F377020

General Info

Members Datasets Scaffolds Average Seq Length
270 182 266 428

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10168843|Ga0207674_101688432
Length 456
Sequence MEEIVLSVENLSKQYRLGKIGTGSLRQDISYWWKYSVLKKPDPFFYSEEDERFLWALKDVSFNLKKGEALGIIGSNGSGKSTLLKIISRITSPTKGHVRGKGTVSSILEIGTGFHPELSGRENIFMSGYALGMTKEEIKKKFDEIVAFSGIEKFVDTPVKRYSSGMYVRLAFSVAAHLEPDILIIDEVLAVGDVEFQKKCMGKMQDVSAAKGRTILFVSHNMTAITNLCSKTIWLDKGVIKQTGLSKDVVKSYLEKFAQPIAPKEWKEPESAPGNDLIRLKRTSVEAAEQSFISVATAIKICCEFWCFAEGFTINANVSLNGEQGECVFNLGSSSVEAQHSVLSLDVVIPPRLLNNQTYTISLTVVKNHSEPLFEFSNCLSFEVQDERQNMNYFGAWPGVIRPVINNDLRIKEILEGVGLPDSVDKMPSELSGGMRKRIGLARTMIMQPEIMLYAV

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
3 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
4 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 0
Rhizoplane 0.37
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 rootH2_10345619 3300003320 Bacteria 1395
3 Ga0065165_1008967 3300005262 Bacteria 4577
4 Ga0065704_10007705 3300005289 Bacteria 3447
5 Ga0065712_10085254 3300005290 Unclassified 2708
6 Ga0065707_10006048 3300005295 Bacteria 4025
7 Ga0070676_10018549 3300005328 Bacteria 3858
8 Ga0070683_100020229 3300005329 Bacteria 5922
9 Ga0070670_100001360 3300005331 Bacteria 19601
10 Ga0070670_100003192 3300005331 Bacteria 13526
11 Ga0070670_100066116 3300005331 Unclassified 3102
12 Ga0070677_10012002 3300005333 Bacteria 2997
13 Ga0068869_100005602 3300005334 Bacteria 7907
14 Ga0070666_10049078 3300005335 Bacteria 2836
15 Ga0070680_100000945 3300005336 Bacteria 20580
16 Ga0068868_100005497 3300005338 Bacteria 8914
17 Ga0070660_100074920 3300005339 Bacteria 2649
18 Ga0070689_100124272 3300005340 Bacteria 2064
19 Ga0070691_10069277 3300005341 Bacteria 1709
20 Ga0070661_100019085 3300005344 Bacteria 4882
21 Ga0070669_100007767 3300005353 Bacteria 7662
22 Ga0070669_100143429 3300005353 Bacteria 1843
23 Ga0070675_100007010 3300005354 Bacteria 8662
24 Ga0070675_100029261 3300005354 Bacteria 4441
25 Ga0070675_100129459 3300005354 Unclassified 2149
26 Ga0070671_100017476 3300005355 Bacteria 5811
27 Ga0070671_100093496 3300005355 Bacteria 2520
28 Ga0070674_100072938 3300005356 Bacteria 2432
29 Ga0070673_100039660 3300005364 Bacteria 3606
30 Ga0070673_100083611 3300005364 Bacteria 2594
31 Ga0070673_100097437 3300005364 Unclassified 2415
32 Ga0070659_100015469 3300005366 Bacteria 5715
33 Ga0070659_100063704 3300005366 Unclassified 2917
34 Ga0070667_100037888 3300005367 Unclassified 4043
35 Ga0070667_100113711 3300005367 Bacteria 2349
36 Ga0070701_10079317 3300005438 Bacteria 1773
37 Ga0070700_100024584 3300005441 Bacteria 3539
38 Ga0070700_100115897 3300005441 Unclassified 1788
39 Ga0070694_100000752 3300005444 Bacteria 18145
40 Ga0070663_100042222 3300005455 Unclassified 3204
41 Ga0070678_100011696 3300005456 Bacteria 5426
42 Ga0070678_100046839 3300005456 Bacteria 3104
43 Ga0070662_100007798 3300005457 Bacteria 6956
44 Ga0068867_100111892 3300005459 Bacteria 2099
45 Ga0070706_100027628 3300005467 Bacteria 5220
46 Ga0070707_100055357 3300005468 Bacteria 3803
47 Ga0070698_100012240 3300005471 Bacteria 9088
48 Ga0070698_100019310 3300005471 Bacteria 7159
49 Ga0070684_100095280 3300005535 Bacteria 2652
50 Ga0070684_100194140 3300005535 Bacteria 1848
51 Ga0070697_100040573 3300005536 Bacteria 3767
52 Ga0070672_100043252 3300005543 Bacteria 3472
53 Ga0070672_100044683 3300005543 Bacteria 3423
54 Ga0070686_100075268 3300005544 Bacteria 2220
55 Ga0070695_100002757 3300005545 Bacteria 10190
56 Ga0070695_100118589 3300005545 Bacteria 1807
57 Ga0070696_100014220 3300005546 Bacteria 5340
58 Ga0070665_100010372 3300005548 Bacteria 9428
59 Ga0070665_100043129 3300005548 Bacteria 4534
60 Ga0070665_100196316 3300005548 Unclassified 2019
61 Ga0070704_100031757 3300005549 Bacteria 3556
62 Ga0068855_100042120 3300005563 Bacteria 5411
63 Ga0070664_100114339 3300005564 Unclassified 2358
64 Ga0068857_100144727 3300005577 Bacteria 2150
65 Ga0068854_100213178 3300005578 Bacteria 1524
66 Ga0068856_100000927 3300005614 Bacteria 31426
67 Ga0070702_100123316 3300005615 Unclassified 1625
68 Ga0070702_100137763 3300005615 Bacteria 1551
69 Ga0068852_100000327 3300005616 Bacteria 32309
70 Ga0068859_100009890 3300005617 Bacteria 9633
71 Ga0068859_100106715 3300005617 Bacteria 2860
72 Ga0068864_100002461 3300005618 Bacteria 15287
73 Ga0068864_100005841 3300005618 Bacteria 10094
74 Ga0068864_100012961 3300005618 Bacteria 6898
75 Ga0068864_100114665 3300005618 Bacteria 2403
76 Ga0068861_100009651 3300005719 Bacteria 6667
77 Ga0068870_10000851 3300005840 Bacteria 11914
78 Ga0068863_100014946 3300005841 Bacteria 7456
79 Ga0068863_100181420 3300005841 Bacteria 2021
80 Ga0068858_100009725 3300005842 Bacteria 9157
81 Ga0068858_100068257 3300005842 Bacteria 3294
82 Ga0068858_100154188 3300005842 Bacteria 2161
83 Ga0068860_100007213 3300005843 Bacteria 11113
84 Ga0068860_100016453 3300005843 Bacteria 7211
85 Ga0068860_100029548 3300005843 Bacteria 5273
86 Ga0068860_100322203 3300005843 Bacteria 1517
87 Ga0068862_100006104 3300005844 Bacteria 10029
88 Ga0081455_10008884 3300005937 Bacteria 10390
89 Ga0075366_10012073 3300006195 Bacteria 4892
90 Ga0097621_100002385 3300006237 Bacteria 12874
91 Ga0097621_100006498 3300006237 Bacteria 8303
92 Ga0068871_100001823 3300006358 Bacteria 14382
93 Ga0068871_100113548 3300006358 Bacteria 2281
94 Ga0075430_100137135 3300006846 Bacteria 2038
95 Ga0075431_100039583 3300006847 Unclassified 4856
96 Ga0075433_10002634 3300006852 Bacteria 13703
97 Ga0075434_100001889 3300006871 Bacteria 18128
98 Ga0075434_100042410 3300006871 Bacteria 4511
99 Ga0075434_100177782 3300006871 Bacteria 2148
100 Ga0075429_100059388 3300006880 Unclassified 3331
101 Ga0068865_100097323 3300006881 Bacteria 2148
102 Ga0097620_100009891 3300006931 Bacteria 9633
103 Ga0097620_100106719 3300006931 Bacteria 2860
104 Ga0075435_100001631 3300007076 Bacteria 14529
105 Ga0075435_100251274 3300007076 Bacteria 1505
106 Ga0111539_10132566 3300009094 Bacteria 2918
107 Ga0105245_10004594 3300009098 Bacteria 12190
108 Ga0105245_10318939 3300009098 Unclassified 1530
109 Ga0114129_10002115 3300009147 Bacteria 27362
110 Ga0114129_10156613 3300009147 Bacteria 3114
111 Ga0105243_10051819 3300009148 Bacteria 3247
112 Ga0105242_10091985 3300009176 Bacteria 2555
113 Ga0105248_10004867 3300009177 Bacteria 14862
114 Ga0105248_10066158 3300009177 Bacteria 4058
115 Ga0105248_10110066 3300009177 Bacteria 3106
116 Ga0105237_10104533 3300009545 Unclassified 2824
117 Ga0105249_10028581 3300009553 Bacteria 5033
118 Ga0105239_10000659 3300010375 Bacteria 49123
119 Ga0105246_10047669 3300011119 Bacteria 2927
120 Ga0157371_10063217 3300013102 Unclassified 2624
121 Ga0157370_10130962 3300013104 Unclassified 2339
122 Ga0157369_10045519 3300013105 Bacteria 4772
123 Ga0157369_10231575 3300013105 Unclassified 1931
124 Ga0157369_10235743 3300013105 Bacteria 1912
125 Ga0157374_10000481 3300013296 Bacteria 36260
126 Ga0157374_10080593 3300013296 Bacteria 3088
127 Ga0157378_10002117 3300013297 Bacteria 17676
128 Ga0157378_10048286 3300013297 Bacteria 3784
129 Ga0157378_10093473 3300013297 Bacteria 2737
130 Ga0163162_10003516 3300013306 Bacteria 14983
131 Ga0163162_10003922 3300013306 Bacteria 14284
132 Ga0163162_10016263 3300013306 Bacteria 7274
133 Ga0157372_10034655 3300013307 Bacteria 5552
134 Ga0157372_10107986 3300013307 Bacteria 3185
135 Ga0157372_10156965 3300013307 Bacteria 2628
136 Ga0157375_10006375 3300013308 Bacteria 10285
137 Ga0157375_10007132 3300013308 Bacteria 9765
138 Ga0157375_10028545 3300013308 Bacteria 5233
139 Ga0157375_10044298 3300013308 Bacteria 4322
140 Ga0157375_10181094 3300013308 Bacteria 2258
141 Ga0163163_10000324 3300014325 Bacteria 46281
142 Ga0163163_10000948 3300014325 Bacteria 24607
143 Ga0163163_10004255 3300014325 Bacteria 12199
144 Ga0163163_10029027 3300014325 Bacteria 5318
145 Ga0163163_10034726 3300014325 Unclassified 4886
146 Ga0163163_10044297 3300014325 Bacteria 4365
147 Ga0163163_10057799 3300014325 Bacteria 3836
148 Ga0157380_10003798 3300014326 Bacteria 10390
149 Ga0157380_10044187 3300014326 Bacteria 3490
150 Ga0157377_10016150 3300014745 Bacteria 3836
151 Ga0157377_10117351 3300014745 Bacteria 1608
152 Ga0157376_10138479 3300014969 Bacteria 2181
153 Ga0182005_1000081 3300015265 Bacteria 73899
154 Ga0163161_10008544 3300017792 Bacteria 7083
155 Ga0163161_10038259 3300017792 Bacteria 3441
156 Ga0213872_10015457 3300021361 Bacteria 3547
157 Ga0213876_10067652 3300021384 Bacteria 1887
158 Ga0209436_101278 3300025208 Bacteria 9012
159 Ga0209233_1000013 3300025261 Bacteria 1013785
160 Ga0209130_1006256 3300025284 Bacteria 3908
161 Ga0207426_1000405 3300025302 Bacteria 72535
162 Ga0207426_1027333 3300025302 Bacteria 1901
163 Ga0207697_10015494 3300025315 Bacteria 3149
164 Ga0207682_10007591 3300025893 Bacteria 4319
165 Ga0207688_10031542 3300025901 Bacteria 2926
166 Ga0207647_10000562 3300025904 Bacteria 29264
167 Ga0207643_10010372 3300025908 Bacteria 5017
168 Ga0207684_10015147 3300025910 Bacteria 6639
169 Ga0207660_10000003 3300025917 Bacteria 675759
170 Ga0207662_10010405 3300025918 Bacteria 5137
171 Ga0207662_10050751 3300025918 Bacteria 2466
172 Ga0207649_10011308 3300025920 Bacteria 4919
173 Ga0207681_10087027 3300025923 Bacteria 2222
174 Ga0207650_10018828 3300025925 Bacteria 4849
175 Ga0207659_10121125 3300025926 Bacteria 2005
176 Ga0207644_10007809 3300025931 Bacteria 6989
177 Ga0207644_10024139 3300025931 Bacteria 4172
178 Ga0207690_10096113 3300025932 Unclassified 2106
179 Ga0207709_10041309 3300025935 Bacteria 2767
180 Ga0207704_10005926 3300025938 Bacteria 5662
181 Ga0207691_10000695 3300025940 Bacteria 33266
182 Ga0207691_10003534 3300025940 Bacteria 15200
183 Ga0207711_10025439 3300025941 Unclassified 4967
184 Ga0207689_10002476 3300025942 Bacteria 17166
185 Ga0207689_10012128 3300025942 Bacteria 7376
186 Ga0207661_10045470 3300025944 Bacteria 3475
187 Ga0207679_10005433 3300025945 Bacteria 7982
188 Ga0207679_10022116 3300025945 Bacteria 4324
189 Ga0207667_10045900 3300025949 Bacteria 4626
190 Ga0207667_10118346 3300025949 Bacteria 2730
191 Ga0207712_10020031 3300025961 Bacteria 4377
192 Ga0207712_10064952 3300025961 Bacteria 2603
193 Ga0207668_10062463 3300025972 Bacteria 2622
194 Ga0207668_10106962 3300025972 Bacteria 2091
195 Ga0207677_10031392 3300026023 Unclassified 3402
196 Ga0207703_10052921 3300026035 Unclassified 3299
197 Ga0207703_10111493 3300026035 Bacteria 2335
198 Ga0207678_10045879 3300026067 Bacteria 3779
199 Ga0207678_10092372 3300026067 Unclassified 2587
200 Ga0207708_10041706 3300026075 Bacteria 3498
201 Ga0207702_10000464 3300026078 Bacteria 45961
202 Ga0207641_10103455 3300026088 Bacteria 2512
203 Ga0207641_10201537 3300026088 Bacteria 1835
204 Ga0207648_10011998 3300026089 Bacteria 8132
205 Ga0207676_10012280 3300026095 Bacteria 6131
206 Ga0207676_10040870 3300026095 Unclassified 3556
207 Ga0207676_10044532 3300026095 Bacteria 3424
208 Ga0207674_10168843 3300026116 Bacteria 2141
209 Ga0207675_100002216 3300026118 Bacteria 19310
210 Ga0207683_10002146 3300026121 Bacteria 17336
211 Ga0207683_10006033 3300026121 Bacteria 10373
212 Ga0207698_10008183 3300026142 Bacteria 6594
213 Ga0268266_10039836 3300028379 Bacteria 4003
214 Ga0268266_10128195 3300028379 Unclassified 2267
215 Ga0268265_10011333 3300028380 Bacteria 6029
216 Ga0268264_10018868 3300028381 Bacteria 5639
217 Ga0268264_10052317 3300028381 Unclassified 3405
218 Ga0265323_10000045 3300028653 Bacteria 67774
219 Ga0307414_10001007 3300032004 Bacteria 14394
220 Ga0307414_10202495 3300032004 Unclassified 1616
221 Ga0373937_0019798 3300036401 Bacteria 6028
222 Ga0395900_0110537 3300037418 Bacteria 2823
223 Ga0395898_0079871 3300037466 Bacteria 3155
224 Ga0395905_0117738 3300037471 Bacteria 2497
225 Ga0395905_0251458 3300037471 Bacteria 1651
226 Ga0395901_0060724 3300038443 Bacteria 3934
227 Ga0436365_1428541 3300039437 Bacteria 2001
228 Ga0436361_0057578 3300039447 Bacteria 25808
229 Ga0451577_0003600 3300042876 Bacteria 17033
230 Ga0453684_0000003 3300044712 Bacteria 1481694
231 Ga0453684_0000023 3300044712 Bacteria 857153
232 Ga0453684_0000443 3300044712 Bacteria 168617
233 Ga0453684_0163784 3300044712 Bacteria 2627
234 Ga0453684_0168736 3300044712 Bacteria 2581
235 Ga0453684_0302610 3300044712 Bacteria 1817
236 Ga0451576_0024746 3300045051 Bacteria 6480
237 Ga0495668_0005889 3300046616 Bacteria 8163
238 Ga0496109_0137584 3300048912 Unclassified 2283
239 Ga0501033_0102073 3300049570 Bacteria 2092
240 Ga0501033_0160407 3300049570 Bacteria 1619
241 Ga0501034_0032731 3300049571 Bacteria 5280
242 Ga0501038_0090727 3300049574 Bacteria 2561
243 Ga0501042_0119023 3300049578 Bacteria 1901
244 Ga0501047_0104081 3300049581 Bacteria 2719
245 Ga0501048_0015309 3300049582 Bacteria 5664
246 Ga0501070_0020126 3300049586 Bacteria 5598
247 Ga0501071_0161858 3300049587 Bacteria 1673
248 Ga0501074_0151967 3300049590 Bacteria 1655
249 Ga0501077_0017141 3300049593 Bacteria 4568
250 Ga0501219_000006 3300049703 Bacteria 30970
251 Ga0501079_0080055 3300049741 Bacteria 2526
252 Ga0501079_0102040 3300049741 Bacteria 2225
253 Ga0501045_0015804 3300049824 Bacteria 5354
254 Ga0501284_00062 3300050005 Bacteria 37409
255 nmdc:mga0k408_78_c1 3300050493 Bacteria 45819
256 nmdc:mga05p37_135427_c1 3300050507 Bacteria 3021
257 nmdc:mga05p37_9840_c1 3300050507 Bacteria 11349
258 nmdc:mga09592_116601_c1 3300050508 Unclassified 2292
259 nmdc:mga0qj67_40341_c1 3300050509 Bacteria 3669
260 nmdc:mga06r32_34190_c1 3300050510 Unclassified 4793
261 nmdc:mga0n895_5086_c1 3300050512 Bacteria 10923
262 nmdc:mga0rr50_41990_c1 3300050513 Bacteria 3337
263 nmdc:mga08x19_31607_c1 3300050514 Bacteria 3331
264 nmdc:mga0a205_614_c1 3300050515 Bacteria 28379
265 Ga0500645_008440 3300053730 Bacteria 3519
266 Ga0501082_0071413 3300060353 Bacteria 2990

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10067652 Ga0213876_100676523 324
2 3300050514 nmdc:mga08x19_31607_c1 nmdc:mga08x19_31607_c1_2180_3319 330
3 3300006195 Ga0075366_10012073 Ga0075366_100120734 347
4 3300050493 nmdc:mga0k408_78_c1 nmdc:mga0k408_78_c1_24801_26057 347
5 3300049578 Ga0501042_0119023 Ga0501042_0119023_570_1802 350
6 3300050509 nmdc:mga0qj67_40341_c1 nmdc:mga0qj67_40341_c1_250_1494 351
7 3300037418 Ga0395900_0110537 Ga0395900_0110537_1522_2799 358
8 3300037466 Ga0395898_0079871 Ga0395898_0079871_647_1924 358
9 3300038443 Ga0395901_0060724 Ga0395901_0060724_20_1297 358
10 iso_pu_bacteria 2818991442 2819573281 361
11 iso_pu_bacteria 2821136567 2821136696 361
12 iso_pu_bacteria 2904467357 2904468559 361
13 3300037471 Ga0395905_0251458 Ga0395905_0251458_315_1586 364
14 3300005262 Ga0065165_1008967 Ga0065165_10089675 365
15 3300005339 Ga0070660_100074920 Ga0070660_1000749202 365
16 3300005548 Ga0070665_100043129 Ga0070665_1000431292 365
17 3300005563 Ga0068855_100042120 Ga0068855_1000421202 365
18 3300005614 Ga0068856_100000927 Ga0068856_10000092724 365
19 3300005617 Ga0068859_100106715 Ga0068859_1001067152 365
20 3300005618 Ga0068864_100012961 Ga0068864_1000129615 365
21 3300005842 Ga0068858_100154188 Ga0068858_1001541882 365
22 3300006881 Ga0068865_100097323 Ga0068865_1000973232 365
23 3300006931 Ga0097620_100106719 Ga0097620_1001067192 365
24 3300009553 Ga0105249_10028581 Ga0105249_100285813 365
25 3300013306 Ga0163162_10016263 Ga0163162_100162633 365
26 3300013308 Ga0157375_10006375 Ga0157375_100063755 365
27 3300014325 Ga0163163_10044297 Ga0163163_100442974 365
28 3300014745 Ga0157377_10016150 Ga0157377_100161503 365
29 3300015265 Ga0182005_1000081 Ga0182005_100008156 365
30 3300017792 Ga0163161_10038259 Ga0163161_100382593 365
31 3300025208 Ga0209436_101278 Ga0209436_1012788 365
32 3300025284 Ga0209130_1006256 Ga0209130_10062564 365
33 3300025302 Ga0207426_1000405 Ga0207426_100040552 365
34 3300025302 Ga0207426_1027333 Ga0207426_10273332 365
35 3300025893 Ga0207682_10007591 Ga0207682_100075913 365
36 3300025908 Ga0207643_10010372 Ga0207643_100103723 365
37 3300025949 Ga0207667_10045900 Ga0207667_100459003 365
38 3300025949 Ga0207667_10118346 Ga0207667_101183462 365
39 3300025972 Ga0207668_10062463 Ga0207668_100624631 365
40 3300026035 Ga0207703_10111493 Ga0207703_101114932 365
41 3300026067 Ga0207678_10045879 Ga0207678_100458792 365
42 3300026075 Ga0207708_10041706 Ga0207708_100417062 365
43 3300026078 Ga0207702_10000464 Ga0207702_100004644 365
44 3300026095 Ga0207676_10044532 Ga0207676_100445323 365
45 3300028380 Ga0268265_10011333 Ga0268265_100113333 365
46 3300044712 Ga0453684_0302610 Ga0453684_0302610_240_1532 365
47 3300053730 Ga0500645_008440 Ga0500645_008440_159_1433 366
48 3300005366 Ga0070659_100063704 Ga0070659_1000637042 367
49 3300005441 Ga0070700_100115897 Ga0070700_1001158972 367
50 3300005455 Ga0070663_100042222 Ga0070663_1000422222 367
51 3300005564 Ga0070664_100114339 Ga0070664_1001143392 367
52 3300009098 Ga0105245_10318939 Ga0105245_103189391 367
53 3300021361 Ga0213872_10015457 Ga0213872_100154572 367
54 3300025932 Ga0207690_10096113 Ga0207690_100961132 367
55 3300026067 Ga0207678_10092372 Ga0207678_100923722 367
56 3300039447 Ga0436361_0057578 Ga0436361_0057578_13323_14606 367
57 3300048912 Ga0496109_0137584 Ga0496109_0137584_129_1367 367
58 3300025925 Ga0207650_10018828 Ga0207650_100188284 368
59 3300039437 Ga0436365_1428541 Ga0436365_1428541_105_1376 368
60 3300042876 Ga0451577_0003600 Ga0451577_0003600_4196_5557 368
61 3300044712 Ga0453684_0000443 Ga0453684_0000443_90775_92136 368
62 3300046616 Ga0495668_0005889 Ga0495668_0005889_699_1958 368
63 3300005616 Ga0068852_100000327 Ga0068852_1000003273 370
64 3300013105 Ga0157369_10045519 Ga0157369_100455192 370
65 3300013307 Ga0157372_10034655 Ga0157372_100346554 370
66 3300025904 Ga0207647_10000562 Ga0207647_100005622 370
67 3300026142 Ga0207698_10008183 Ga0207698_100081836 370
68 3300044712 Ga0453684_0168736 Ga0453684_0168736_135_1409 370
69 3300005336 Ga0070680_100000945 Ga0070680_1000009457 371
70 3300005467 Ga0070706_100027628 Ga0070706_1000276283 371
71 3300005468 Ga0070707_100055357 Ga0070707_1000553573 371
72 3300005471 Ga0070698_100012240 Ga0070698_1000122409 371
73 3300005535 Ga0070684_100194140 Ga0070684_1001941402 371
74 3300005577 Ga0068857_100144727 Ga0068857_1001447272 371
75 3300009545 Ga0105237_10104533 Ga0105237_101045332 371
76 3300013307 Ga0157372_10107986 Ga0157372_101079863 371
77 3300025910 Ga0207684_10015147 Ga0207684_100151475 371
78 3300025917 Ga0207660_10000003 Ga0207660_10000003351 371
79 3300026116 Ga0207674_10168843 Ga0207674_101688432 371
80 3300037471 Ga0395905_0117738 Ga0395905_0117738_419_1705 371
81 3300005329 Ga0070683_100020229 Ga0070683_1000202292 372
82 3300005331 Ga0070670_100066116 Ga0070670_1000661162 372
83 3300005535 Ga0070684_100095280 Ga0070684_1000952802 372
84 3300013296 Ga0157374_10080593 Ga0157374_100805933 372
85 3300014325 Ga0163163_10004255 Ga0163163_100042558 372
86 3300017792 Ga0163161_10008544 Ga0163161_100085445 372
87 3300025918 Ga0207662_10050751 Ga0207662_100507512 372
88 3300025931 Ga0207644_10024139 Ga0207644_100241394 372
89 3300025944 Ga0207661_10045470 Ga0207661_100454702 372
90 3300025945 Ga0207679_10005433 Ga0207679_100054337 372
91 3300049586 Ga0501070_0020126 Ga0501070_0020126_204_1484 372
92 3300049590 Ga0501074_0151967 Ga0501074_0151967_47_1327 372
93 3300049703 Ga0501219_000006 Ga0501219_000006_2899_4167 372
94 3300050005 Ga0501284_00062 Ga0501284_00062_20429_21697 372
95 iso_pu_bacteria 2890804823 2890806969 372
96 3300005290 Ga0065712_10085254 Ga0065712_100852542 373
97 3300005335 Ga0070666_10049078 Ga0070666_100490782 373
98 3300005338 Ga0068868_100005497 Ga0068868_1000054974 373
99 3300005340 Ga0070689_100124272 Ga0070689_1001242722 373
100 3300005353 Ga0070669_100143429 Ga0070669_1001434292 373
101 3300005354 Ga0070675_100129459 Ga0070675_1001294592 373
102 3300005364 Ga0070673_100039660 Ga0070673_1000396602 373
103 3300005364 Ga0070673_100097437 Ga0070673_1000974372 373
104 3300005367 Ga0070667_100037888 Ga0070667_1000378884 373
105 3300005367 Ga0070667_100113711 Ga0070667_1001137112 373
106 3300005438 Ga0070701_10079317 Ga0070701_100793171 373
107 3300005459 Ga0068867_100111892 Ga0068867_1001118922 373
108 3300005543 Ga0070672_100043252 Ga0070672_1000432522 373
109 3300005544 Ga0070686_100075268 Ga0070686_1000752681 373
110 3300005548 Ga0070665_100196316 Ga0070665_1001963162 373
111 3300005615 Ga0070702_100123316 Ga0070702_1001233162 373
112 3300005615 Ga0070702_100137763 Ga0070702_1001377631 373
113 3300005617 Ga0068859_100009890 Ga0068859_1000098905 373
114 3300005618 Ga0068864_100005841 Ga0068864_1000058417 373
115 3300005618 Ga0068864_100114665 Ga0068864_1001146652 373
116 3300005841 Ga0068863_100181420 Ga0068863_1001814202 373
117 3300005842 Ga0068858_100009725 Ga0068858_1000097257 373
118 3300005842 Ga0068858_100068257 Ga0068858_1000682572 373
119 3300005843 Ga0068860_100029548 Ga0068860_1000295484 373
120 3300005843 Ga0068860_100322203 Ga0068860_1003222031 373
121 3300006237 Ga0097621_100002385 Ga0097621_1000023856 373
122 3300006237 Ga0097621_100006498 Ga0097621_1000064982 373
123 3300006358 Ga0068871_100001823 Ga0068871_1000018234 373
124 3300006358 Ga0068871_100113548 Ga0068871_1001135482 373
125 3300006931 Ga0097620_100009891 Ga0097620_1000098915 373
126 3300009098 Ga0105245_10004594 Ga0105245_100045945 373
127 3300009148 Ga0105243_10051819 Ga0105243_100518192 373
128 3300009176 Ga0105242_10091985 Ga0105242_100919852 373
129 3300009177 Ga0105248_10004867 Ga0105248_100048677 373
130 3300009177 Ga0105248_10110066 Ga0105248_101100662 373
131 3300013297 Ga0157378_10002117 Ga0157378_100021176 373
132 3300013297 Ga0157378_10048286 Ga0157378_100482862 373
133 3300013306 Ga0163162_10003516 Ga0163162_100035162 373
134 3300013306 Ga0163162_10003922 Ga0163162_100039227 373
135 3300013308 Ga0157375_10007132 Ga0157375_100071322 373
136 3300013308 Ga0157375_10044298 Ga0157375_100442983 373
137 3300014325 Ga0163163_10000948 Ga0163163_1000094816 373
138 3300014325 Ga0163163_10034726 Ga0163163_100347262 373
139 3300014325 Ga0163163_10057799 Ga0163163_100577992 373
140 3300014326 Ga0157380_10044187 Ga0157380_100441872 373
141 3300014745 Ga0157377_10117351 Ga0157377_101173512 373
142 3300025315 Ga0207697_10015494 Ga0207697_100154943 373
143 3300025923 Ga0207681_10087027 Ga0207681_100870272 373
144 3300025931 Ga0207644_10007809 Ga0207644_100078092 373
145 3300025935 Ga0207709_10041309 Ga0207709_100413092 373
146 3300025940 Ga0207691_10003534 Ga0207691_100035349 373
147 3300025941 Ga0207711_10025439 Ga0207711_100254393 373
148 3300025942 Ga0207689_10002476 Ga0207689_1000247611 373
149 3300025961 Ga0207712_10020031 Ga0207712_100200312 373
150 3300026023 Ga0207677_10031392 Ga0207677_100313923 373
151 3300026035 Ga0207703_10052921 Ga0207703_100529212 373
152 3300026088 Ga0207641_10103455 Ga0207641_101034552 373
153 3300026088 Ga0207641_10201537 Ga0207641_102015371 373
154 3300026089 Ga0207648_10011998 Ga0207648_100119985 373
155 3300026095 Ga0207676_10040870 Ga0207676_100408703 373
156 3300028379 Ga0268266_10128195 Ga0268266_101281952 373
157 3300028381 Ga0268264_10018868 Ga0268264_100188684 373
158 3300028381 Ga0268264_10052317 Ga0268264_100523172 373
159 3300036401 Ga0373937_0019798 Ga0373937_0019798_113_1360 373
160 3300044712 Ga0453684_0000003 Ga0453684_0000003_434477_435775 373
161 3300005295 Ga0065707_10006048 Ga0065707_100060483 374
162 3300005471 Ga0070698_100019310 Ga0070698_1000193105 374
163 3300005546 Ga0070696_100014220 Ga0070696_1000142202 374
164 3300005549 Ga0070704_100031757 Ga0070704_1000317573 374
165 3300014325 Ga0163163_10000324 Ga0163163_1000032437 374
166 3300049570 Ga0501033_0102073 Ga0501033_0102073_408_1703 374
167 3300049571 Ga0501034_0032731 Ga0501034_0032731_1542_2837 374
168 3300049581 Ga0501047_0104081 Ga0501047_0104081_1171_2466 374
169 3300049593 Ga0501077_0017141 Ga0501077_0017141_1627_2919 374
170 3300049741 Ga0501079_0080055 Ga0501079_0080055_1075_2361 374
171 3300011119 Ga0105246_10047669 Ga0105246_100476693 375
172 3300032004 Ga0307414_10001007 Ga0307414_100010076 376
173 3300003320 rootH2_10345619 rootH2_103456191 377
174 3300005289 Ga0065704_10007705 Ga0065704_100077052 377
175 3300005355 Ga0070671_100017476 Ga0070671_1000174764 377
176 3300005543 Ga0070672_100044683 Ga0070672_1000446832 377
177 3300005578 Ga0068854_100213178 Ga0068854_1002131781 377
178 3300005937 Ga0081455_10008884 Ga0081455_100088843 377
179 3300006847 Ga0075431_100039583 Ga0075431_1000395833 377
180 3300006871 Ga0075434_100042410 Ga0075434_1000424102 377
181 3300006880 Ga0075429_100059388 Ga0075429_1000593883 377
182 3300009147 Ga0114129_10156613 Ga0114129_101566133 377
183 3300028653 Ga0265323_10000045 Ga0265323_100000456 377
184 3300050507 nmdc:mga05p37_135427_c1 nmdc:mga05p37_135427_c1_563_1882 377
185 3300050508 nmdc:mga09592_116601_c1 nmdc:mga09592_116601_c1_697_1968 377
186 3300050510 nmdc:mga06r32_34190_c1 nmdc:mga06r32_34190_c1_344_1615 377
187 3300005328 Ga0070676_10018549 Ga0070676_100185492 378
188 3300005331 Ga0070670_100001360 Ga0070670_1000013603 378
189 3300005331 Ga0070670_100003192 Ga0070670_1000031922 378
190 3300005333 Ga0070677_10012002 Ga0070677_100120023 378
191 3300005334 Ga0068869_100005602 Ga0068869_1000056026 378
192 3300005344 Ga0070661_100019085 Ga0070661_1000190853 378
193 3300005353 Ga0070669_100007767 Ga0070669_1000077673 378
194 3300005354 Ga0070675_100007010 Ga0070675_1000070106 378
195 3300005354 Ga0070675_100029261 Ga0070675_1000292612 378
196 3300005355 Ga0070671_100093496 Ga0070671_1000934962 378
197 3300005356 Ga0070674_100072938 Ga0070674_1000729382 378
198 3300005364 Ga0070673_100083611 Ga0070673_1000836113 378
199 3300005366 Ga0070659_100015469 Ga0070659_1000154692 378
200 3300005441 Ga0070700_100024584 Ga0070700_1000245843 378
201 3300005456 Ga0070678_100011696 Ga0070678_1000116962 378
202 3300005456 Ga0070678_100046839 Ga0070678_1000468392 378
203 3300005457 Ga0070662_100007798 Ga0070662_1000077984 378
204 3300005545 Ga0070695_100118589 Ga0070695_1001185892 378
205 3300005548 Ga0070665_100010372 Ga0070665_1000103728 378
206 3300005618 Ga0068864_100002461 Ga0068864_1000024613 378
207 3300005719 Ga0068861_100009651 Ga0068861_1000096514 378
208 3300005840 Ga0068870_10000851 Ga0068870_1000085110 378
209 3300005841 Ga0068863_100014946 Ga0068863_1000149463 378
210 3300005843 Ga0068860_100016453 Ga0068860_1000164535 378
211 3300005844 Ga0068862_100006104 Ga0068862_1000061048 378
212 3300009094 Ga0111539_10132566 Ga0111539_101325662 378
213 3300009177 Ga0105248_10066158 Ga0105248_100661582 378
214 3300013296 Ga0157374_10000481 Ga0157374_1000048115 378
215 3300013297 Ga0157378_10093473 Ga0157378_100934733 378
216 3300013308 Ga0157375_10028545 Ga0157375_100285455 378
217 3300013308 Ga0157375_10181094 Ga0157375_101810942 378
218 3300014325 Ga0163163_10029027 Ga0163163_100290274 378
219 3300014326 Ga0157380_10003798 Ga0157380_100037985 378
220 3300014969 Ga0157376_10138479 Ga0157376_101384792 378
221 3300025901 Ga0207688_10031542 Ga0207688_100315421 378
222 3300025918 Ga0207662_10010405 Ga0207662_100104052 378
223 3300025920 Ga0207649_10011308 Ga0207649_100113083 378
224 3300025926 Ga0207659_10121125 Ga0207659_101211252 378
225 3300025938 Ga0207704_10005926 Ga0207704_100059262 378
226 3300025940 Ga0207691_10000695 Ga0207691_1000069524 378
227 3300025942 Ga0207689_10012128 Ga0207689_100121282 378
228 3300025945 Ga0207679_10022116 Ga0207679_100221162 378
229 3300025961 Ga0207712_10064952 Ga0207712_100649522 378
230 3300025972 Ga0207668_10106962 Ga0207668_101069622 378
231 3300026095 Ga0207676_10012280 Ga0207676_100122802 378
232 3300026118 Ga0207675_100002216 Ga0207675_1000022167 378
233 3300026121 Ga0207683_10002146 Ga0207683_1000214612 378
234 3300026121 Ga0207683_10006033 Ga0207683_100060332 378
235 3300028379 Ga0268266_10039836 Ga0268266_100398362 378
236 3300032004 Ga0307414_10202495 Ga0307414_102024952 378
237 3300006846 Ga0075430_100137135 Ga0075430_1001371352 379
238 3300006871 Ga0075434_100177782 Ga0075434_1001777822 379
239 3300007076 Ga0075435_100251274 Ga0075435_1002512741 379
240 3300010375 Ga0105239_10000659 Ga0105239_1000065916 379
241 3300013102 Ga0157371_10063217 Ga0157371_100632172 379
242 3300013104 Ga0157370_10130962 Ga0157370_101309622 379
243 3300013105 Ga0157369_10231575 Ga0157369_102315752 379
244 3300013105 Ga0157369_10235743 Ga0157369_102357431 379
245 3300013307 Ga0157372_10156965 Ga0157372_101569652 379
246 3300049570 Ga0501033_0160407 Ga0501033_0160407_127_1461 379
247 3300049574 Ga0501038_0090727 Ga0501038_0090727_812_2146 379
248 3300049582 Ga0501048_0015309 Ga0501048_0015309_1853_3187 379
249 3300049587 Ga0501071_0161858 Ga0501071_0161858_96_1430 379
250 3300049824 Ga0501045_0015804 Ga0501045_0015804_1338_2672 379
251 3300060353 Ga0501082_0071413 Ga0501082_0071413_419_1753 379
252 3300005843 Ga0068860_100007213 Ga0068860_1000072139 380
253 3300006852 Ga0075433_10002634 Ga0075433_100026343 380
254 3300006871 Ga0075434_100001889 Ga0075434_1000018895 380
255 3300007076 Ga0075435_100001631 Ga0075435_1000016315 380
256 3300009147 Ga0114129_10002115 Ga0114129_1000211510 380
257 3300044712 Ga0453684_0163784 Ga0453684_0163784_137_1420 380
258 3300050507 nmdc:mga05p37_9840_c1 nmdc:mga05p37_9840_c1_9939_11294 380
259 3300050512 nmdc:mga0n895_5086_c1 nmdc:mga0n895_5086_c1_4392_5747 380
260 3300050513 nmdc:mga0rr50_41990_c1 nmdc:mga0rr50_41990_c1_1298_2653 380
261 3300050515 nmdc:mga0a205_614_c1 nmdc:mga0a205_614_c1_16130_17485 380
262 3300049741 Ga0501079_0102040 Ga0501079_0102040_800_2113 381
263 3300005341 Ga0070691_10069277 Ga0070691_100692772 382
264 3300005444 Ga0070694_100000752 Ga0070694_1000007525 382
265 3300005536 Ga0070697_100040573 Ga0070697_1000405733 382
266 3300005545 Ga0070695_100002757 Ga0070695_1000027574 382
267 3300044712 Ga0453684_0000023 Ga0453684_0000023_647803_649110 382
268 3300045051 Ga0451576_0024746 Ga0451576_0024746_4987_6318 382
269 3300003214 JGI25165J46597_1000013 JGI25165J46597_100001345 398
270 3300025261 Ga0209233_1000013 Ga0209233_1000013299 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

57

190

0.9

PF00005

ABC_tran

ABC transporter

317

454

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dd0-assembly1.cif.gz_C crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.9392 1 241
7dd0-assembly1.cif.gz_A crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.9324 1 241
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.9263 1 241
7dd0-assembly2.cif.gz_B crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8943 4 241
6o14-assembly1.cif.gz_A crystal structure of the aquifex aeolicus wzt carbohydrate binding domain 0.8857 251 374
ID Description Score Start End Superfamily
af_P72047_42_272_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9039 52 242 3.40.50.300
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8994 6 240 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8919 4 241 3.40.50.300
af_X2JG15_1642_1882_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8676 4 240 3.40.50.300
af_A0A1D6DXP2_296_452_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8657 99 215 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A839ZFQ2-F1-model_v4 Capsular polysaccharide transport system ATP-binding protein 0.8911 4 245 GO:0005524
GO:0016887
AF-Q93UJ9-F1-model_v4 Wzt2 0.8875 9 241 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-A0A1X7MNH7-F1-model_v4 deleted 0.8873 4 241
AF-A0A7V5VXK5-F1-model_v4 ABC transporter ATP-binding protein 0.8777 4 240 GO:0005524
GO:0016887
AF-A0A7Z0RNF7-F1-model_v4 deleted 0.8727 6 240

Feature Viewer

pLDDT pTM Quality
77.19 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map