F377048

General Info

Members Datasets Scaffolds Average Seq Length
270 208 193 521

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10030263|Ga0316579_100302631
Length 576
Sequence MVLKTDLLNHKKYSEDCSHEAENFDIHTMRRVILDFLAEQRVESGTLASLMFDNRFVRELPADPETANRPRQVTGACYTFVKPKRVAAPKLVAFSPEVASLLDLSVETCESDEFLNVFVGNRILPGMEPYATCYGGHQFGNWAGQLGDGRAINLGEIINQRSERWALQIKGAGPTPYRRAADGLAVLRSSIREFLCSEAMFHLGIPTTRALSVILTGEQVVRDMFYDGNPKLEPGAVVCRVASSFTRFGNFQIFASREEIEVLRQLADYTIRIDFPHLGDPSPEVYLKWFEEVCRTTAELIVHWMRVGFVHGVMNTDNMSVLGLTIDYGPYGWLEDYDPNWTPNTTDAGSRRYCFGNQPQIAYWNLVQLANAIYPLIGKIEPLQEALSVYSQQFQDGWQAMMAKKLGLKTFESATDDSLVTELLAILPLAETDMTIFFRRLAMIDVDVKSLRNTSNETLMAPVMPAYYLPEQLTHEYRTRMGSWLRDYLIRLVKDNTSHETRRRRMNAVNPKYVLRNYLAQLAIDKAEQGDFSLVNELLEVMRYPYDEQSGKEEFAKKRPEWARHRPGCSMLSCSS

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
10 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
11 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
12 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
13 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
14 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
15 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
16 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
17 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
18 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
19 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
20 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
21 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
22 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
23 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
24 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
25 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
26 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
27 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
28 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
29 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
30 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
31 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
32 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
33 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
34 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
35 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
36 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
37 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
38 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
39 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
40 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
41 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
42 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
43 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
44 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
45 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
46 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
47 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
48 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
49 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
50 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
51 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
52 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
53 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
54 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
55 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
56 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
57 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
58 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
59 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
60 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
61 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
62 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
63 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
64 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
65 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
66 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
67 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
68 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
69 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
70 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
71 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
72 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
73 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
74 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
75 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
80 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
136 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
145 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
146 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
147 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
194 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
195 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
196 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
206 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
207 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
208 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.48
Metatranscriptomes 0
Isolates 28.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 2.59
Nodule 1.48
Rhizoplane 0.37
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 24.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000879 3300001915 Bacteria 9065
2 rootH2_10007934 3300003320 Bacteria 25313
3 rootH2_10090189 3300003320 Bacteria 6423
4 rootH2_10172555 3300003320 Bacteria 5431
5 rootH1_10001964 3300003323 Bacteria 47184
6 rootH1_10099832 3300003323 Bacteria 4627
7 Ga0065714_10064794 3300005288 Bacteria 18645
8 Ga0065704_10084005 3300005289 Bacteria 3389
9 Ga0065707_10091018 3300005295 Bacteria 4021
10 Ga0070683_100001973 3300005329 Bacteria 16071
11 Ga0070682_100000065 3300005337 Bacteria 100147
12 Ga0070682_100019339 3300005337 Bacteria 3994
13 Ga0070713_100000026 3300005436 Bacteria 95308
14 Ga0070672_100017209 3300005543 Bacteria 5198
15 Ga0068852_100000863 3300005616 Bacteria 20150
16 Ga0068859_100053313 3300005617 Bacteria 4068
17 Ga0068861_100000936 3300005719 Bacteria 17736
18 Ga0068863_100017931 3300005841 Bacteria 6776
19 Ga0075428_100000054 3300006844 Bacteria 91405
20 Ga0097620_100053315 3300006931 Bacteria 4068
21 Ga0079104_1000321 3300006946 Bacteria 60074
22 Ga0099826_10007074 3300006948 Bacteria 8237
23 Ga0105244_10000005 3300009036 Bacteria 481412
24 Ga0105244_10000108 3300009036 Bacteria 86321
25 Ga0105244_10000222 3300009036 Bacteria 58959
26 Ga0105250_10000004 3300009092 Bacteria 438653
27 Ga0105250_10014130 3300009092 Bacteria 3284
28 Ga0105250_10041825 3300009092 Bacteria 1836
29 Ga0111539_10001012 3300009094 Bacteria 36834
30 Ga0111539_10087252 3300009094 Bacteria 3665
31 Ga0105243_10000004 3300009148 Bacteria 601266
32 Ga0105243_10000021 3300009148 Bacteria 213782
33 Ga0105243_10009071 3300009148 Bacteria 7598
34 Ga0105249_10004861 3300009553 Bacteria 11592
35 Ga0157373_10000002 3300013100 Bacteria 750094
36 Ga0157373_10000065 3300013100 Bacteria 93292
37 Ga0157371_10022904 3300013102 Bacteria 4569
38 Ga0157370_10000360 3300013104 Bacteria 57621
39 Ga0157370_10009203 3300013104 Bacteria 10592
40 Ga0157370_10063445 3300013104 Bacteria 3500
41 Ga0157370_10136353 3300013104 Bacteria 2287
42 Ga0157369_10002103 3300013105 Bacteria 24007
43 Ga0157369_10042182 3300013105 Bacteria 4978
44 Ga0163162_10123891 3300013306 Bacteria 2690
45 Ga0157372_10103690 3300013307 Bacteria 3250
46 Ga0157375_10027755 3300013308 Bacteria 5296
47 Ga0163163_10178492 3300014325 Bacteria 2171
48 Ga0182008_10000005 3300014497 Bacteria 386556
49 Ga0182006_1000001 3300015261 Bacteria 1091090
50 Ga0182006_1002549 3300015261 Bacteria 9884
51 Ga0163161_10000063 3300017792 Bacteria 109669
52 Ga0209675_1000022 3300025291 Bacteria 315280
53 Ga0207696_1000056 3300025711 Bacteria 251959
54 Ga0207696_1015260 3300025711 Bacteria 2608
55 Ga0207655_1000004 3300025728 Bacteria 1021221
56 Ga0207655_1000016 3300025728 Bacteria 551476
57 Ga0207655_1000128 3300025728 Bacteria 149987
58 Ga0207700_10000365 3300025928 Bacteria 26392
59 Ga0207709_10000010 3300025935 Bacteria 601305
60 Ga0207709_10000281 3300025935 Bacteria 58322
61 Ga0207661_10001008 3300025944 Bacteria 18623
62 Ga0207641_10166281 3300026088 Bacteria 2009
63 Ga0207675_100073382 3300026118 Bacteria 3202
64 Ga0207698_10002535 3300026142 Bacteria 10845
65 Ga0209281_1000244 3300027111 Bacteria 109979
66 Ga0207428_10008811 3300027907 Bacteria 9097
67 Ga0265331_10002066 3300031250 Bacteria 13900
68 Ga0265327_10001058 3300031251 Bacteria 38434
69 Ga0265327_10003865 3300031251 Bacteria 13805
70 Ga0307408_100000518 3300031548 Bacteria 33310
71 Ga0307408_100007458 3300031548 Bacteria 7232
72 Ga0316579_10030263 3300031691 Bacteria 2473
73 Ga0316576_10002755 3300031727 Bacteria 10081
74 Ga0316576_10060333 3300031727 Bacteria 2778
75 Ga0316578_10038381 3300031728 Bacteria 2761
76 Ga0307405_10030059 3300031731 Bacteria 3182
77 Ga0316577_10006590 3300031733 Bacteria 6145
78 Ga0307413_10000439 3300031824 Bacteria 13517
79 Ga0307410_10000191 3300031852 Bacteria 22695
80 Ga0307406_10000143 3300031901 Bacteria 42246
81 Ga0307407_10001412 3300031903 Bacteria 8673
82 Ga0307412_10000058 3300031911 Bacteria 140824
83 Ga0307412_10000375 3300031911 Bacteria 27871
84 Ga0307412_10086614 3300031911 Bacteria 2180
85 Ga0307416_100000006 3300032002 Bacteria 466074
86 Ga0307416_100000418 3300032002 Bacteria 21636
87 Ga0307414_10000061 3300032004 Bacteria 109693
88 Ga0307414_10000062 3300032004 Bacteria 108721
89 Ga0307414_10000086 3300032004 Bacteria 85265
90 Ga0307414_10013215 3300032004 Bacteria 4909
91 Ga0307414_10018678 3300032004 Bacteria 4276
92 Ga0307414_10035698 3300032004 Bacteria 3311
93 Ga0307411_10000001 3300032005 Bacteria 931810
94 Ga0316583_10018561 3300032133 Bacteria 2497
95 Ga0316580_10016339 3300032139 Bacteria 2277
96 Ga0373949_0000198 3300035090 Bacteria 23288
97 Ga0373936_0000008 3300035113 Bacteria 268505
98 Ga0373960_0012424 3300035121 Bacteria 2116
99 Ga0316574_0001799 3300035398 Bacteria 10432
100 Ga0373933_0076020 3300035724 Bacteria 2051
101 Ga0316582_0008857 3300036647 Bacteria 5427
102 Ga0316584_0014129 3300036712 Bacteria 5673
103 Ga0316581_0012281 3300037588 Bacteria 2410
104 Ga0400488_24622 3300038741 Bacteria 20978
105 Ga0400488_60573 3300038741 Bacteria 2907
106 Ga0400483_041497 3300039062 Bacteria 3878
107 Ga0400483_117379 3300039062 Bacteria 3034
108 Ga0400483_158054 3300039062 Bacteria 7990
109 Ga0400483_290635 3300039062 Bacteria 6174
110 Ga0400489_13016 3300039093 Bacteria 11817
111 Ga0439466_0003020 3300041411 Bacteria 6560
112 Ga0439465_0000001 3300041413 Bacteria 82718
113 Ga0451849_0485324 3300041505 Bacteria 2803
114 Ga0451577_0133827 3300042876 Bacteria 2225
115 Ga0453684_0091453 3300044712 Bacteria 3756
116 Ga0451576_0000217 3300045051 Bacteria 142222
117 Ga0451576_0056841 3300045051 Bacteria 4090
118 Ga0495627_000012 3300046453 Bacteria 345654
119 Ga0495627_003919 3300046453 Bacteria 6367
120 Ga0495596_0001618 3300046500 Bacteria 12813
121 Ga0495606_0011987 3300046507 Bacteria 7001
122 Ga0495606_0034089 3300046507 Bacteria 3500
123 Ga0495610_0000005 3300046512 Bacteria 924111
124 Ga0495632_0006500 3300046519 Bacteria 7501
125 Ga0495663_0000070 3300046525 Bacteria 46854
126 Ga0495663_0009812 3300046525 Bacteria 2658
127 Ga0495654_0000003 3300046530 Bacteria 863485
128 Ga0495609_0000003 3300046538 Bacteria 711547
129 Ga0495633_0000001 3300046558 Bacteria 801972
130 Ga0495633_0001201 3300046558 Bacteria 20826
131 Ga0495625_0003228 3300046660 Bacteria 16510
132 Ga0495686_0000136 3300047472 Bacteria 148759
133 Ga0496114_0031826 3300048917 Bacteria 4339
134 Ga0496116_0000029 3300048919 Bacteria 422187
135 Ga0496116_0000032 3300048919 Bacteria 419997
136 Ga0496116_0011258 3300048919 Bacteria 7425
137 Ga0496117_0000007 3300048920 Bacteria 720505
138 Ga0496117_0001753 3300048920 Bacteria 29865
139 Ga0496118_0000418 3300048921 Bacteria 70766
140 Ga0496118_0051633 3300048921 Bacteria 3144
141 Ga0496119_0000007 3300048922 Bacteria 475920
142 Ga0496120_0030732 3300048923 Bacteria 3261
143 Ga0496121_0027156 3300048924 Bacteria 5365
144 Ga0496122_0000151 3300048925 Bacteria 162224
145 Ga0496122_0000153 3300048925 Bacteria 161087
146 Ga0496122_0004192 3300048925 Bacteria 18134
147 Ga0496122_0006203 3300048925 Bacteria 13863
148 Ga0496122_0007009 3300048925 Bacteria 12674
149 Ga0496123_0005677 3300048926 Bacteria 12454
150 Ga0496123_0007477 3300048926 Bacteria 10268
151 Ga0496123_0059929 3300048926 Bacteria 2457
152 Ga0496124_0002007 3300048927 Bacteria 27709
153 Ga0496124_0108188 3300048927 Bacteria 2242
154 Ga0496125_0000059 3300048928 Bacteria 264149
155 Ga0496125_0006666 3300048928 Bacteria 12430
156 Ga0496125_0026239 3300048928 Bacteria 5314
157 Ga0496126_0006692 3300048929 Bacteria 12801
158 Ga0496126_0173040 3300048929 Bacteria 1838
159 Ga0496126_0205044 3300048929 Bacteria 1663
160 Ga0501292_005526 3300049515 Bacteria 1765
161 Ga0501034_0032554 3300049571 Bacteria 5293
162 Ga0501038_0033349 3300049574 Bacteria 4537
163 Ga0501043_0077480 3300049579 Bacteria 2612
164 Ga0501047_0000718 3300049581 Bacteria 34451
165 Ga0501048_0121799 3300049582 Bacteria 1843
166 Ga0501067_0002370 3300049583 Bacteria 10435
167 Ga0501067_0005143 3300049583 Bacteria 7272
168 Ga0501068_0000096 3300049584 Bacteria 37679
169 Ga0501069_0065329 3300049585 Bacteria 2034
170 Ga0501070_0016799 3300049586 Bacteria 6143
171 Ga0501070_0108581 3300049586 Bacteria 2292
172 Ga0501071_0104519 3300049587 Bacteria 2090
173 Ga0501072_0000018 3300049588 Bacteria 158735
174 Ga0501076_0100433 3300049592 Bacteria 2331
175 Ga0501230_003844 3300049667 Bacteria 2024
176 Ga0501235_008218 3300049669 Bacteria 2277
177 Ga0501249_000037 3300049679 Bacteria 63492
178 Ga0501249_001046 3300049679 Bacteria 5901
179 Ga0501241_000001 3300049758 Bacteria 233688
180 Ga0501266_000019 3300049763 Bacteria 114355
181 Ga0501269_000002 3300049766 Bacteria 118370
182 Ga0501280_000116 3300049776 Bacteria 21015
183 nmdc:mga08y16_14604_c1 3300050511 Bacteria 8260
184 nmdc:mga08y16_69995_c1 3300050511 Bacteria 3657
185 Ga0500646_0003373 3300053090 Bacteria 4101
186 Ga0500641_0000019 3300053096 Bacteria 123198
187 Ga0500641_0000511 3300053096 Bacteria 13960
188 Ga0500658_0000003 3300053134 Bacteria 512506
189 Ga0500559_0015678 3300053136 Bacteria 3200
190 Ga0500584_012588 3300053726 Bacteria 3850
191 Ga0501084_0000113 3300054114 Bacteria 61155
192 Ga0501084_0272268 3300054114 Bacteria 1430
193 Ga0501082_0002541 3300060353 Bacteria 15984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0173040 Ga0496126_0173040_25_1338 424
2 3300054114 Ga0501084_0272268 Ga0501084_0272268_12_1391 452
3 3300039062 Ga0400483_041497 Ga0400483_041497_732_2162 455
4 3300009036 Ga0105244_10000222 Ga0105244_1000022210 470
5 3300025728 Ga0207655_1000004 Ga0207655_1000004906 470
6 3300035121 Ga0373960_0012424 Ga0373960_0012424_41_1537 471
7 3300044712 Ga0453684_0091453 Ga0453684_0091453_930_2399 471
8 3300039062 Ga0400483_290635 Ga0400483_290635_11_1516 477
9 3300009036 Ga0105244_10000108 Ga0105244_1000010861 482
10 3300025728 Ga0207655_1000128 Ga0207655_100012889 482
11 3300031824 Ga0307413_10000439 Ga0307413_100004394 484
12 3300049587 Ga0501071_0104519 Ga0501071_0104519_484_2022 484
13 3300031250 Ga0265331_10002066 Ga0265331_100020667 486
14 3300031251 Ga0265327_10001058 Ga0265327_1000105828 486
15 3300049515 Ga0501292_005526 Ga0501292_005526_229_1722 486
16 3300049667 Ga0501230_003844 Ga0501230_003844_146_1639 486
17 3300049669 Ga0501235_008218 Ga0501235_008218_184_1677 486
18 3300013104 Ga0157370_10063445 Ga0157370_100634453 487
19 3300013105 Ga0157369_10042182 Ga0157369_100421823 487
20 3300031548 Ga0307408_100000518 Ga0307408_1000005181 489
21 3300049571 Ga0501034_0032554 Ga0501034_0032554_3147_4766 489
22 3300013104 Ga0157370_10009203 Ga0157370_100092036 491
23 3300053726 Ga0500584_012588 Ga0500584_012588_982_2550 493
24 3300032004 Ga0307414_10000062 Ga0307414_1000006231 496
25 3300039093 Ga0400489_13016 Ga0400489_13016_1790_3349 497
26 3300053096 Ga0500641_0000511 Ga0500641_0000511_8193_9761 497
27 3300005337 Ga0070682_100019339 Ga0070682_1000193392 498
28 3300013104 Ga0157370_10136353 Ga0157370_101363532 498
29 3300031548 Ga0307408_100007458 Ga0307408_1000074584 498
30 3300009553 Ga0105249_10004861 Ga0105249_100048615 499
31 3300017792 Ga0163161_10000063 Ga0163161_1000006336 499
32 3300049776 Ga0501280_000116 Ga0501280_000116_16325_17917 500
33 3300035090 Ga0373949_0000198 Ga0373949_0000198_3736_5346 501
34 3300049583 Ga0501067_0002370 Ga0501067_0002370_4734_6347 501
35 iso_pu_bacteria 2687453341 2688390927 501
36 3300013307 Ga0157372_10103690 Ga0157372_101036903 502
37 3300049586 Ga0501070_0016799 Ga0501070_0016799_4526_6079 502
38 3300049586 Ga0501070_0108581 Ga0501070_0108581_229_1782 502
39 iso_pu_bacteria 2519899754 2520882362 502
40 iso_pu_bacteria 2643221667 2644372284 502
41 iso_pu_bacteria 2643221725 2644684756 502
42 iso_pu_bacteria 2738541279 2738732592 502
43 iso_pu_bacteria 2738541285 2738765157 502
44 iso_pu_bacteria 2738543007 2739214172 502
45 iso_pu_bacteria 2739367857 2740004171 502
46 iso_pu_bacteria 2739367858 2740008988 502
47 iso_pu_bacteria 2802428842 2802653689 502
48 iso_pu_bacteria 2816332280 2817416359 502
49 iso_pu_bacteria 2857613821 2857615047 502
50 iso_pu_bacteria 2857618242 2857618750 502
51 iso_pu_bacteria 2881359912 2881363194 502
52 iso_pu_bacteria 2903895155 2903896801 502
53 iso_pu_bacteria 2904419702 2904422896 502
54 iso_pu_bacteria 2904555929 2904557163 502
55 iso_pu_bacteria 2919683626 2919685984 502
56 iso_pu_bacteria 2929150217 2929153648 502
57 iso_pu_bacteria 2958458903 2958461203 502
58 iso_pu_bacteria 2977268062 2977270313 502
59 iso_pu_bacteria 8054307821 8054309982 502
60 iso_pu_bacteria 8055419101 8055422026 502
61 iso_pu_bacteria 8055592153 8055593312 502
62 iso_pu_bacteria 8056440228 8056443868 502
63 3300003320 rootH2_10007934 rootH2_1000793410 503
64 3300005543 Ga0070672_100017209 Ga0070672_1000172092 503
65 3300005616 Ga0068852_100000863 Ga0068852_1000008638 503
66 3300026142 Ga0207698_10002535 Ga0207698_100025354 503
67 iso_pu_bacteria 2513020052 2513235978 503
68 3300003323 rootH1_10099832 rootH1_100998322 504
69 iso_pu_bacteria 2643221600 2644012975 504
70 iso_pu_bacteria 2919191525 2919195217 504
71 3300005436 Ga0070713_100000026 Ga0070713_1000000262 505
72 3300025928 Ga0207700_10000365 Ga0207700_1000036513 505
73 3300006946 Ga0079104_1000321 Ga0079104_100032134 506
74 3300006948 Ga0099826_10007074 Ga0099826_100070745 506
75 3300009092 Ga0105250_10000004 Ga0105250_10000004153 506
76 3300009092 Ga0105250_10041825 Ga0105250_100418252 506
77 3300013100 Ga0157373_10000002 Ga0157373_10000002606 506
78 3300013104 Ga0157370_10000360 Ga0157370_100003603 506
79 3300013105 Ga0157369_10002103 Ga0157369_1000210312 506
80 3300015261 Ga0182006_1002549 Ga0182006_10025497 506
81 3300025711 Ga0207696_1000056 Ga0207696_1000056153 506
82 3300027111 Ga0209281_1000244 Ga0209281_100024435 506
83 3300031852 Ga0307410_10000191 Ga0307410_1000019113 506
84 3300031901 Ga0307406_10000143 Ga0307406_1000014313 506
85 3300031903 Ga0307407_10001412 Ga0307407_100014123 506
86 3300032002 Ga0307416_100000418 Ga0307416_10000041817 506
87 3300032004 Ga0307414_10000086 Ga0307414_1000008622 506
88 3300032004 Ga0307414_10035698 Ga0307414_100356983 506
89 3300032005 Ga0307411_10000001 Ga0307411_10000001354 506
90 3300041411 Ga0439466_0003020 Ga0439466_0003020_3347_4915 506
91 3300048919 Ga0496116_0000032 Ga0496116_0000032_57369_58937 506
92 3300048924 Ga0496121_0027156 Ga0496121_0027156_2617_4185 506
93 3300048927 Ga0496124_0108188 Ga0496124_0108188_625_2193 506
94 3300048928 Ga0496125_0000059 Ga0496125_0000059_54760_56328 506
95 3300049679 Ga0501249_000037 Ga0501249_000037_8104_9672 506
96 3300049679 Ga0501249_001046 Ga0501249_001046_2311_3903 506
97 3300049763 Ga0501266_000019 Ga0501266_000019_33133_34725 506
98 3300053090 Ga0500646_0003373 Ga0500646_0003373_1494_3062 506
99 3300053096 Ga0500641_0000019 Ga0500641_0000019_68056_69624 506
100 3300053134 Ga0500658_0000003 Ga0500658_0000003_266119_267687 506
101 3300053136 Ga0500559_0015678 Ga0500559_0015678_561_2129 506
102 iso_pu_bacteria 2643221716 2644642708 506
103 iso_pu_bacteria 2739367866 2740033930 506
104 3300005295 Ga0065707_10091018 Ga0065707_100910182 507
105 3300041505 Ga0451849_0485324 Ga0451849_0485324_1065_2642 507
106 3300049574 Ga0501038_0033349 Ga0501038_0033349_2632_4245 507
107 3300049579 Ga0501043_0077480 Ga0501043_0077480_726_2339 507
108 3300049581 Ga0501047_0000718 Ga0501047_0000718_20251_21864 507
109 3300049582 Ga0501048_0121799 Ga0501048_0121799_22_1635 507
110 3300049583 Ga0501067_0005143 Ga0501067_0005143_2240_3853 507
111 3300049584 Ga0501068_0000096 Ga0501068_0000096_16976_18589 507
112 3300049585 Ga0501069_0065329 Ga0501069_0065329_146_1759 507
113 3300049588 Ga0501072_0000018 Ga0501072_0000018_20266_21879 507
114 3300049592 Ga0501076_0100433 Ga0501076_0100433_100_1713 507
115 3300054114 Ga0501084_0000113 Ga0501084_0000113_52687_54300 507
116 3300060353 Ga0501082_0002541 Ga0501082_0002541_12738_14351 507
117 3300005617 Ga0068859_100053313 Ga0068859_1000533133 508
118 3300005719 Ga0068861_100000936 Ga0068861_1000009363 508
119 3300005841 Ga0068863_100017931 Ga0068863_1000179313 508
120 3300006931 Ga0097620_100053315 Ga0097620_1000533153 508
121 3300013306 Ga0163162_10123891 Ga0163162_101238911 508
122 3300014325 Ga0163163_10178492 Ga0163163_101784922 508
123 3300026088 Ga0207641_10166281 Ga0207641_101662811 508
124 3300026118 Ga0207675_100073382 Ga0207675_1000733821 508
125 3300031251 Ga0265327_10003865 Ga0265327_100038658 508
126 3300035113 Ga0373936_0000008 Ga0373936_0000008_60029_61630 508
127 3300035724 Ga0373933_0076020 Ga0373933_0076020_187_1851 508
128 3300045051 Ga0451576_0000217 Ga0451576_0000217_42730_44349 508
129 iso_pu_bacteria 2739367874 2740060141 508
130 iso_pu_bacteria 2740891818 2740992925 508
131 iso_pu_bacteria 2896317667 2896318542 508
132 iso_pu_bacteria 2910245624 2910246880 508
133 3300003320 rootH2_10090189 rootH2_100901893 509
134 3300003323 rootH1_10001964 rootH1_100019644 509
135 3300009094 Ga0111539_10087252 Ga0111539_100872521 509
136 3300031691 Ga0316579_10030263 Ga0316579_100302631 509
137 3300031727 Ga0316576_10002755 Ga0316576_100027555 509
138 3300031727 Ga0316576_10060333 Ga0316576_100603333 509
139 3300031728 Ga0316578_10038381 Ga0316578_100383812 509
140 3300031733 Ga0316577_10006590 Ga0316577_100065906 509
141 3300032004 Ga0307414_10013215 Ga0307414_100132158 509
142 3300032133 Ga0316583_10018561 Ga0316583_100185612 509
143 3300032139 Ga0316580_10016339 Ga0316580_100163391 509
144 3300035398 Ga0316574_0001799 Ga0316574_0001799_6514_8244 509
145 3300036647 Ga0316582_0008857 Ga0316582_0008857_233_1963 509
146 3300036712 Ga0316584_0014129 Ga0316584_0014129_3118_4848 509
147 3300037588 Ga0316581_0012281 Ga0316581_0012281_396_2126 509
148 3300038741 Ga0400488_24622 Ga0400488_24622_13574_15232 509
149 3300038741 Ga0400488_60573 Ga0400488_60573_1219_2877 509
150 3300039062 Ga0400483_117379 Ga0400483_117379_1185_2795 509
151 3300039062 Ga0400483_158054 Ga0400483_158054_4882_6546 509
152 3300042876 Ga0451577_0133827 Ga0451577_0133827_49_1701 509
153 3300050511 nmdc:mga08y16_69995_c1 nmdc:mga08y16_69995_c1_1902_3548 509
154 iso_pu_bacteria 2523533629 2524005004 509
155 iso_pu_bacteria 2582581278 2585141174 509
156 iso_pu_bacteria 2582581873 2585426139 509
157 iso_pu_bacteria 2585428045 2587676953 509
158 iso_pu_bacteria 2585428060 2587746543 509
159 iso_pu_bacteria 2585428061 2587753167 509
160 iso_pu_bacteria 2585428095 2587866011 509
161 iso_pu_bacteria 2585428115 2587944524 509
162 iso_pu_bacteria 2585428182 2588211193 509
163 iso_pu_bacteria 2585428183 2588215575 509
164 iso_pu_bacteria 2585428184 2588218997 509
165 iso_pu_bacteria 2585428185 2588224489 509
166 iso_pu_bacteria 2585428187 2588232088 509
167 iso_pu_bacteria 2588253712 2588447259 509
168 iso_pu_bacteria 2588254255 2590602897 509
169 iso_pu_bacteria 2588254257 2590609910 509
170 iso_pu_bacteria 2721755487 2722727854 509
171 iso_pu_bacteria 2728369107 2729201098 509
172 iso_pu_bacteria 2738541276 2738716253 509
173 iso_pu_bacteria 2751185877 2753673936 509
174 iso_pu_bacteria 2765235839 2765575387 509
175 iso_pu_bacteria 2772190705 2772603393 509
176 iso_pu_bacteria 2775506739 2775674581 509
177 iso_pu_bacteria 2816332188 2816875214 509
178 iso_pu_bacteria 2842083920 2842084741 509
179 iso_pu_bacteria 2871720351 2871723287 509
180 iso_pu_bacteria 2889290771 2889294106 509
181 iso_pu_bacteria 2904780799 2904781502 509
182 iso_pu_bacteria 2905999023 2905999283 509
183 iso_pu_bacteria 2919097161 2919098197 509
184 iso_pu_bacteria 2919177583 2919177785 509
185 iso_pu_bacteria 2919399522 2919401540 509
186 iso_pu_bacteria 2945924605 2945925377 509
187 iso_pu_bacteria 2946019816 2946023783 509
188 iso_pu_bacteria 2977243572 2977244189 509
189 iso_pu_bacteria 2984572630 2984574206 509
190 iso_pu_bacteria 2984606641 2984607654 509
191 iso_pu_bacteria 2993372514 2993375680 509
192 iso_pu_bacteria 2993480792 2993482549 509
193 3300006844 Ga0075428_100000054 Ga0075428_10000005477 510
194 3300009094 Ga0111539_10001012 Ga0111539_1000101232 510
195 3300027907 Ga0207428_10008811 Ga0207428_100088115 510
196 3300045051 Ga0451576_0056841 Ga0451576_0056841_1478_3055 510
197 3300048917 Ga0496114_0031826 Ga0496114_0031826_991_2637 510
198 3300050511 nmdc:mga08y16_14604_c1 nmdc:mga08y16_14604_c1_4477_6054 510
199 iso_pu_bacteria 2684623219 2687236362 510
200 3300013308 Ga0157375_10027755 Ga0157375_100277553 512
201 3300041413 Ga0439465_0000001 Ga0439465_0000001_29761_31299 512
202 3300001915 JGI24741J21665_1000879 JGI24741J21665_10008794 513
203 3300003320 rootH2_10172555 rootH2_101725552 513
204 3300005288 Ga0065714_10064794 Ga0065714_1006479413 513
205 3300005289 Ga0065704_10084005 Ga0065704_100840052 513
206 3300005329 Ga0070683_100001973 Ga0070683_1000019739 513
207 3300005337 Ga0070682_100000065 Ga0070682_10000006571 513
208 3300009036 Ga0105244_10000005 Ga0105244_10000005147 513
209 3300009092 Ga0105250_10014130 Ga0105250_100141302 513
210 3300009148 Ga0105243_10000004 Ga0105243_10000004478 513
211 3300009148 Ga0105243_10000021 Ga0105243_10000021184 513
212 3300009148 Ga0105243_10009071 Ga0105243_100090715 513
213 3300013100 Ga0157373_10000065 Ga0157373_100000655 513
214 3300013102 Ga0157371_10022904 Ga0157371_100229042 513
215 3300014497 Ga0182008_10000005 Ga0182008_10000005108 513
216 3300015261 Ga0182006_1000001 Ga0182006_1000001553 513
217 3300025291 Ga0209675_1000022 Ga0209675_100002249 513
218 3300025711 Ga0207696_1015260 Ga0207696_10152602 513
219 3300025728 Ga0207655_1000016 Ga0207655_1000016146 513
220 3300025935 Ga0207709_10000010 Ga0207709_10000010481 513
221 3300025935 Ga0207709_10000281 Ga0207709_1000028112 513
222 3300025944 Ga0207661_10001008 Ga0207661_100010085 513
223 3300031731 Ga0307405_10030059 Ga0307405_100300593 513
224 3300031911 Ga0307412_10000058 Ga0307412_1000005837 513
225 3300031911 Ga0307412_10000375 Ga0307412_1000037518 513
226 3300031911 Ga0307412_10086614 Ga0307412_100866141 513
227 3300032002 Ga0307416_100000006 Ga0307416_100000006393 513
228 3300032004 Ga0307414_10000061 Ga0307414_1000006184 513
229 3300032004 Ga0307414_10018678 Ga0307414_100186782 513
230 3300046453 Ga0495627_000012 Ga0495627_000012_266612_268153 513
231 3300046453 Ga0495627_003919 Ga0495627_003919_1935_3476 513
232 3300046500 Ga0495596_0001618 Ga0495596_0001618_1787_3328 513
233 3300046507 Ga0495606_0011987 Ga0495606_0011987_3293_4834 513
234 3300046507 Ga0495606_0034089 Ga0495606_0034089_1405_2946 513
235 3300046512 Ga0495610_0000005 Ga0495610_0000005_526560_528101 513
236 3300046519 Ga0495632_0006500 Ga0495632_0006500_5531_7072 513
237 3300046525 Ga0495663_0000070 Ga0495663_0000070_43052_44593 513
238 3300046525 Ga0495663_0009812 Ga0495663_0009812_866_2407 513
239 3300046530 Ga0495654_0000003 Ga0495654_0000003_421304_422845 513
240 3300046538 Ga0495609_0000003 Ga0495609_0000003_433963_435504 513
241 3300046558 Ga0495633_0000001 Ga0495633_0000001_495899_497440 513
242 3300046558 Ga0495633_0001201 Ga0495633_0001201_12564_14105 513
243 3300046660 Ga0495625_0003228 Ga0495625_0003228_8086_9627 513
244 3300047472 Ga0495686_0000136 Ga0495686_0000136_7148_8689 513
245 3300048919 Ga0496116_0000029 Ga0496116_0000029_419815_421356 513
246 3300048919 Ga0496116_0011258 Ga0496116_0011258_5124_6665 513
247 3300048920 Ga0496117_0000007 Ga0496117_0000007_416932_418473 513
248 3300048920 Ga0496117_0001753 Ga0496117_0001753_15424_16965 513
249 3300048921 Ga0496118_0000418 Ga0496118_0000418_29088_30629 513
250 3300048921 Ga0496118_0051633 Ga0496118_0051633_943_2484 513
251 3300048922 Ga0496119_0000007 Ga0496119_0000007_416999_418540 513
252 3300048923 Ga0496120_0030732 Ga0496120_0030732_294_1835 513
253 3300048925 Ga0496122_0000151 Ga0496122_0000151_157505_159046 513
254 3300048925 Ga0496122_0000153 Ga0496122_0000153_156439_157980 513
255 3300048925 Ga0496122_0004192 Ga0496122_0004192_6016_7557 513
256 3300048925 Ga0496122_0006203 Ga0496122_0006203_4531_6072 513
257 3300048925 Ga0496122_0007009 Ga0496122_0007009_3236_4777 513
258 3300048926 Ga0496123_0005677 Ga0496123_0005677_3173_4714 513
259 3300048926 Ga0496123_0007477 Ga0496123_0007477_4776_6317 513
260 3300048926 Ga0496123_0059929 Ga0496123_0059929_881_2422 513
261 3300048927 Ga0496124_0002007 Ga0496124_0002007_12740_14281 513
262 3300048928 Ga0496125_0006666 Ga0496125_0006666_3134_4675 513
263 3300048928 Ga0496125_0026239 Ga0496125_0026239_596_2137 513
264 3300048929 Ga0496126_0006692 Ga0496126_0006692_7177_8718 513
265 3300048929 Ga0496126_0205044 Ga0496126_0205044_21_1562 513
266 3300049758 Ga0501241_000001 Ga0501241_000001_55612_57153 513
267 3300049766 Ga0501269_000002 Ga0501269_000002_59757_61298 513
268 iso_pu_bacteria 2511231000 2511232269 513
269 iso_pu_bacteria 2582581281 2585157177 513
270 iso_pu_bacteria 2582581282 2585161317 513

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02696

SelO

Protein adenylyltransferase SelO

65

543

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iny-assembly1.cif.gz_A crystal structure of an uncharacterized protein 0.9515 31 497
6lna-assembly1.cif.gz_A ydiu complex with ampnpp and mn2+ 0.9464 31 498
6lna-assembly2.cif.gz_B ydiu complex with ampnpp and mn2+ 0.945 31 497
6eac-assembly4.cif.gz_D pseudomonas syringae selo 0.9426 31 497
6k20-assembly1.cif.gz_A structure of apo ydiu 0.938 31 497
ID Description Score Start End Superfamily
af_P38970_587_855_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7315 240 285 1.10.510.10
af_Q2G0K5_17_85_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6555 388 432 3.40.50.1000
af_Q19704_297_493_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6505 229 323 1.10.510.10
af_A0A0N7KHL0_127_310_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.609 229 320 1.10.510.10
af_Q8IID5_1255_1441_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5985 230 320 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A349VTD8-F1-model_v4 YdiU family protein 0.9942 1 462 GO:0005524
GO:0046872
GO:0070733
AF-A0A3B9NBS4-F1-model_v4 Protein adenylyltransferase SelO (EC 2.7.7.108) 0.9941 1 513 GO:0000287
GO:0005524
GO:0070733
AF-A0A349VTD8-F1-model_v4 YdiU family protein 0.992 1 462 GO:0005524
GO:0046872
GO:0070733
AF-A0A2X2L8E4-F1-model_v4 Uncharacterized conserved protein 0.9916 1 371 GO:0005524
GO:0046872
GO:0070733
AF-A0A2W6U2H5-F1-model_v4 Selenoprotein O 0.9915 1 108 GO:0005524
GO:0046872
GO:0070733

Feature Viewer

pLDDT pTM Quality
94.16 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map