0400489_20985 3300039093 Bacteria 1649
182 Ga0451791_0166916 3300041451 Unclassified 1220
183 Ga0451791_0325780 3300041451 Bacteria 3893
184 Ga0451793_0047331 3300041452 Bacteria 3857
185 Ga0451797_1245007 3300041453 Bacteria 1564
186 Ga0451802_0878280 3300041460 Bacteria 2571
187 Ga0451837_1172012 3300041494 Unclassified 1004
188 Ga0451853_0272448 3300041512 Bacteria 3605
189 Ga0439448_0001508 3300042005 Bacteria 6064
190 Ga0439448_0068717 3300042005 Bacteria 1178
191 Ga0439463_006347 3300042016 Bacteria 2933
192 Ga0439463_007413 3300042016 Bacteria 2709
193 Ga0439459_0009909 3300042438 Bacteria 1652
194 Ga0439440_0000935 3300042993 Bacteria 5119
195 Ga0439440_0035504 3300042993 Bacteria 1196
196 Ga0466972_0044178 3300044658 Bacteria 2162
197 Ga0466965_0041956 3300044683 Bacteria 2255
198 Ga0466963_0011924 3300044694 Bacteria 5308
199 Ga0466963_0116953 3300044694 Bacteria 1833
200 Ga0466963_0190768 3300044694 Bacteria 1432
201 Ga0466963_0235812 3300044694 Bacteria 1283
202 Ga0466968_0215482 3300044735 Bacteria 903
203 Ga0466970_0099959 3300044765 Bacteria 1579
204 Ga0466957_0085798 3300044842 Bacteria 1967
205 Ga0466957_0354454 3300044842 Bacteria 996
206 Ga0451576_0456592 3300045051 Bacteria 1341
207 Ga0466958_0007170 3300045836 Bacteria 6112
208 Ga0466958_0270254 3300045836 Unclassified 1089
209 Ga0466967_0039319 3300045976 Bacteria 4065
210 Ga0466967_0067983 3300045976 Bacteria 3180
211 Ga0466967_0081277 3300045976 Bacteria 2927
212 Ga0495603_0032358 3300046455 Bacteria 3147
213 Ga0495603_0050413 3300046455 Bacteria 2475
214 Ga0495651_0025177 3300046462 Bacteria 4631
215 Ga0495653_0047950 3300046463 Bacteria 3301
216 Ga0495582_0118288 3300046473 Bacteria 1492
217 Ga0495608_0299970 3300046511 Unclassified 995
218 Ga0495674_0171578 3300047319 Bacteria 1810
219 Ga0495676_0021821 3300047321 Bacteria 5584
220 Ga0495680_0169740 3300047322 Bacteria 1580
221 Ga0496100_0007330 3300048903 Bacteria 6076
222 Ga0496100_0014637 3300048903 Bacteria 4559
223 Ga0496100_0289040 3300048903 Bacteria 1224
224 Ga0496101_0004427 3300048904 Bacteria 8838
225 Ga0496101_0010931 3300048904 Bacteria 6009
226 Ga0496101_0175094 3300048904 Bacteria 1650
227 Ga0496102_0008416 3300048905 Bacteria 8840
228 Ga0496104_0429190 3300048907 Bacteria 1233
229 Ga0496106_0013460 3300048909 Bacteria 6038
230 Ga0496106_0014308 3300048909 Bacteria 5863
231 Ga0496107_0005985 3300048910 Bacteria 8337
232 Ga0496107_0018281 3300048910 Bacteria 4934
233 Ga0496108_0002735 3300048911 Bacteria 14104
234 Ga0496108_0063611 3300048911 Bacteria 3107
235 Ga0496108_0266814 3300048911 Bacteria 1490
236 Ga0496109_0020703 3300048912 Bacteria 5809
237 Ga0496109_0044042 3300048912 Bacteria 4047
238 Ga0496109_0185161 3300048912 Bacteria 1957
239 Ga0496109_0570841 3300048912 Bacteria 1066
240 Ga0496110_0008539 3300048913 Bacteria 8247
241 Ga0496110_0030070 3300048913 Bacteria 4680
242 Ga0496111_0272369 3300048914 Bacteria 1256
243 Ga0496111_0441304 3300048914 Bacteria 961
244 Ga0496112_0475202 3300048915 Unclassified 1187
245 Ga0496114_0008964 3300048917 Bacteria 7932
246 Ga0496114_0014167 3300048917 Bacteria 6395
247 Ga0496114_0142774 3300048917 Bacteria 2074
248 Ga0496115_0061329 3300048918 Bacteria 3032
249 Ga0496115_0145507 3300048918 Bacteria 1956
250 Ga0501034_0026939 3300049571 Bacteria 5848
251 Ga0501034_0264805 3300049571 Bacteria 1661
252 Ga0501067_0034904 3300049583 Bacteria 2791
253 Ga0501069_0011378 3300049585 Bacteria 4718
254 nmdc:mga05p37_181670_c1 3300050507 Bacteria 2559
255 nmdc:mga09592_34495_c1 3300050508 Bacteria 4230
256 nmdc:mga09592_591479_c1 3300050508 Bacteria 951
257 nmdc:mga06r32_521585_c1 3300050510 Bacteria 1164
258 nmdc:mga08y16_2233_c1 3300050511 Bacteria 19854
259 nmdc:mga0n895_1523_c1 3300050512 Bacteria 17402
260 nmdc:mga0n895_68440_c1 3300050512 Bacteria 3517
261 nmdc:mga0rr50_23067_c1 3300050513 Bacteria 4284
262 nmdc:mga08x19_1651_c1 3300050514 Bacteria 13775
263 nmdc:mga0a205_114080_c1 3300050515 Bacteria 2601
264 nmdc:mga0a205_1272_c1 3300050515 Bacteria 21228
265 nmdc:mga0a205_168582_c1 3300050515 Bacteria 1621
266 Ga0495601_0004593 3300053077 Bacteria 7990
267 Ga0495619_0032646 3300053085 Bacteria 3378
268 Ga0495619_0331235 3300053085 Bacteria 1054
269 Ga0466962_0062927 3300061719 Bacteria 1772
270 2883824756 2883821847 Bacteria 5121194
271 Ga0466959_0065446
272 JGI25406J46586_10019576
273 JGI25406J46586_10048476
274 Ga0070689_100128575
275 Ga0070674_100069218
276 Ga0070688_100112234
277 Ga0070667_100243625
278 Ga0070714_100091317
279 Ga0070700_100067614
280 Ga0070678_100005095
281 Ga0070678_100132798
282 Ga0068867_100201071
283 Ga0068867_100331440
284 Ga0070684_100240530
285 Ga0070684_100299321
286 Ga0070665_100113922
287 Ga0068854_100488325
288 Ga0070702_100016648
289 Ga0070702_100045856
290 Ga0068866_10204532
291 Ga0068861_100025388
292 Ga0068870_10120791
293 Ga0068858_100513061
294 Ga0068858_100604605
295 Ga0068860_100075725
296 Ga0068860_100109820
297 Ga0068860_100297452
298 Ga0068862_100594171
299 Ga0081455_10002399
300 Ga0081455_10004570
301 Ga0081455_10006076
302 Ga0081455_10121942
303 Ga0081539_10000111
304 Ga0081539_10002079
305 Ga0075432_10000223
306 Ga0075432_10007673
307 Ga0070715_10136033
308 Ga0075428_100133986
309 Ga0075431_100119382
310 Ga0075433_10024534
311 Ga0075433_10040866
312 Ga0075433_10139137
313 Ga0075434_100073457
314 Ga0075434_100083033
315 Ga0075434_100156803
316 Ga0075436_100049266
317 Ga0075435_100000271
318 Ga0075435_100032068
319 Ga0111539_10001308
320 Ga0111539_10055656
321 Ga0105245_10031968
322 Ga0105245_10152690
323 Ga0105245_10948258
324 Ga0105247_10093604
325 Ga0114129_10153371
326 Ga0114129_10710416
327 Ga0105243_10031088
328 Ga0105243_10119174
329 Ga0105242_10006573
330 Ga0105242_10272279
331 Ga0105242_10359653
332 Ga0105248_10009236
333 Ga0105248_10778048
334 Ga0105238_10470180
335 Ga0105249_10015353
336 Ga0105249_10059413
337 Ga0105239_10020681
338 Ga0105246_10200460
339 Ga0157378_10006561
340 Ga0163162_10114814
341 Ga0163162_10186468
342 Ga0163162_10727280
343 Ga0157372_10154660
344 Ga0163163_10020321
345 Ga0157380_10040347
346 Ga0157380_10041197
347 Ga0157376_10027922
348 Ga0157376_10029712
349 Ga0197907_10537467
350 Ga0206350_10022915
351 Ga0206350_10511498
352 Ga0224712_10092080
353 Ga0207688_10005728
354 Ga0207688_10061157
355 Ga0207699_10085859
356 Ga0207643_10106723
357 Ga0207694_10454416
358 Ga0207706_10007054
359 Ga0207686_10018257
360 Ga0207686_10193049
361 Ga0207709_10041153
362 Ga0207709_10491859
363 Ga0207704_10050207
364 Ga0207704_10123810
365 Ga0207665_10193126
366 Ga0207711_10099993
367 Ga0207661_10082459
368 Ga0207668_10345774
369 Ga0207668_10550458
370 Ga0207658_10044170
371 Ga0207703_10052736
372 Ga0207703_10401085
373 Ga0207639_10168238
374 Ga0207678_10262937
375 Ga0207708_10102527
376 Ga0207648_10383851
377 Ga0207675_100015657
378 Ga0207675_100206159
379 Ga0207683_10001727
380 Ga0207698_10097700
381 Ga0207428_10001129
382 Ga0207428_10004315
383 Ga0268265_10396921
384 Ga0268264_10089325
385 Ga0265336_10045919
386 Ga0265330_10026728
387 Ga0265330_10067759
388 Ga0265340_10064614
389 Ga0265331_10091481
390 Ga0265316_10023532
391 Ga0307408_100235375
392 Ga0316575_10006605
393 Ga0316575_10071781
394 Ga0316579_10000732
395 Ga0316579_10001662
396 Ga0265314_10006192
397 Ga0316576_10008398
398 Ga0316576_10013989
399 Ga0316576_10121942
400 Ga0316576_10137806
401 Ga0316576_10170217
402 Ga0316578_10001885
403 Ga0316578_10002255
404 Ga0316578_10014690
405 Ga0307405_10039776
406 Ga0307405_10285464
407 Ga0316577_10001081
408 Ga0316577_10002286
409 Ga0307410_10163185
410 Ga0307406_10056285
411 Ga0307406_10236067
412 Ga0307407_10001942
413 Ga0307412_10047428
414 Ga0307409_100000340
415 Ga0307409_100007453
416 Ga0307409_100273106
417 Ga0307416_100072027
418 Ga0307416_100143427
419 Ga0307414_10004144
420 Ga0307414_10079919
421 Ga0307414_10193165
422 Ga0307411_10014563
423 Ga0307415_100000801
424 Ga0307415_100112829
425 Ga0316583_10013647
426 Ga0316585_10000302
427 Ga0316580_10084447
428 Ga0316596_1000419
429 Ga0316596_1069213
430 Ga0373943_0023186
431 Ga0373955_0307104
432 Ga0316574_0009994
433 Ga0373947_0034817
434 Ga0316582_0000579
435 Ga0316582_0007735
436 Ga0316582_0302998
437 Ga0316584_0000543
438 Ga0316584_0004510
439 Ga0316584_0047231
440 Ga0316584_0076513
441 Ga0316584_0185012
442 Ga0316584_0276199
443 Ga0373925_0266831
444 Ga0395898_0041939
445 Ga0395898_0436994
446 Ga0316581_0000021
447 Ga0395901_0008618
448 Ga0395901_0652916
449 Ga0400490_34255
450 Ga0400483_022913
451 Ga0400489_20985
452 Ga0451791_0166916
453 Ga0451791_0325780
454 Ga0451793_0047331
455 Ga0451797_1245007
456 Ga0451802_0878280
457 Ga0451837_1172012
458 Ga0451853_0272448
459 Ga0439448_0001508
460 Ga0439448_0068717
461 Ga0439463_006347
462 Ga0439463_007413
463 Ga0439459_0009909
464 Ga0439440_0000935
465 Ga0439440_0035504
466 Ga0466972_0044178
467 Ga0466965_0041956
468 Ga0466963_0011924
469 Ga0466963_0116953
470 Ga0466963_0190768
471 Ga0466963_0235812
472 Ga0466968_0215482
473 Ga0466970_0099959
474 Ga0466957_0085798
475 Ga0466957_0354454
476 Ga0451576_0456592
477 Ga0466958_0007170
478 Ga0466958_0270254
479 Ga0466967_0039319
480 Ga0466967_0067983
481 Ga0466967_0081277
482 Ga0495603_0032358
483 Ga0495603_0050413
484 Ga0495651_0025177
485 Ga0495653_0047950
486 Ga0495582_0118288
487 Ga0495608_0299970
488 Ga0495674_0171578
489 Ga0495676_0021821
490 Ga0495680_0169740
491 Ga0496100_0007330
492 Ga0496100_0014637
493 Ga0496100_0289040
494 Ga0496101_0004427
495 Ga0496101_0010931
496 Ga0496101_0175094
497 Ga0496102_0008416
498 Ga0496104_0429190
499 Ga0496106_0013460
500 Ga0496106_0014308
501 Ga0496107_0005985
502 Ga0496107_0018281
503 Ga0496108_0002735
504 Ga0496108_0063611
505 Ga0496108_0266814
506 Ga0496109_0020703
507 Ga0496109_0044042
508 Ga0496109_0185161
509 Ga0496109_0570841
510 Ga0496110_0008539
511 Ga0496110_0030070
512 Ga0496111_0272369
513 Ga0496111_0441304
514 Ga0496112_0475202
515 Ga0496114_0008964
516 Ga0496114_0014167
517 Ga0496114_0142774
518 Ga0496115_0061329
519 Ga0496115_0145507
520 Ga0501034_0026939
521 Ga0501034_0264805
522 Ga0501067_0034904
523 Ga0501069_0011378
524 nmdc:mga05p37_181670_c1
525 nmdc:mga09592_34495_c1
526 nmdc:mga09592_591479_c1
527 nmdc:mga06r32_521585_c1
528 nmdc:mga08y16_2233_c1
529 nmdc:mga0n895_1523_c1
530 nmdc:mga0n895_68440_c1
531 nmdc:mga0rr50_23067_c1
532 nmdc:mga08x19_1651_c1
533 nmdc:mga0a205_114080_c1
534 nmdc:mga0a205_1272_c1
535 nmdc:mga0a205_168582_c1
536 Ga0495601_0004593
537 Ga0495619_0032646
538 Ga0495619_0331235
539 Ga0466962_0062927
540 2883824756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

16

270

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8381 4 262
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8366 4 260
4exb-assembly2.cif.gz_F putative aldo-keto reductase from pseudomona aeruginosa 0.8342 4 260
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8294 4 262
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8267 4 262
ID Description Score Start End Superfamily
af_A0A0R0KVN6_7_249_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8383 4 181 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8081 4 262 3.20.20.100
af_Q9VGF3_22_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7694 2 279 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7693 2 278 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7646 4 262 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A6L7M8F3-F1-model_v4 deleted 0.9976 1 201
AF-A0A2W4M2M6-F1-model_v4 Aldo/keto reductase 0.9949 1 285 GO:0016491
AF-T1DCU6-F1-model_v4 Aldo/keto reductase 0.9943 1 138
AF-A0A846PG70-F1-model_v4 Aldo/keto reductase 0.9934 1 285 GO:0016491
AF-A0A524LVU3-F1-model_v4 Aldo/keto reductase 0.9921 1 245 GO:0016491

Map