F377020
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 182 | 266 | 428 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10168843|Ga0207674_101688432 |
| Length | 456 |
| Sequence | MEEIVLSVENLSKQYRLGKIGTGSLRQDISYWWKYSVLKKPDPFFYSEEDERFLWALKDVSFNLKKGEALGIIGSNGSGKSTLLKIISRITSPTKGHVRGKGTVSSILEIGTGFHPELSGRENIFMSGYALGMTKEEIKKKFDEIVAFSGIEKFVDTPVKRYSSGMYVRLAFSVAAHLEPDILIIDEVLAVGDVEFQKKCMGKMQDVSAAKGRTILFVSHNMTAITNLCSKTIWLDKGVIKQTGLSKDVVKSYLEKFAQPIAPKEWKEPESAPGNDLIRLKRTSVEAAEQSFISVATAIKICCEFWCFAEGFTINANVSLNGEQGECVFNLGSSSVEAQHSVLSLDVVIPPRLLNNQTYTISLTVVKNHSEPLFEFSNCLSFEVQDERQNMNYFGAWPGVIRPVINNDLRIKEILEGVGLPDSVDKMPSELSGGMRKRIGLARTMIMQPEIMLYAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 2 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 3 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 4 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 169 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 172 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 182 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.52 |
| Metatranscriptomes | 0 |
| Isolates | 1.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.7 |
| Nodule | 0 |
| Rhizoplane | 0.37 |
| Rhizosphere | 93.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000013 | 3300003214 | Bacteria | 402100 |
| 2 | rootH2_10345619 | 3300003320 | Bacteria | 1395 |
| 3 | Ga0065165_1008967 | 3300005262 | Bacteria | 4577 |
| 4 | Ga0065704_10007705 | 3300005289 | Bacteria | 3447 |
| 5 | Ga0065712_10085254 | 3300005290 | Unclassified | 2708 |
| 6 | Ga0065707_10006048 | 3300005295 | Bacteria | 4025 |
| 7 | Ga0070676_10018549 | 3300005328 | Bacteria | 3858 |
| 8 | Ga0070683_100020229 | 3300005329 | Bacteria | 5922 |
| 9 | Ga0070670_100001360 | 3300005331 | Bacteria | 19601 |
| 10 | Ga0070670_100003192 | 3300005331 | Bacteria | 13526 |
| 11 | Ga0070670_100066116 | 3300005331 | Unclassified | 3102 |
| 12 | Ga0070677_10012002 | 3300005333 | Bacteria | 2997 |
| 13 | Ga0068869_100005602 | 3300005334 | Bacteria | 7907 |
| 14 | Ga0070666_10049078 | 3300005335 | Bacteria | 2836 |
| 15 | Ga0070680_100000945 | 3300005336 | Bacteria | 20580 |
| 16 | Ga0068868_100005497 | 3300005338 | Bacteria | 8914 |
| 17 | Ga0070660_100074920 | 3300005339 | Bacteria | 2649 |
| 18 | Ga0070689_100124272 | 3300005340 | Bacteria | 2064 |
| 19 | Ga0070691_10069277 | 3300005341 | Bacteria | 1709 |
| 20 | Ga0070661_100019085 | 3300005344 | Bacteria | 4882 |
| 21 | Ga0070669_100007767 | 3300005353 | Bacteria | 7662 |
| 22 | Ga0070669_100143429 | 3300005353 | Bacteria | 1843 |
| 23 | Ga0070675_100007010 | 3300005354 | Bacteria | 8662 |
| 24 | Ga0070675_100029261 | 3300005354 | Bacteria | 4441 |
| 25 | Ga0070675_100129459 | 3300005354 | Unclassified | 2149 |
| 26 | Ga0070671_100017476 | 3300005355 | Bacteria | 5811 |
| 27 | Ga0070671_100093496 | 3300005355 | Bacteria | 2520 |
| 28 | Ga0070674_100072938 | 3300005356 | Bacteria | 2432 |
| 29 | Ga0070673_100039660 | 3300005364 | Bacteria | 3606 |
| 30 | Ga0070673_100083611 | 3300005364 | Bacteria | 2594 |
| 31 | Ga0070673_100097437 | 3300005364 | Unclassified | 2415 |
| 32 | Ga0070659_100015469 | 3300005366 | Bacteria | 5715 |
| 33 | Ga0070659_100063704 | 3300005366 | Unclassified | 2917 |
| 34 | Ga0070667_100037888 | 3300005367 | Unclassified | 4043 |
| 35 | Ga0070667_100113711 | 3300005367 | Bacteria | 2349 |
| 36 | Ga0070701_10079317 | 3300005438 | Bacteria | 1773 |
| 37 | Ga0070700_100024584 | 3300005441 | Bacteria | 3539 |
| 38 | Ga0070700_100115897 | 3300005441 | Unclassified | 1788 |
| 39 | Ga0070694_100000752 | 3300005444 | Bacteria | 18145 |
| 40 | Ga0070663_100042222 | 3300005455 | Unclassified | 3204 |
| 41 | Ga0070678_100011696 | 3300005456 | Bacteria | 5426 |
| 42 | Ga0070678_100046839 | 3300005456 | Bacteria | 3104 |
| 43 | Ga0070662_100007798 | 3300005457 | Bacteria | 6956 |
| 44 | Ga0068867_100111892 | 3300005459 | Bacteria | 2099 |
| 45 | Ga0070706_100027628 | 3300005467 | Bacteria | 5220 |
| 46 | Ga0070707_100055357 | 3300005468 | Bacteria | 3803 |
| 47 | Ga0070698_100012240 | 3300005471 | Bacteria | 9088 |
| 48 | Ga0070698_100019310 | 3300005471 | Bacteria | 7159 |
| 49 | Ga0070684_100095280 | 3300005535 | Bacteria | 2652 |
| 50 | Ga0070684_100194140 | 3300005535 | Bacteria | 1848 |
| 51 | Ga0070697_100040573 | 3300005536 | Bacteria | 3767 |
| 52 | Ga0070672_100043252 | 3300005543 | Bacteria | 3472 |
| 53 | Ga0070672_100044683 | 3300005543 | Bacteria | 3423 |
| 54 | Ga0070686_100075268 | 3300005544 | Bacteria | 2220 |
| 55 | Ga0070695_100002757 | 3300005545 | Bacteria | 10190 |
| 56 | Ga0070695_100118589 | 3300005545 | Bacteria | 1807 |
| 57 | Ga0070696_100014220 | 3300005546 | Bacteria | 5340 |
| 58 | Ga0070665_100010372 | 3300005548 | Bacteria | 9428 |
| 59 | Ga0070665_100043129 | 3300005548 | Bacteria | 4534 |
| 60 | Ga0070665_100196316 | 3300005548 | Unclassified | 2019 |
| 61 | Ga0070704_100031757 | 3300005549 | Bacteria | 3556 |
| 62 | Ga0068855_100042120 | 3300005563 | Bacteria | 5411 |
| 63 | Ga0070664_100114339 | 3300005564 | Unclassified | 2358 |
| 64 | Ga0068857_100144727 | 3300005577 | Bacteria | 2150 |
| 65 | Ga0068854_100213178 | 3300005578 | Bacteria | 1524 |
| 66 | Ga0068856_100000927 | 3300005614 | Bacteria | 31426 |
| 67 | Ga0070702_100123316 | 3300005615 | Unclassified | 1625 |
| 68 | Ga0070702_100137763 | 3300005615 | Bacteria | 1551 |
| 69 | Ga0068852_100000327 | 3300005616 | Bacteria | 32309 |
| 70 | Ga0068859_100009890 | 3300005617 | Bacteria | 9633 |
| 71 | Ga0068859_100106715 | 3300005617 | Bacteria | 2860 |
| 72 | Ga0068864_100002461 | 3300005618 | Bacteria | 15287 |
| 73 | Ga0068864_100005841 | 3300005618 | Bacteria | 10094 |
| 74 | Ga0068864_100012961 | 3300005618 | Bacteria | 6898 |
| 75 | Ga0068864_100114665 | 3300005618 | Bacteria | 2403 |
| 76 | Ga0068861_100009651 | 3300005719 | Bacteria | 6667 |
| 77 | Ga0068870_10000851 | 3300005840 | Bacteria | 11914 |
| 78 | Ga0068863_100014946 | 3300005841 | Bacteria | 7456 |
| 79 | Ga0068863_100181420 | 3300005841 | Bacteria | 2021 |
| 80 | Ga0068858_100009725 | 3300005842 | Bacteria | 9157 |
| 81 | Ga0068858_100068257 | 3300005842 | Bacteria | 3294 |
| 82 | Ga0068858_100154188 | 3300005842 | Bacteria | 2161 |
| 83 | Ga0068860_100007213 | 3300005843 | Bacteria | 11113 |
| 84 | Ga0068860_100016453 | 3300005843 | Bacteria | 7211 |
| 85 | Ga0068860_100029548 | 3300005843 | Bacteria | 5273 |
| 86 | Ga0068860_100322203 | 3300005843 | Bacteria | 1517 |
| 87 | Ga0068862_100006104 | 3300005844 | Bacteria | 10029 |
| 88 | Ga0081455_10008884 | 3300005937 | Bacteria | 10390 |
| 89 | Ga0075366_10012073 | 3300006195 | Bacteria | 4892 |
| 90 | Ga0097621_100002385 | 3300006237 | Bacteria | 12874 |
| 91 | Ga0097621_100006498 | 3300006237 | Bacteria | 8303 |
| 92 | Ga0068871_100001823 | 3300006358 | Bacteria | 14382 |
| 93 | Ga0068871_100113548 | 3300006358 | Bacteria | 2281 |
| 94 | Ga0075430_100137135 | 3300006846 | Bacteria | 2038 |
| 95 | Ga0075431_100039583 | 3300006847 | Unclassified | 4856 |
| 96 | Ga0075433_10002634 | 3300006852 | Bacteria | 13703 |
| 97 | Ga0075434_100001889 | 3300006871 | Bacteria | 18128 |
| 98 | Ga0075434_100042410 | 3300006871 | Bacteria | 4511 |
| 99 | Ga0075434_100177782 | 3300006871 | Bacteria | 2148 |
| 100 | Ga0075429_100059388 | 3300006880 | Unclassified | 3331 |
| 101 | Ga0068865_100097323 | 3300006881 | Bacteria | 2148 |
| 102 | Ga0097620_100009891 | 3300006931 | Bacteria | 9633 |
| 103 | Ga0097620_100106719 | 3300006931 | Bacteria | 2860 |
| 104 | Ga0075435_100001631 | 3300007076 | Bacteria | 14529 |
| 105 | Ga0075435_100251274 | 3300007076 | Bacteria | 1505 |
| 106 | Ga0111539_10132566 | 3300009094 | Bacteria | 2918 |
| 107 | Ga0105245_10004594 | 3300009098 | Bacteria | 12190 |
| 108 | Ga0105245_10318939 | 3300009098 | Unclassified | 1530 |
| 109 | Ga0114129_10002115 | 3300009147 | Bacteria | 27362 |
| 110 | Ga0114129_10156613 | 3300009147 | Bacteria | 3114 |
| 111 | Ga0105243_10051819 | 3300009148 | Bacteria | 3247 |
| 112 | Ga0105242_10091985 | 3300009176 | Bacteria | 2555 |
| 113 | Ga0105248_10004867 | 3300009177 | Bacteria | 14862 |
| 114 | Ga0105248_10066158 | 3300009177 | Bacteria | 4058 |
| 115 | Ga0105248_10110066 | 3300009177 | Bacteria | 3106 |
| 116 | Ga0105237_10104533 | 3300009545 | Unclassified | 2824 |
| 117 | Ga0105249_10028581 | 3300009553 | Bacteria | 5033 |
| 118 | Ga0105239_10000659 | 3300010375 | Bacteria | 49123 |
| 119 | Ga0105246_10047669 | 3300011119 | Bacteria | 2927 |
| 120 | Ga0157371_10063217 | 3300013102 | Unclassified | 2624 |
| 121 | Ga0157370_10130962 | 3300013104 | Unclassified | 2339 |
| 122 | Ga0157369_10045519 | 3300013105 | Bacteria | 4772 |
| 123 | Ga0157369_10231575 | 3300013105 | Unclassified | 1931 |
| 124 | Ga0157369_10235743 | 3300013105 | Bacteria | 1912 |
| 125 | Ga0157374_10000481 | 3300013296 | Bacteria | 36260 |
| 126 | Ga0157374_10080593 | 3300013296 | Bacteria | 3088 |
| 127 | Ga0157378_10002117 | 3300013297 | Bacteria | 17676 |
| 128 | Ga0157378_10048286 | 3300013297 | Bacteria | 3784 |
| 129 | Ga0157378_10093473 | 3300013297 | Bacteria | 2737 |
| 130 | Ga0163162_10003516 | 3300013306 | Bacteria | 14983 |
| 131 | Ga0163162_10003922 | 3300013306 | Bacteria | 14284 |
| 132 | Ga0163162_10016263 | 3300013306 | Bacteria | 7274 |
| 133 | Ga0157372_10034655 | 3300013307 | Bacteria | 5552 |
| 134 | Ga0157372_10107986 | 3300013307 | Bacteria | 3185 |
| 135 | Ga0157372_10156965 | 3300013307 | Bacteria | 2628 |
| 136 | Ga0157375_10006375 | 3300013308 | Bacteria | 10285 |
| 137 | Ga0157375_10007132 | 3300013308 | Bacteria | 9765 |
| 138 | Ga0157375_10028545 | 3300013308 | Bacteria | 5233 |
| 139 | Ga0157375_10044298 | 3300013308 | Bacteria | 4322 |
| 140 | Ga0157375_10181094 | 3300013308 | Bacteria | 2258 |
| 141 | Ga0163163_10000324 | 3300014325 | Bacteria | 46281 |
| 142 | Ga0163163_10000948 | 3300014325 | Bacteria | 24607 |
| 143 | Ga0163163_10004255 | 3300014325 | Bacteria | 12199 |
| 144 | Ga0163163_10029027 | 3300014325 | Bacteria | 5318 |
| 145 | Ga0163163_10034726 | 3300014325 | Unclassified | 4886 |
| 146 | Ga0163163_10044297 | 3300014325 | Bacteria | 4365 |
| 147 | Ga0163163_10057799 | 3300014325 | Bacteria | 3836 |
| 148 | Ga0157380_10003798 | 3300014326 | Bacteria | 10390 |
| 149 | Ga0157380_10044187 | 3300014326 | Bacteria | 3490 |
| 150 | Ga0157377_10016150 | 3300014745 | Bacteria | 3836 |
| 151 | Ga0157377_10117351 | 3300014745 | Bacteria | 1608 |
| 152 | Ga0157376_10138479 | 3300014969 | Bacteria | 2181 |
| 153 | Ga0182005_1000081 | 3300015265 | Bacteria | 73899 |
| 154 | Ga0163161_10008544 | 3300017792 | Bacteria | 7083 |
| 155 | Ga0163161_10038259 | 3300017792 | Bacteria | 3441 |
| 156 | Ga0213872_10015457 | 3300021361 | Bacteria | 3547 |
| 157 | Ga0213876_10067652 | 3300021384 | Bacteria | 1887 |
| 158 | Ga0209436_101278 | 3300025208 | Bacteria | 9012 |
| 159 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 160 | Ga0209130_1006256 | 3300025284 | Bacteria | 3908 |
| 161 | Ga0207426_1000405 | 3300025302 | Bacteria | 72535 |
| 162 | Ga0207426_1027333 | 3300025302 | Bacteria | 1901 |
| 163 | Ga0207697_10015494 | 3300025315 | Bacteria | 3149 |
| 164 | Ga0207682_10007591 | 3300025893 | Bacteria | 4319 |
| 165 | Ga0207688_10031542 | 3300025901 | Bacteria | 2926 |
| 166 | Ga0207647_10000562 | 3300025904 | Bacteria | 29264 |
| 167 | Ga0207643_10010372 | 3300025908 | Bacteria | 5017 |
| 168 | Ga0207684_10015147 | 3300025910 | Bacteria | 6639 |
| 169 | Ga0207660_10000003 | 3300025917 | Bacteria | 675759 |
| 170 | Ga0207662_10010405 | 3300025918 | Bacteria | 5137 |
| 171 | Ga0207662_10050751 | 3300025918 | Bacteria | 2466 |
| 172 | Ga0207649_10011308 | 3300025920 | Bacteria | 4919 |
| 173 | Ga0207681_10087027 | 3300025923 | Bacteria | 2222 |
| 174 | Ga0207650_10018828 | 3300025925 | Bacteria | 4849 |
| 175 | Ga0207659_10121125 | 3300025926 | Bacteria | 2005 |
| 176 | Ga0207644_10007809 | 3300025931 | Bacteria | 6989 |
| 177 | Ga0207644_10024139 | 3300025931 | Bacteria | 4172 |
| 178 | Ga0207690_10096113 | 3300025932 | Unclassified | 2106 |
| 179 | Ga0207709_10041309 | 3300025935 | Bacteria | 2767 |
| 180 | Ga0207704_10005926 | 3300025938 | Bacteria | 5662 |
| 181 | Ga0207691_10000695 | 3300025940 | Bacteria | 33266 |
| 182 | Ga0207691_10003534 | 3300025940 | Bacteria | 15200 |
| 183 | Ga0207711_10025439 | 3300025941 | Unclassified | 4967 |
| 184 | Ga0207689_10002476 | 3300025942 | Bacteria | 17166 |
| 185 | Ga0207689_10012128 | 3300025942 | Bacteria | 7376 |
| 186 | Ga0207661_10045470 | 3300025944 | Bacteria | 3475 |
| 187 | Ga0207679_10005433 | 3300025945 | Bacteria | 7982 |
| 188 | Ga0207679_10022116 | 3300025945 | Bacteria | 4324 |
| 189 | Ga0207667_10045900 | 3300025949 | Bacteria | 4626 |
| 190 | Ga0207667_10118346 | 3300025949 | Bacteria | 2730 |
| 191 | Ga0207712_10020031 | 3300025961 | Bacteria | 4377 |
| 192 | Ga0207712_10064952 | 3300025961 | Bacteria | 2603 |
| 193 | Ga0207668_10062463 | 3300025972 | Bacteria | 2622 |
| 194 | Ga0207668_10106962 | 3300025972 | Bacteria | 2091 |
| 195 | Ga0207677_10031392 | 3300026023 | Unclassified | 3402 |
| 196 | Ga0207703_10052921 | 3300026035 | Unclassified | 3299 |
| 197 | Ga0207703_10111493 | 3300026035 | Bacteria | 2335 |
| 198 | Ga0207678_10045879 | 3300026067 | Bacteria | 3779 |
| 199 | Ga0207678_10092372 | 3300026067 | Unclassified | 2587 |
| 200 | Ga0207708_10041706 | 3300026075 | Bacteria | 3498 |
| 201 | Ga0207702_10000464 | 3300026078 | Bacteria | 45961 |
| 202 | Ga0207641_10103455 | 3300026088 | Bacteria | 2512 |
| 203 | Ga0207641_10201537 | 3300026088 | Bacteria | 1835 |
| 204 | Ga0207648_10011998 | 3300026089 | Bacteria | 8132 |
| 205 | Ga0207676_10012280 | 3300026095 | Bacteria | 6131 |
| 206 | Ga0207676_10040870 | 3300026095 | Unclassified | 3556 |
| 207 | Ga0207676_10044532 | 3300026095 | Bacteria | 3424 |
| 208 | Ga0207674_10168843 | 3300026116 | Bacteria | 2141 |
| 209 | Ga0207675_100002216 | 3300026118 | Bacteria | 19310 |
| 210 | Ga0207683_10002146 | 3300026121 | Bacteria | 17336 |
| 211 | Ga0207683_10006033 | 3300026121 | Bacteria | 10373 |
| 212 | Ga0207698_10008183 | 3300026142 | Bacteria | 6594 |
| 213 | Ga0268266_10039836 | 3300028379 | Bacteria | 4003 |
| 214 | Ga0268266_10128195 | 3300028379 | Unclassified | 2267 |
| 215 | Ga0268265_10011333 | 3300028380 | Bacteria | 6029 |
| 216 | Ga0268264_10018868 | 3300028381 | Bacteria | 5639 |
| 217 | Ga0268264_10052317 | 3300028381 | Unclassified | 3405 |
| 218 | Ga0265323_10000045 | 3300028653 | Bacteria | 67774 |
| 219 | Ga0307414_10001007 | 3300032004 | Bacteria | 14394 |
| 220 | Ga0307414_10202495 | 3300032004 | Unclassified | 1616 |
| 221 | Ga0373937_0019798 | 3300036401 | Bacteria | 6028 |
| 222 | Ga0395900_0110537 | 3300037418 | Bacteria | 2823 |
| 223 | Ga0395898_0079871 | 3300037466 | Bacteria | 3155 |
| 224 | Ga0395905_0117738 | 3300037471 | Bacteria | 2497 |
| 225 | Ga0395905_0251458 | 3300037471 | Bacteria | 1651 |
| 226 | Ga0395901_0060724 | 3300038443 | Bacteria | 3934 |
| 227 | Ga0436365_1428541 | 3300039437 | Bacteria | 2001 |
| 228 | Ga0436361_0057578 | 3300039447 | Bacteria | 25808 |
| 229 | Ga0451577_0003600 | 3300042876 | Bacteria | 17033 |
| 230 | Ga0453684_0000003 | 3300044712 | Bacteria | 1481694 |
| 231 | Ga0453684_0000023 | 3300044712 | Bacteria | 857153 |
| 232 | Ga0453684_0000443 | 3300044712 | Bacteria | 168617 |
| 233 | Ga0453684_0163784 | 3300044712 | Bacteria | 2627 |
| 234 | Ga0453684_0168736 | 3300044712 | Bacteria | 2581 |
| 235 | Ga0453684_0302610 | 3300044712 | Bacteria | 1817 |
| 236 | Ga0451576_0024746 | 3300045051 | Bacteria | 6480 |
| 237 | Ga0495668_0005889 | 3300046616 | Bacteria | 8163 |
| 238 | Ga0496109_0137584 | 3300048912 | Unclassified | 2283 |
| 239 | Ga0501033_0102073 | 3300049570 | Bacteria | 2092 |
| 240 | Ga0501033_0160407 | 3300049570 | Bacteria | 1619 |
| 241 | Ga0501034_0032731 | 3300049571 | Bacteria | 5280 |
| 242 | Ga0501038_0090727 | 3300049574 | Bacteria | 2561 |
| 243 | Ga0501042_0119023 | 3300049578 | Bacteria | 1901 |
| 244 | Ga0501047_0104081 | 3300049581 | Bacteria | 2719 |
| 245 | Ga0501048_0015309 | 3300049582 | Bacteria | 5664 |
| 246 | Ga0501070_0020126 | 3300049586 | Bacteria | 5598 |
| 247 | Ga0501071_0161858 | 3300049587 | Bacteria | 1673 |
| 248 | Ga0501074_0151967 | 3300049590 | Bacteria | 1655 |
| 249 | Ga0501077_0017141 | 3300049593 | Bacteria | 4568 |
| 250 | Ga0501219_000006 | 3300049703 | Bacteria | 30970 |
| 251 | Ga0501079_0080055 | 3300049741 | Bacteria | 2526 |
| 252 | Ga0501079_0102040 | 3300049741 | Bacteria | 2225 |
| 253 | Ga0501045_0015804 | 3300049824 | Bacteria | 5354 |
| 254 | Ga0501284_00062 | 3300050005 | Bacteria | 37409 |
| 255 | nmdc:mga0k408_78_c1 | 3300050493 | Bacteria | 45819 |
| 256 | nmdc:mga05p37_135427_c1 | 3300050507 | Bacteria | 3021 |
| 257 | nmdc:mga05p37_9840_c1 | 3300050507 | Bacteria | 11349 |
| 258 | nmdc:mga09592_116601_c1 | 3300050508 | Unclassified | 2292 |
| 259 | nmdc:mga0qj67_40341_c1 | 3300050509 | Bacteria | 3669 |
| 260 | nmdc:mga06r32_34190_c1 | 3300050510 | Unclassified | 4793 |
| 261 | nmdc:mga0n895_5086_c1 | 3300050512 | Bacteria | 10923 |
| 262 | nmdc:mga0rr50_41990_c1 | 3300050513 | Bacteria | 3337 |
| 263 | nmdc:mga08x19_31607_c1 | 3300050514 | Bacteria | 3331 |
| 264 | nmdc:mga0a205_614_c1 | 3300050515 | Bacteria | 28379 |
| 265 | Ga0500645_008440 | 3300053730 | Bacteria | 3519 |
| 266 | Ga0501082_0071413 | 3300060353 | Bacteria | 2990 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021384 | Ga0213876_10067652 | Ga0213876_100676523 | 324 |
| 2 | 3300050514 | nmdc:mga08x19_31607_c1 | nmdc:mga08x19_31607_c1_2180_3319 | 330 |
| 3 | 3300006195 | Ga0075366_10012073 | Ga0075366_100120734 | 347 |
| 4 | 3300050493 | nmdc:mga0k408_78_c1 | nmdc:mga0k408_78_c1_24801_26057 | 347 |
| 5 | 3300049578 | Ga0501042_0119023 | Ga0501042_0119023_570_1802 | 350 |
| 6 | 3300050509 | nmdc:mga0qj67_40341_c1 | nmdc:mga0qj67_40341_c1_250_1494 | 351 |
| 7 | 3300037418 | Ga0395900_0110537 | Ga0395900_0110537_1522_2799 | 358 |
| 8 | 3300037466 | Ga0395898_0079871 | Ga0395898_0079871_647_1924 | 358 |
| 9 | 3300038443 | Ga0395901_0060724 | Ga0395901_0060724_20_1297 | 358 |
| 10 | iso_pu_bacteria | 2818991442 | 2819573281 | 361 |
| 11 | iso_pu_bacteria | 2821136567 | 2821136696 | 361 |
| 12 | iso_pu_bacteria | 2904467357 | 2904468559 | 361 |
| 13 | 3300037471 | Ga0395905_0251458 | Ga0395905_0251458_315_1586 | 364 |
| 14 | 3300005262 | Ga0065165_1008967 | Ga0065165_10089675 | 365 |
| 15 | 3300005339 | Ga0070660_100074920 | Ga0070660_1000749202 | 365 |
| 16 | 3300005548 | Ga0070665_100043129 | Ga0070665_1000431292 | 365 |
| 17 | 3300005563 | Ga0068855_100042120 | Ga0068855_1000421202 | 365 |
| 18 | 3300005614 | Ga0068856_100000927 | Ga0068856_10000092724 | 365 |
| 19 | 3300005617 | Ga0068859_100106715 | Ga0068859_1001067152 | 365 |
| 20 | 3300005618 | Ga0068864_100012961 | Ga0068864_1000129615 | 365 |
| 21 | 3300005842 | Ga0068858_100154188 | Ga0068858_1001541882 | 365 |
| 22 | 3300006881 | Ga0068865_100097323 | Ga0068865_1000973232 | 365 |
| 23 | 3300006931 | Ga0097620_100106719 | Ga0097620_1001067192 | 365 |
| 24 | 3300009553 | Ga0105249_10028581 | Ga0105249_100285813 | 365 |
| 25 | 3300013306 | Ga0163162_10016263 | Ga0163162_100162633 | 365 |
| 26 | 3300013308 | Ga0157375_10006375 | Ga0157375_100063755 | 365 |
| 27 | 3300014325 | Ga0163163_10044297 | Ga0163163_100442974 | 365 |
| 28 | 3300014745 | Ga0157377_10016150 | Ga0157377_100161503 | 365 |
| 29 | 3300015265 | Ga0182005_1000081 | Ga0182005_100008156 | 365 |
| 30 | 3300017792 | Ga0163161_10038259 | Ga0163161_100382593 | 365 |
| 31 | 3300025208 | Ga0209436_101278 | Ga0209436_1012788 | 365 |
| 32 | 3300025284 | Ga0209130_1006256 | Ga0209130_10062564 | 365 |
| 33 | 3300025302 | Ga0207426_1000405 | Ga0207426_100040552 | 365 |
| 34 | 3300025302 | Ga0207426_1027333 | Ga0207426_10273332 | 365 |
| 35 | 3300025893 | Ga0207682_10007591 | Ga0207682_100075913 | 365 |
| 36 | 3300025908 | Ga0207643_10010372 | Ga0207643_100103723 | 365 |
| 37 | 3300025949 | Ga0207667_10045900 | Ga0207667_100459003 | 365 |
| 38 | 3300025949 | Ga0207667_10118346 | Ga0207667_101183462 | 365 |
| 39 | 3300025972 | Ga0207668_10062463 | Ga0207668_100624631 | 365 |
| 40 | 3300026035 | Ga0207703_10111493 | Ga0207703_101114932 | 365 |
| 41 | 3300026067 | Ga0207678_10045879 | Ga0207678_100458792 | 365 |
| 42 | 3300026075 | Ga0207708_10041706 | Ga0207708_100417062 | 365 |
| 43 | 3300026078 | Ga0207702_10000464 | Ga0207702_100004644 | 365 |
| 44 | 3300026095 | Ga0207676_10044532 | Ga0207676_100445323 | 365 |
| 45 | 3300028380 | Ga0268265_10011333 | Ga0268265_100113333 | 365 |
| 46 | 3300044712 | Ga0453684_0302610 | Ga0453684_0302610_240_1532 | 365 |
| 47 | 3300053730 | Ga0500645_008440 | Ga0500645_008440_159_1433 | 366 |
| 48 | 3300005366 | Ga0070659_100063704 | Ga0070659_1000637042 | 367 |
| 49 | 3300005441 | Ga0070700_100115897 | Ga0070700_1001158972 | 367 |
| 50 | 3300005455 | Ga0070663_100042222 | Ga0070663_1000422222 | 367 |
| 51 | 3300005564 | Ga0070664_100114339 | Ga0070664_1001143392 | 367 |
| 52 | 3300009098 | Ga0105245_10318939 | Ga0105245_103189391 | 367 |
| 53 | 3300021361 | Ga0213872_10015457 | Ga0213872_100154572 | 367 |
| 54 | 3300025932 | Ga0207690_10096113 | Ga0207690_100961132 | 367 |
| 55 | 3300026067 | Ga0207678_10092372 | Ga0207678_100923722 | 367 |
| 56 | 3300039447 | Ga0436361_0057578 | Ga0436361_0057578_13323_14606 | 367 |
| 57 | 3300048912 | Ga0496109_0137584 | Ga0496109_0137584_129_1367 | 367 |
| 58 | 3300025925 | Ga0207650_10018828 | Ga0207650_100188284 | 368 |
| 59 | 3300039437 | Ga0436365_1428541 | Ga0436365_1428541_105_1376 | 368 |
| 60 | 3300042876 | Ga0451577_0003600 | Ga0451577_0003600_4196_5557 | 368 |
| 61 | 3300044712 | Ga0453684_0000443 | Ga0453684_0000443_90775_92136 | 368 |
| 62 | 3300046616 | Ga0495668_0005889 | Ga0495668_0005889_699_1958 | 368 |
| 63 | 3300005616 | Ga0068852_100000327 | Ga0068852_1000003273 | 370 |
| 64 | 3300013105 | Ga0157369_10045519 | Ga0157369_100455192 | 370 |
| 65 | 3300013307 | Ga0157372_10034655 | Ga0157372_100346554 | 370 |
| 66 | 3300025904 | Ga0207647_10000562 | Ga0207647_100005622 | 370 |
| 67 | 3300026142 | Ga0207698_10008183 | Ga0207698_100081836 | 370 |
| 68 | 3300044712 | Ga0453684_0168736 | Ga0453684_0168736_135_1409 | 370 |
| 69 | 3300005336 | Ga0070680_100000945 | Ga0070680_1000009457 | 371 |
| 70 | 3300005467 | Ga0070706_100027628 | Ga0070706_1000276283 | 371 |
| 71 | 3300005468 | Ga0070707_100055357 | Ga0070707_1000553573 | 371 |
| 72 | 3300005471 | Ga0070698_100012240 | Ga0070698_1000122409 | 371 |
| 73 | 3300005535 | Ga0070684_100194140 | Ga0070684_1001941402 | 371 |
| 74 | 3300005577 | Ga0068857_100144727 | Ga0068857_1001447272 | 371 |
| 75 | 3300009545 | Ga0105237_10104533 | Ga0105237_101045332 | 371 |
| 76 | 3300013307 | Ga0157372_10107986 | Ga0157372_101079863 | 371 |
| 77 | 3300025910 | Ga0207684_10015147 | Ga0207684_100151475 | 371 |
| 78 | 3300025917 | Ga0207660_10000003 | Ga0207660_10000003351 | 371 |
| 79 | 3300026116 | Ga0207674_10168843 | Ga0207674_101688432 | 371 |
| 80 | 3300037471 | Ga0395905_0117738 | Ga0395905_0117738_419_1705 | 371 |
| 81 | 3300005329 | Ga0070683_100020229 | Ga0070683_1000202292 | 372 |
| 82 | 3300005331 | Ga0070670_100066116 | Ga0070670_1000661162 | 372 |
| 83 | 3300005535 | Ga0070684_100095280 | Ga0070684_1000952802 | 372 |
| 84 | 3300013296 | Ga0157374_10080593 | Ga0157374_100805933 | 372 |
| 85 | 3300014325 | Ga0163163_10004255 | Ga0163163_100042558 | 372 |
| 86 | 3300017792 | Ga0163161_10008544 | Ga0163161_100085445 | 372 |
| 87 | 3300025918 | Ga0207662_10050751 | Ga0207662_100507512 | 372 |
| 88 | 3300025931 | Ga0207644_10024139 | Ga0207644_100241394 | 372 |
| 89 | 3300025944 | Ga0207661_10045470 | Ga0207661_100454702 | 372 |
| 90 | 3300025945 | Ga0207679_10005433 | Ga0207679_100054337 | 372 |
| 91 | 3300049586 | Ga0501070_0020126 | Ga0501070_0020126_204_1484 | 372 |
| 92 | 3300049590 | Ga0501074_0151967 | Ga0501074_0151967_47_1327 | 372 |
| 93 | 3300049703 | Ga0501219_000006 | Ga0501219_000006_2899_4167 | 372 |
| 94 | 3300050005 | Ga0501284_00062 | Ga0501284_00062_20429_21697 | 372 |
| 95 | iso_pu_bacteria | 2890804823 | 2890806969 | 372 |
| 96 | 3300005290 | Ga0065712_10085254 | Ga0065712_100852542 | 373 |
| 97 | 3300005335 | Ga0070666_10049078 | Ga0070666_100490782 | 373 |
| 98 | 3300005338 | Ga0068868_100005497 | Ga0068868_1000054974 | 373 |
| 99 | 3300005340 | Ga0070689_100124272 | Ga0070689_1001242722 | 373 |
| 100 | 3300005353 | Ga0070669_100143429 | Ga0070669_1001434292 | 373 |
| 101 | 3300005354 | Ga0070675_100129459 | Ga0070675_1001294592 | 373 |
| 102 | 3300005364 | Ga0070673_100039660 | Ga0070673_1000396602 | 373 |
| 103 | 3300005364 | Ga0070673_100097437 | Ga0070673_1000974372 | 373 |
| 104 | 3300005367 | Ga0070667_100037888 | Ga0070667_1000378884 | 373 |
| 105 | 3300005367 | Ga0070667_100113711 | Ga0070667_1001137112 | 373 |
| 106 | 3300005438 | Ga0070701_10079317 | Ga0070701_100793171 | 373 |
| 107 | 3300005459 | Ga0068867_100111892 | Ga0068867_1001118922 | 373 |
| 108 | 3300005543 | Ga0070672_100043252 | Ga0070672_1000432522 | 373 |
| 109 | 3300005544 | Ga0070686_100075268 | Ga0070686_1000752681 | 373 |
| 110 | 3300005548 | Ga0070665_100196316 | Ga0070665_1001963162 | 373 |
| 111 | 3300005615 | Ga0070702_100123316 | Ga0070702_1001233162 | 373 |
| 112 | 3300005615 | Ga0070702_100137763 | Ga0070702_1001377631 | 373 |
| 113 | 3300005617 | Ga0068859_100009890 | Ga0068859_1000098905 | 373 |
| 114 | 3300005618 | Ga0068864_100005841 | Ga0068864_1000058417 | 373 |
| 115 | 3300005618 | Ga0068864_100114665 | Ga0068864_1001146652 | 373 |
| 116 | 3300005841 | Ga0068863_100181420 | Ga0068863_1001814202 | 373 |
| 117 | 3300005842 | Ga0068858_100009725 | Ga0068858_1000097257 | 373 |
| 118 | 3300005842 | Ga0068858_100068257 | Ga0068858_1000682572 | 373 |
| 119 | 3300005843 | Ga0068860_100029548 | Ga0068860_1000295484 | 373 |
| 120 | 3300005843 | Ga0068860_100322203 | Ga0068860_1003222031 | 373 |
| 121 | 3300006237 | Ga0097621_100002385 | Ga0097621_1000023856 | 373 |
| 122 | 3300006237 | Ga0097621_100006498 | Ga0097621_1000064982 | 373 |
| 123 | 3300006358 | Ga0068871_100001823 | Ga0068871_1000018234 | 373 |
| 124 | 3300006358 | Ga0068871_100113548 | Ga0068871_1001135482 | 373 |
| 125 | 3300006931 | Ga0097620_100009891 | Ga0097620_1000098915 | 373 |
| 126 | 3300009098 | Ga0105245_10004594 | Ga0105245_100045945 | 373 |
| 127 | 3300009148 | Ga0105243_10051819 | Ga0105243_100518192 | 373 |
| 128 | 3300009176 | Ga0105242_10091985 | Ga0105242_100919852 | 373 |
| 129 | 3300009177 | Ga0105248_10004867 | Ga0105248_100048677 | 373 |
| 130 | 3300009177 | Ga0105248_10110066 | Ga0105248_101100662 | 373 |
| 131 | 3300013297 | Ga0157378_10002117 | Ga0157378_100021176 | 373 |
| 132 | 3300013297 | Ga0157378_10048286 | Ga0157378_100482862 | 373 |
| 133 | 3300013306 | Ga0163162_10003516 | Ga0163162_100035162 | 373 |
| 134 | 3300013306 | Ga0163162_10003922 | Ga0163162_100039227 | 373 |
| 135 | 3300013308 | Ga0157375_10007132 | Ga0157375_100071322 | 373 |
| 136 | 3300013308 | Ga0157375_10044298 | Ga0157375_100442983 | 373 |
| 137 | 3300014325 | Ga0163163_10000948 | Ga0163163_1000094816 | 373 |
| 138 | 3300014325 | Ga0163163_10034726 | Ga0163163_100347262 | 373 |
| 139 | 3300014325 | Ga0163163_10057799 | Ga0163163_100577992 | 373 |
| 140 | 3300014326 | Ga0157380_10044187 | Ga0157380_100441872 | 373 |
| 141 | 3300014745 | Ga0157377_10117351 | Ga0157377_101173512 | 373 |
| 142 | 3300025315 | Ga0207697_10015494 | Ga0207697_100154943 | 373 |
| 143 | 3300025923 | Ga0207681_10087027 | Ga0207681_100870272 | 373 |
| 144 | 3300025931 | Ga0207644_10007809 | Ga0207644_100078092 | 373 |
| 145 | 3300025935 | Ga0207709_10041309 | Ga0207709_100413092 | 373 |
| 146 | 3300025940 | Ga0207691_10003534 | Ga0207691_100035349 | 373 |
| 147 | 3300025941 | Ga0207711_10025439 | Ga0207711_100254393 | 373 |
| 148 | 3300025942 | Ga0207689_10002476 | Ga0207689_1000247611 | 373 |
| 149 | 3300025961 | Ga0207712_10020031 | Ga0207712_100200312 | 373 |
| 150 | 3300026023 | Ga0207677_10031392 | Ga0207677_100313923 | 373 |
| 151 | 3300026035 | Ga0207703_10052921 | Ga0207703_100529212 | 373 |
| 152 | 3300026088 | Ga0207641_10103455 | Ga0207641_101034552 | 373 |
| 153 | 3300026088 | Ga0207641_10201537 | Ga0207641_102015371 | 373 |
| 154 | 3300026089 | Ga0207648_10011998 | Ga0207648_100119985 | 373 |
| 155 | 3300026095 | Ga0207676_10040870 | Ga0207676_100408703 | 373 |
| 156 | 3300028379 | Ga0268266_10128195 | Ga0268266_101281952 | 373 |
| 157 | 3300028381 | Ga0268264_10018868 | Ga0268264_100188684 | 373 |
| 158 | 3300028381 | Ga0268264_10052317 | Ga0268264_100523172 | 373 |
| 159 | 3300036401 | Ga0373937_0019798 | Ga0373937_0019798_113_1360 | 373 |
| 160 | 3300044712 | Ga0453684_0000003 | Ga0453684_0000003_434477_435775 | 373 |
| 161 | 3300005295 | Ga0065707_10006048 | Ga0065707_100060483 | 374 |
| 162 | 3300005471 | Ga0070698_100019310 | Ga0070698_1000193105 | 374 |
| 163 | 3300005546 | Ga0070696_100014220 | Ga0070696_1000142202 | 374 |
| 164 | 3300005549 | Ga0070704_100031757 | Ga0070704_1000317573 | 374 |
| 165 | 3300014325 | Ga0163163_10000324 | Ga0163163_1000032437 | 374 |
| 166 | 3300049570 | Ga0501033_0102073 | Ga0501033_0102073_408_1703 | 374 |
| 167 | 3300049571 | Ga0501034_0032731 | Ga0501034_0032731_1542_2837 | 374 |
| 168 | 3300049581 | Ga0501047_0104081 | Ga0501047_0104081_1171_2466 | 374 |
| 169 | 3300049593 | Ga0501077_0017141 | Ga0501077_0017141_1627_2919 | 374 |
| 170 | 3300049741 | Ga0501079_0080055 | Ga0501079_0080055_1075_2361 | 374 |
| 171 | 3300011119 | Ga0105246_10047669 | Ga0105246_100476693 | 375 |
| 172 | 3300032004 | Ga0307414_10001007 | Ga0307414_100010076 | 376 |
| 173 | 3300003320 | rootH2_10345619 | rootH2_103456191 | 377 |
| 174 | 3300005289 | Ga0065704_10007705 | Ga0065704_100077052 | 377 |
| 175 | 3300005355 | Ga0070671_100017476 | Ga0070671_1000174764 | 377 |
| 176 | 3300005543 | Ga0070672_100044683 | Ga0070672_1000446832 | 377 |
| 177 | 3300005578 | Ga0068854_100213178 | Ga0068854_1002131781 | 377 |
| 178 | 3300005937 | Ga0081455_10008884 | Ga0081455_100088843 | 377 |
| 179 | 3300006847 | Ga0075431_100039583 | Ga0075431_1000395833 | 377 |
| 180 | 3300006871 | Ga0075434_100042410 | Ga0075434_1000424102 | 377 |
| 181 | 3300006880 | Ga0075429_100059388 | Ga0075429_1000593883 | 377 |
| 182 | 3300009147 | Ga0114129_10156613 | Ga0114129_101566133 | 377 |
| 183 | 3300028653 | Ga0265323_10000045 | Ga0265323_100000456 | 377 |
| 184 | 3300050507 | nmdc:mga05p37_135427_c1 | nmdc:mga05p37_135427_c1_563_1882 | 377 |
| 185 | 3300050508 | nmdc:mga09592_116601_c1 | nmdc:mga09592_116601_c1_697_1968 | 377 |
| 186 | 3300050510 | nmdc:mga06r32_34190_c1 | nmdc:mga06r32_34190_c1_344_1615 | 377 |
| 187 | 3300005328 | Ga0070676_10018549 | Ga0070676_100185492 | 378 |
| 188 | 3300005331 | Ga0070670_100001360 | Ga0070670_1000013603 | 378 |
| 189 | 3300005331 | Ga0070670_100003192 | Ga0070670_1000031922 | 378 |
| 190 | 3300005333 | Ga0070677_10012002 | Ga0070677_100120023 | 378 |
| 191 | 3300005334 | Ga0068869_100005602 | Ga0068869_1000056026 | 378 |
| 192 | 3300005344 | Ga0070661_100019085 | Ga0070661_1000190853 | 378 |
| 193 | 3300005353 | Ga0070669_100007767 | Ga0070669_1000077673 | 378 |
| 194 | 3300005354 | Ga0070675_100007010 | Ga0070675_1000070106 | 378 |
| 195 | 3300005354 | Ga0070675_100029261 | Ga0070675_1000292612 | 378 |
| 196 | 3300005355 | Ga0070671_100093496 | Ga0070671_1000934962 | 378 |
| 197 | 3300005356 | Ga0070674_100072938 | Ga0070674_1000729382 | 378 |
| 198 | 3300005364 | Ga0070673_100083611 | Ga0070673_1000836113 | 378 |
| 199 | 3300005366 | Ga0070659_100015469 | Ga0070659_1000154692 | 378 |
| 200 | 3300005441 | Ga0070700_100024584 | Ga0070700_1000245843 | 378 |
| 201 | 3300005456 | Ga0070678_100011696 | Ga0070678_1000116962 | 378 |
| 202 | 3300005456 | Ga0070678_100046839 | Ga0070678_1000468392 | 378 |
| 203 | 3300005457 | Ga0070662_100007798 | Ga0070662_1000077984 | 378 |
| 204 | 3300005545 | Ga0070695_100118589 | Ga0070695_1001185892 | 378 |
| 205 | 3300005548 | Ga0070665_100010372 | Ga0070665_1000103728 | 378 |
| 206 | 3300005618 | Ga0068864_100002461 | Ga0068864_1000024613 | 378 |
| 207 | 3300005719 | Ga0068861_100009651 | Ga0068861_1000096514 | 378 |
| 208 | 3300005840 | Ga0068870_10000851 | Ga0068870_1000085110 | 378 |
| 209 | 3300005841 | Ga0068863_100014946 | Ga0068863_1000149463 | 378 |
| 210 | 3300005843 | Ga0068860_100016453 | Ga0068860_1000164535 | 378 |
| 211 | 3300005844 | Ga0068862_100006104 | Ga0068862_1000061048 | 378 |
| 212 | 3300009094 | Ga0111539_10132566 | Ga0111539_101325662 | 378 |
| 213 | 3300009177 | Ga0105248_10066158 | Ga0105248_100661582 | 378 |
| 214 | 3300013296 | Ga0157374_10000481 | Ga0157374_1000048115 | 378 |
| 215 | 3300013297 | Ga0157378_10093473 | Ga0157378_100934733 | 378 |
| 216 | 3300013308 | Ga0157375_10028545 | Ga0157375_100285455 | 378 |
| 217 | 3300013308 | Ga0157375_10181094 | Ga0157375_101810942 | 378 |
| 218 | 3300014325 | Ga0163163_10029027 | Ga0163163_100290274 | 378 |
| 219 | 3300014326 | Ga0157380_10003798 | Ga0157380_100037985 | 378 |
| 220 | 3300014969 | Ga0157376_10138479 | Ga0157376_101384792 | 378 |
| 221 | 3300025901 | Ga0207688_10031542 | Ga0207688_100315421 | 378 |
| 222 | 3300025918 | Ga0207662_10010405 | Ga0207662_100104052 | 378 |
| 223 | 3300025920 | Ga0207649_10011308 | Ga0207649_100113083 | 378 |
| 224 | 3300025926 | Ga0207659_10121125 | Ga0207659_101211252 | 378 |
| 225 | 3300025938 | Ga0207704_10005926 | Ga0207704_100059262 | 378 |
| 226 | 3300025940 | Ga0207691_10000695 | Ga0207691_1000069524 | 378 |
| 227 | 3300025942 | Ga0207689_10012128 | Ga0207689_100121282 | 378 |
| 228 | 3300025945 | Ga0207679_10022116 | Ga0207679_100221162 | 378 |
| 229 | 3300025961 | Ga0207712_10064952 | Ga0207712_100649522 | 378 |
| 230 | 3300025972 | Ga0207668_10106962 | Ga0207668_101069622 | 378 |
| 231 | 3300026095 | Ga0207676_10012280 | Ga0207676_100122802 | 378 |
| 232 | 3300026118 | Ga0207675_100002216 | Ga0207675_1000022167 | 378 |
| 233 | 3300026121 | Ga0207683_10002146 | Ga0207683_1000214612 | 378 |
| 234 | 3300026121 | Ga0207683_10006033 | Ga0207683_100060332 | 378 |
| 235 | 3300028379 | Ga0268266_10039836 | Ga0268266_100398362 | 378 |
| 236 | 3300032004 | Ga0307414_10202495 | Ga0307414_102024952 | 378 |
| 237 | 3300006846 | Ga0075430_100137135 | Ga0075430_1001371352 | 379 |
| 238 | 3300006871 | Ga0075434_100177782 | Ga0075434_1001777822 | 379 |
| 239 | 3300007076 | Ga0075435_100251274 | Ga0075435_1002512741 | 379 |
| 240 | 3300010375 | Ga0105239_10000659 | Ga0105239_1000065916 | 379 |
| 241 | 3300013102 | Ga0157371_10063217 | Ga0157371_100632172 | 379 |
| 242 | 3300013104 | Ga0157370_10130962 | Ga0157370_101309622 | 379 |
| 243 | 3300013105 | Ga0157369_10231575 | Ga0157369_102315752 | 379 |
| 244 | 3300013105 | Ga0157369_10235743 | Ga0157369_102357431 | 379 |
| 245 | 3300013307 | Ga0157372_10156965 | Ga0157372_101569652 | 379 |
| 246 | 3300049570 | Ga0501033_0160407 | Ga0501033_0160407_127_1461 | 379 |
| 247 | 3300049574 | Ga0501038_0090727 | Ga0501038_0090727_812_2146 | 379 |
| 248 | 3300049582 | Ga0501048_0015309 | Ga0501048_0015309_1853_3187 | 379 |
| 249 | 3300049587 | Ga0501071_0161858 | Ga0501071_0161858_96_1430 | 379 |
| 250 | 3300049824 | Ga0501045_0015804 | Ga0501045_0015804_1338_2672 | 379 |
| 251 | 3300060353 | Ga0501082_0071413 | Ga0501082_0071413_419_1753 | 379 |
| 252 | 3300005843 | Ga0068860_100007213 | Ga0068860_1000072139 | 380 |
| 253 | 3300006852 | Ga0075433_10002634 | Ga0075433_100026343 | 380 |
| 254 | 3300006871 | Ga0075434_100001889 | Ga0075434_1000018895 | 380 |
| 255 | 3300007076 | Ga0075435_100001631 | Ga0075435_1000016315 | 380 |
| 256 | 3300009147 | Ga0114129_10002115 | Ga0114129_1000211510 | 380 |
| 257 | 3300044712 | Ga0453684_0163784 | Ga0453684_0163784_137_1420 | 380 |
| 258 | 3300050507 | nmdc:mga05p37_9840_c1 | nmdc:mga05p37_9840_c1_9939_11294 | 380 |
| 259 | 3300050512 | nmdc:mga0n895_5086_c1 | nmdc:mga0n895_5086_c1_4392_5747 | 380 |
| 260 | 3300050513 | nmdc:mga0rr50_41990_c1 | nmdc:mga0rr50_41990_c1_1298_2653 | 380 |
| 261 | 3300050515 | nmdc:mga0a205_614_c1 | nmdc:mga0a205_614_c1_16130_17485 | 380 |
| 262 | 3300049741 | Ga0501079_0102040 | Ga0501079_0102040_800_2113 | 381 |
| 263 | 3300005341 | Ga0070691_10069277 | Ga0070691_100692772 | 382 |
| 264 | 3300005444 | Ga0070694_100000752 | Ga0070694_1000007525 | 382 |
| 265 | 3300005536 | Ga0070697_100040573 | Ga0070697_1000405733 | 382 |
| 266 | 3300005545 | Ga0070695_100002757 | Ga0070695_1000027574 | 382 |
| 267 | 3300044712 | Ga0453684_0000023 | Ga0453684_0000023_647803_649110 | 382 |
| 268 | 3300045051 | Ga0451576_0024746 | Ga0451576_0024746_4987_6318 | 382 |
| 269 | 3300003214 | JGI25165J46597_1000013 | JGI25165J46597_100001345 | 398 |
| 270 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013299 | 398 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dd0-assembly1.cif.gz_C | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.9392 | 1 | 241 |
| 7dd0-assembly1.cif.gz_A | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.9324 | 1 | 241 |
| 7dd0-assembly2.cif.gz_D | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.9263 | 1 | 241 |
| 7dd0-assembly2.cif.gz_B | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.8943 | 4 | 241 |
| 6o14-assembly1.cif.gz_A | crystal structure of the aquifex aeolicus wzt carbohydrate binding domain | 0.8857 | 251 | 374 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P72047_42_272_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9039 | 52 | 242 | 3.40.50.300 |
| af_Q2G2L1_4_262_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8994 | 6 | 240 | 3.40.50.300 |
| af_Q58429_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8919 | 4 | 241 | 3.40.50.300 |
| af_X2JG15_1642_1882_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8676 | 4 | 240 | 3.40.50.300 |
| af_A0A1D6DXP2_296_452_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8657 | 99 | 215 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A839ZFQ2-F1-model_v4 | Capsular polysaccharide transport system ATP-binding protein | 0.8911 | 4 | 245 |
GO:0005524
GO:0016887 |
| AF-Q93UJ9-F1-model_v4 | Wzt2 | 0.8875 | 9 | 241 |
GO:0005524
GO:0005886 GO:0016887 GO:0140359 |
| AF-A0A1X7MNH7-F1-model_v4 | deleted | 0.8873 | 4 | 241 |
|
| AF-A0A7V5VXK5-F1-model_v4 | ABC transporter ATP-binding protein | 0.8777 | 4 | 240 |
GO:0005524
GO:0016887 |
| AF-A0A7Z0RNF7-F1-model_v4 | deleted | 0.8727 | 6 | 240 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar