F376910

General Info

Members Datasets Scaffolds Average Seq Length
270 194 242 207

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10608381|Ga0105248_106083812
Length 245
Sequence MKTARKSRRALILVDLQNDFLPGGALAVPGGDAVIPVANKLQRSGNFDLIVATQDWHPRDHGSFAPNHRGKTPGEVVNLNGLRQILWPIHCVQNTRGAEFSPALDVSRINKIIHKGTDPWIDSYSTFFDNGHRKNTGLDRYLKARGVTDVYLAGLATDYCVKFSALDARQLGFNVHVIEDGCRGIDLRHGDVDAAIEQMRRAGAQITRSTRVATAAKTRSRTRGKDVTSQPARRRSKRKLASAKR

Samples

Sample ID Description Type Environment
1 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
2 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
3 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
4 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
5 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
6 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
7 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
8 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
9 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
10 2818991452 Burkholderia cepacia 561 Isolate Unclassified
11 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
12 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
13 2904564687 Burkholderia sp. 571 Isolate Unclassified
14 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
15 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
16 2928163908 Burkholderia sp. 567 Isolate Unclassified
17 2928170801 Burkholderia sp. 572 Isolate Unclassified
18 2928536128 Burkholderia sola 565 Isolate Unclassified
19 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
187 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
188 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
189 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
190 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
191 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
192 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
193 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
194 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.63
Metatranscriptomes 0
Isolates 10.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.3
Nodule 0
Rhizoplane 3.33
Rhizosphere 71.11
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004240 3300001989 Bacteria 5489
2 rootH2_10091819 3300003320 Bacteria 1525
3 rootH2_10106903 3300003320 Bacteria 1785
4 Ga0055532_1001848 3300003758 Bacteria 5195
5 Ga0055532_1001863 3300003758 Bacteria 5152
6 Ga0055532_1002185 3300003758 Bacteria 4334
7 Ga0055527_1000285 3300003760 Bacteria 29822
8 Ga0055527_1000469 3300003760 Bacteria 15440
9 Ga0055535_1000501 3300003761 Bacteria 34751
10 Ga0055535_1001165 3300003761 Bacteria 15440
11 Ga0055542_1000602 3300003762 Bacteria 30738
12 Ga0055542_1012813 3300003762 Bacteria 1436
13 Ga0055529_1000251 3300003763 Bacteria 65519
14 Ga0055529_1014118 3300003763 Bacteria 1013
15 Ga0065704_10088356 3300005289 Bacteria 2944
16 Ga0070658_10000253 3300005327 Bacteria 46941
17 Ga0070658_10231861 3300005327 Bacteria 1563
18 Ga0070660_100000007 3300005339 Bacteria 162039
19 Ga0070689_100001067 3300005340 Bacteria 17193
20 Ga0070687_100078672 3300005343 Bacteria 1793
21 Ga0070675_100176879 3300005354 Bacteria 1843
22 Ga0070659_100000019 3300005366 Bacteria 156016
23 Ga0070714_100254334 3300005435 Bacteria 1625
24 Ga0070713_100098173 3300005436 Bacteria 2532
25 Ga0070705_100554368 3300005440 Bacteria 882
26 Ga0070708_100218344 3300005445 Bacteria 1788
27 Ga0070708_100444065 3300005445 Bacteria 1224
28 Ga0070663_100006300 3300005455 Bacteria 7120
29 Ga0070685_10072496 3300005466 Bacteria 2045
30 Ga0070706_100001357 3300005467 Bacteria 26038
31 Ga0070706_100101031 3300005467 Unclassified 2681
32 Ga0070706_100102462 3300005467 Bacteria 2661
33 Ga0070698_100004089 3300005471 Bacteria 16027
34 Ga0070699_100007845 3300005518 Bacteria 9274
35 Ga0068853_100000001 3300005539 Bacteria 715840
36 Ga0068853_101081468 3300005539 Bacteria 773
37 Ga0070693_100485592 3300005547 Bacteria 873
38 Ga0068855_100285878 3300005563 Bacteria 1830
39 Ga0068855_100507042 3300005563 Bacteria 1310
40 Ga0068855_100592610 3300005563 Bacteria 1196
41 Ga0068855_100724845 3300005563 Bacteria 1062
42 Ga0070664_100149721 3300005564 Bacteria 2060
43 Ga0068857_100281820 3300005577 Bacteria 1529
44 Ga0070702_100354077 3300005615 Bacteria 1035
45 Ga0068852_100220209 3300005616 Bacteria 1804
46 Ga0068852_100245266 3300005616 Bacteria 1714
47 Ga0068864_100298249 3300005618 Bacteria 1508
48 Ga0068861_100012065 3300005719 Bacteria 6021
49 Ga0068858_100779888 3300005842 Bacteria 932
50 Ga0068862_100146030 3300005844 Bacteria 2102
51 Ga0068862_100319524 3300005844 Bacteria 1433
52 Ga0081539_10039758 3300005985 Bacteria 2771
53 Ga0070717_10014028 3300006028 Bacteria 6157
54 Ga0075365_10000019 3300006038 Bacteria 65113
55 Ga0075363_100001712 3300006048 Bacteria 8524
56 Ga0075363_100007297 3300006048 Bacteria 5069
57 Ga0075364_10007715 3300006051 Bacteria 6404
58 Ga0075364_10008355 3300006051 Bacteria 6184
59 Ga0075364_10145796 3300006051 Eukaryota 1594
60 Ga0075369_10000270 3300006186 Bacteria 15473
61 Ga0075370_10000137 3300006353 Bacteria 24856
62 Ga0075428_100169680 3300006844 Bacteria 2366
63 Ga0075434_100034907 3300006871 Eukaryota 4970
64 Ga0075434_100352522 3300006871 Bacteria 1493
65 Ga0075429_100032299 3300006880 Eukaryota 4550
66 Ga0099795_10012662 3300007788 Unclassified 2565
67 Ga0105240_10003575 3300009093 Bacteria 24117
68 Ga0105240_10122905 3300009093 Bacteria 3124
69 Ga0105240_10495299 3300009093 Bacteria 1360
70 Ga0111539_10061127 3300009094 Unclassified 4463
71 Ga0114129_10092210 3300009147 Bacteria 4197
72 Ga0105248_10608381 3300009177 Unclassified 1233
73 Ga0105248_11359952 3300009177 Bacteria 803
74 Ga0105237_10004792 3300009545 Bacteria 15543
75 Ga0105237_10035442 3300009545 Bacteria 5049
76 Ga0105237_10155838 3300009545 Bacteria 2281
77 Ga0105237_10288780 3300009545 Bacteria 1643
78 Ga0105238_10887045 3300009551 Bacteria 910
79 Ga0105249_10019631 3300009553 Bacteria 6032
80 Ga0099796_10077117 3300010159 Bacteria 1215
81 Ga0157373_10000471 3300013100 Bacteria 31950
82 Ga0157371_10059636 3300013102 Bacteria 2705
83 Ga0157371_10691413 3300013102 Bacteria 763
84 Ga0157369_10261992 3300013105 Bacteria 1803
85 Ga0182006_1116341 3300015261 Bacteria 934
86 Ga0213872_10121179 3300021361 Bacteria 1156
87 Ga0213876_10031111 3300021384 Bacteria 2817
88 Ga0213871_10000805 3300021441 Unclassified 4686
89 Ga0213871_10010964 3300021441 Bacteria 2070
90 Ga0213871_10012710 3300021441 Bacteria 1963
91 Ga0209566_103062 3300025225 Bacteria 2736
92 Ga0209672_100014 3300025228 Bacteria 546252
93 Ga0209672_100023 3300025228 Bacteria 371758
94 Ga0209147_100094 3300025229 Bacteria 167145
95 Ga0209147_100186 3300025229 Bacteria 73135
96 Ga0209147_100208 3300025229 Bacteria 62998
97 Ga0209258_100040 3300025242 Bacteria 385401
98 Ga0209258_100142 3300025242 Bacteria 165865
99 Ga0209646_1016188 3300025246 Bacteria 1108
100 Ga0209148_1000035 3300025254 Bacteria 548413
101 Ga0209148_1000513 3300025254 Bacteria 38858
102 Ga0209148_1001094 3300025254 Bacteria 16351
103 Ga0209759_1002608 3300025256 Bacteria 7776
104 Ga0209455_1000072 3300025272 Bacteria 293074
105 Ga0209455_1000634 3300025272 Bacteria 21681
106 Ga0209673_1000030 3300025273 Bacteria 351933
107 Ga0209564_1003030 3300025295 Bacteria 11975
108 Ga0207647_10001702 3300025904 Bacteria 16928
109 Ga0207705_10005194 3300025909 Bacteria 9759
110 Ga0207684_10015100 3300025910 Bacteria 6648
111 Ga0207684_10154075 3300025910 Unclassified 1977
112 Ga0207695_10001245 3300025913 Bacteria 43532
113 Ga0207695_10404935 3300025913 Bacteria 1249
114 Ga0207695_10416447 3300025913 Bacteria 1228
115 Ga0207671_10011955 3300025914 Bacteria 7017
116 Ga0207671_10026320 3300025914 Bacteria 4362
117 Ga0207662_10048906 3300025918 Bacteria 2507
118 Ga0207657_10000004 3300025919 Bacteria 247179
119 Ga0207649_10113817 3300025920 Bacteria 1812
120 Ga0207694_10194281 3300025924 Bacteria 1649
121 Ga0207650_10848153 3300025925 Bacteria 775
122 Ga0207659_10060544 3300025926 Bacteria 2725
123 Ga0207659_10143592 3300025926 Bacteria 1856
124 Ga0207659_10764622 3300025926 Bacteria 829
125 Ga0207700_10231676 3300025928 Bacteria 1571
126 Ga0207700_10478662 3300025928 Bacteria 1100
127 Ga0207664_10431978 3300025929 Bacteria 1174
128 Ga0207690_10000015 3300025932 Bacteria 257457
129 Ga0207670_10013640 3300025936 Bacteria 4798
130 Ga0207665_10032087 3300025939 Bacteria 3477
131 Ga0207711_10731500 3300025941 Bacteria 922
132 Ga0207689_10945183 3300025942 Bacteria 727
133 Ga0207679_11214290 3300025945 Bacteria 692
134 Ga0207712_10032208 3300025961 Unclassified 3537
135 Ga0207703_10013245 3300026035 Bacteria 6423
136 Ga0207703_10077720 3300026035 Bacteria 2756
137 Ga0207703_10988279 3300026035 Bacteria 807
138 Ga0207639_10000001 3300026041 Bacteria 1431562
139 Ga0207639_10392814 3300026041 Bacteria 1248
140 Ga0207639_11026578 3300026041 Bacteria 773
141 Ga0207678_10001093 3300026067 Bacteria 24884
142 Ga0207641_10869703 3300026088 Bacteria 894
143 Ga0207676_10235892 3300026095 Bacteria 1638
144 Ga0207676_10422126 3300026095 Unclassified 1251
145 Ga0207674_10601250 3300026116 Bacteria 1062
146 Ga0207675_100006220 3300026118 Bacteria 11336
147 Ga0207698_10017462 3300026142 Bacteria 4869
148 Ga0209371_1000290 3300027312 Bacteria 57261
149 Ga0207428_10098996 3300027907 Bacteria 2255
150 Ga0268256_1000224 3300030500 Bacteria 61981
151 Ga0265330_10000339 3300031235 Bacteria 33381
152 Ga0265325_10035815 3300031241 Bacteria 2633
153 Ga0265327_10000601 3300031251 Bacteria 59701
154 Ga0265316_10000272 3300031344 Bacteria 58100
155 Ga0265314_10001045 3300031711 Bacteria 32296
156 Ga0307416_100559592 3300032002 Bacteria 1218
157 Ga0307414_10000019 3300032004 Bacteria 235390
158 Ga0373943_0184476 3300035170 Bacteria 1148
159 Ga0373925_0226994 3300037068 Bacteria 1492
160 Ga0395905_0017838 3300037471 Bacteria 6743
161 Ga0395905_0132633 3300037471 Bacteria 2343
162 Ga0436364_0262393 3300037853 Unclassified 878
163 Ga0436364_0695500 3300037853 Bacteria 1677
164 Ga0436365_0253137 3300039437 Bacteria 1668
165 Ga0436365_0594925 3300039437 Bacteria 1182
166 Ga0436365_0712819 3300039437 Bacteria 66345
167 Ga0436360_0188981 3300039438 Unclassified 2459
168 Ga0436360_0614620 3300039438 Bacteria 2844
169 Ga0436360_0898544 3300039438 Unclassified 4607
170 Ga0436360_0979639 3300039438 Unclassified 828
171 Ga0436360_1334329 3300039438 Bacteria 2191
172 Ga0436361_0571094 3300039447 Unclassified 1554
173 Ga0436361_0639752 3300039447 Bacteria 1516
174 Ga0436361_0698608 3300039447 Bacteria 2512
175 Ga0436362_0733281 3300039453 Bacteria 1141
176 Ga0436362_0872268 3300039453 Bacteria 1121
177 Ga0451847_0454310 3300041503 Bacteria 687
178 Ga0451577_0000006 3300042876 Bacteria 709265
179 Ga0451577_0008708 3300042876 Bacteria 9839
180 Ga0451577_0264556 3300042876 Bacteria 1557
181 Ga0451577_0801001 3300042876 Bacteria 851
182 Ga0453683_0000096 3300044673 Bacteria 132402
183 Ga0453684_0000037 3300044712 Bacteria 709327
184 Ga0453684_0020468 3300044712 Bacteria 9974
185 Ga0453684_0158611 3300044712 Bacteria 2679
186 Ga0453684_0554026 3300044712 Bacteria 1266
187 Ga0453684_0562658 3300044712 Bacteria 1254
188 Ga0451576_0073201 3300045051 Bacteria 3566
189 Ga0495592_0315043 3300046454 Bacteria 1013
190 Ga0495653_0490543 3300046463 Bacteria 767
191 Ga0495606_0149982 3300046507 Bacteria 1369
192 Ga0495628_0017519 3300046516 Bacteria 5961
193 Ga0495630_0550332 3300046517 Bacteria 885
194 Ga0495652_0138714 3300046529 Bacteria 1915
195 Ga0495665_0033069 3300046531 Bacteria 2766
196 Ga0495586_0103936 3300046535 Bacteria 1578
197 Ga0495586_0137724 3300046535 Bacteria 1369
198 Ga0495645_0017683 3300046543 Bacteria 5110
199 Ga0495645_0218884 3300046543 Bacteria 1282
200 Ga0495667_0231605 3300046559 Bacteria 1178
201 Ga0495674_0249887 3300047319 Bacteria 1459
202 Ga0495680_0053358 3300047322 Bacteria 3147
203 Ga0495675_0070281 3300047444 Bacteria 2210
204 Ga0495675_0213128 3300047444 Bacteria 1172
205 Ga0495684_0081477 3300047471 Bacteria 2456
206 Ga0495602_0269787 3300048088 Bacteria 1258
207 Ga0496103_0231391 3300048906 Bacteria 1189
208 Ga0496104_0072629 3300048907 Bacteria 3272
209 Ga0496112_0828197 3300048915 Bacteria 849
210 Ga0496114_0232943 3300048917 Bacteria 1618
211 Ga0496118_0150251 3300048921 Bacteria 1459
212 Ga0496119_0068211 3300048922 Bacteria 2095
213 Ga0496126_0259396 3300048929 Bacteria 1446
214 Ga0501032_0065580 3300049569 Bacteria 2428
215 Ga0501033_0020366 3300049570 Bacteria 5010
216 Ga0501034_0000428 3300049571 Bacteria 69991
217 Ga0501036_0141617 3300049572 Bacteria 2029
218 Ga0501037_0007225 3300049573 Bacteria 8116
219 Ga0501038_0003439 3300049574 Bacteria 14763
220 Ga0501043_0182233 3300049579 Bacteria 1636
221 Ga0501043_0204580 3300049579 Bacteria 1531
222 Ga0501047_0084997 3300049581 Bacteria 3041
223 Ga0501047_0213625 3300049581 Bacteria 1787
224 Ga0501073_0113186 3300049589 Bacteria 1882
225 Ga0501227_000920 3300049665 Bacteria 6448
226 Ga0501035_0092205 3300049822 Bacteria 2666
227 Ga0501044_0248444 3300049823 Bacteria 1721
228 Ga0501044_0267255 3300049823 Bacteria 1647
229 nmdc:mga03n38_317_c1 3300050490 Bacteria 11640
230 nmdc:mga00v17_29902_c1 3300050491 Bacteria 3200
231 nmdc:mga00v17_463_c1 3300050491 Bacteria 22736
232 nmdc:mga00v17_94_c1 3300050491 Bacteria 52910
233 nmdc:mga0yw44_48_c1 3300050492 Bacteria 40823
234 nmdc:mga06z11_17636_c1 3300050494 Eukaryota 3245
235 nmdc:mga07m45_184_c1 3300050496 Bacteria 24886
236 nmdc:mga09592_10430_c1 3300050508 Eukaryota 7561
237 nmdc:mga09592_903169_c1 3300050508 Bacteria 742
238 nmdc:mga08y16_201329_c1 3300050511 Bacteria 2063
239 nmdc:mga0n895_28648_c1 3300050512 Bacteria 5300
240 nmdc:mga0sz30_143_c1 3300050516 Bacteria 26630
241 Ga0500635_0014530 3300053080 Bacteria 2309
242 Ga0500559_0014932 3300053136 Bacteria 3282

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0979639 Ga0436360_0979639_31_549 169
2 3300050511 nmdc:mga08y16_201329_c1 nmdc:mga08y16_201329_c1_1480_2034 180
3 3300005618 Ga0068864_100298249 Ga0068864_1002982491 189
4 3300026095 Ga0207676_10235892 Ga0207676_102358922 189
5 3300006048 Ga0075363_100001712 Ga0075363_10000171212 196
6 3300006051 Ga0075364_10145796 Ga0075364_101457962 196
7 3300006186 Ga0075369_10000270 Ga0075369_1000027018 196
8 3300006353 Ga0075370_10000137 Ga0075370_1000013712 196
9 3300006871 Ga0075434_100034907 Ga0075434_1000349075 196
10 3300006880 Ga0075429_100032299 Ga0075429_1000322993 196
11 3300009147 Ga0114129_10092210 Ga0114129_100922103 196
12 3300042876 Ga0451577_0264556 Ga0451577_0264556_237_830 196
13 3300042876 Ga0451577_0801001 Ga0451577_0801001_41_637 196
14 3300050490 nmdc:mga03n38_317_c1 nmdc:mga03n38_317_c1_7892_8509 196
15 3300050491 nmdc:mga00v17_29902_c1 nmdc:mga00v17_29902_c1_2547_3164 196
16 3300050494 nmdc:mga06z11_17636_c1 nmdc:mga06z11_17636_c1_2466_3083 196
17 3300050496 nmdc:mga07m45_184_c1 nmdc:mga07m45_184_c1_14230_14847 196
18 3300050508 nmdc:mga09592_10430_c1 nmdc:mga09592_10430_c1_1881_2498 196
19 3300050512 nmdc:mga0n895_28648_c1 nmdc:mga0n895_28648_c1_1964_2581 196
20 3300050516 nmdc:mga0sz30_143_c1 nmdc:mga0sz30_143_c1_14310_14927 196
21 3300005435 Ga0070714_100254334 Ga0070714_1002543341 197
22 3300005436 Ga0070713_100098173 Ga0070713_1000981732 197
23 3300021361 Ga0213872_10121179 Ga0213872_101211792 197
24 3300021384 Ga0213876_10031111 Ga0213876_100311112 197
25 3300021441 Ga0213871_10000805 Ga0213871_100008052 197
26 3300021441 Ga0213871_10010964 Ga0213871_100109641 197
27 3300021441 Ga0213871_10012710 Ga0213871_100127102 197
28 3300025928 Ga0207700_10231676 Ga0207700_102316761 197
29 3300025929 Ga0207664_10431978 Ga0207664_104319782 197
30 3300037853 Ga0436364_0262393 Ga0436364_0262393_243_845 197
31 3300037853 Ga0436364_0695500 Ga0436364_0695500_828_1430 197
32 3300039437 Ga0436365_0712819 Ga0436365_0712819_37346_37948 197
33 3300039438 Ga0436360_0188981 Ga0436360_0188981_798_1400 197
34 3300039438 Ga0436360_0614620 Ga0436360_0614620_302_904 197
35 3300039438 Ga0436360_0898544 Ga0436360_0898544_2687_3289 197
36 3300039438 Ga0436360_1334329 Ga0436360_1334329_358_960 197
37 3300039447 Ga0436361_0571094 Ga0436361_0571094_25_627 197
38 3300039447 Ga0436361_0639752 Ga0436361_0639752_679_1281 197
39 3300039447 Ga0436361_0698608 Ga0436361_0698608_314_916 197
40 3300039453 Ga0436362_0733281 Ga0436362_0733281_444_1046 197
41 3300039453 Ga0436362_0872268 Ga0436362_0872268_414_1016 197
42 3300031251 Ga0265327_10000601 Ga0265327_1000060151 199
43 3300044712 Ga0453684_0562658 Ga0453684_0562658_492_1100 199
44 3300003320 rootH2_10091819 rootH2_100918192 200
45 3300005289 Ga0065704_10088356 Ga0065704_100883561 200
46 3300013102 Ga0157371_10059636 Ga0157371_100596362 200
47 3300013102 Ga0157371_10691413 Ga0157371_106914131 200
48 3300025920 Ga0207649_10113817 Ga0207649_101138172 200
49 3300032004 Ga0307414_10000019 Ga0307414_1000001971 200
50 3300044712 Ga0453684_0554026 Ga0453684_0554026_265_870 200
51 3300053136 Ga0500559_0014932 Ga0500559_0014932_2534_3139 200
52 iso_pu_bacteria 2599185156 2599331722 200
53 iso_pu_bacteria 2842922631 2842924127 200
54 3300005563 Ga0068855_100724845 Ga0068855_1007248452 201
55 3300027907 Ga0207428_10098996 Ga0207428_100989961 201
56 3300005440 Ga0070705_100554368 Ga0070705_1005543681 202
57 3300005467 Ga0070706_100101031 Ga0070706_1001010313 202
58 3300010159 Ga0099796_10077117 Ga0099796_100771172 202
59 3300013100 Ga0157373_10000471 Ga0157373_100004711 202
60 3300025910 Ga0207684_10154075 Ga0207684_101540752 202
61 3300042876 Ga0451577_0000006 Ga0451577_0000006_322350_322961 202
62 3300042876 Ga0451577_0008708 Ga0451577_0008708_4172_4783 202
63 3300044673 Ga0453683_0000096 Ga0453683_0000096_36139_36750 202
64 3300044712 Ga0453684_0000037 Ga0453684_0000037_322345_322956 202
65 3300044712 Ga0453684_0020468 Ga0453684_0020468_5264_5875 202
66 3300049665 Ga0501227_000920 Ga0501227_000920_2027_2638 202
67 3300005340 Ga0070689_100001067 Ga0070689_1000010678 203
68 3300005343 Ga0070687_100078672 Ga0070687_1000786722 203
69 3300005354 Ga0070675_100176879 Ga0070675_1001768792 203
70 3300005466 Ga0070685_10072496 Ga0070685_100724963 203
71 3300025918 Ga0207662_10048906 Ga0207662_100489062 203
72 3300025926 Ga0207659_10143592 Ga0207659_101435922 203
73 3300025936 Ga0207670_10013640 Ga0207670_100136403 203
74 3300031235 Ga0265330_10000339 Ga0265330_1000033919 203
75 3300031241 Ga0265325_10035815 Ga0265325_100358153 203
76 3300031344 Ga0265316_10000272 Ga0265316_1000027237 203
77 3300031711 Ga0265314_10001045 Ga0265314_1000104519 203
78 3300046543 Ga0495645_0218884 Ga0495645_0218884_131_745 203
79 3300048917 Ga0496114_0232943 Ga0496114_0232943_273_887 203
80 3300005467 Ga0070706_100001357 Ga0070706_1000013571 204
81 3300005615 Ga0070702_100354077 Ga0070702_1003540771 204
82 3300006038 Ga0075365_10000019 Ga0075365_1000001945 204
83 3300006048 Ga0075363_100007297 Ga0075363_1000072973 204
84 3300006051 Ga0075364_10007715 Ga0075364_100077155 204
85 3300006051 Ga0075364_10008355 Ga0075364_100083557 204
86 3300025910 Ga0207684_10015100 Ga0207684_100151002 204
87 3300025926 Ga0207659_10764622 Ga0207659_107646221 204
88 3300026088 Ga0207641_10869703 Ga0207641_108697032 204
89 3300026095 Ga0207676_10422126 Ga0207676_104221262 204
90 3300046454 Ga0495592_0315043 Ga0495592_0315043_253_870 204
91 3300046516 Ga0495628_0017519 Ga0495628_0017519_4174_4791 204
92 3300046529 Ga0495652_0138714 Ga0495652_0138714_1197_1814 204
93 3300047444 Ga0495675_0070281 Ga0495675_0070281_1431_2048 204
94 3300047471 Ga0495684_0081477 Ga0495684_0081477_715_1332 204
95 3300050491 nmdc:mga00v17_463_c1 nmdc:mga00v17_463_c1_5381_5998 204
96 3300050491 nmdc:mga00v17_94_c1 nmdc:mga00v17_94_c1_2549_3166 204
97 3300050492 nmdc:mga0yw44_48_c1 nmdc:mga0yw44_48_c1_22576_23193 204
98 3300050508 nmdc:mga09592_903169_c1 nmdc:mga09592_903169_c1_97_714 204
99 3300053080 Ga0500635_0014530 Ga0500635_0014530_753_1382 204
100 3300005719 Ga0068861_100012065 Ga0068861_1000120654 205
101 3300009553 Ga0105249_10019631 Ga0105249_100196313 205
102 3300025942 Ga0207689_10945183 Ga0207689_109451831 205
103 3300025961 Ga0207712_10032208 Ga0207712_100322082 205
104 3300026118 Ga0207675_100006220 Ga0207675_1000062202 205
105 3300035170 Ga0373943_0184476 Ga0373943_0184476_145_765 205
106 3300037068 Ga0373925_0226994 Ga0373925_0226994_115_735 205
107 3300044712 Ga0453684_0158611 Ga0453684_0158611_447_1067 205
108 3300045051 Ga0451576_0073201 Ga0451576_0073201_2822_3442 205
109 3300005327 Ga0070658_10000253 Ga0070658_1000025315 206
110 3300005445 Ga0070708_100218344 Ga0070708_1002183442 206
111 3300005445 Ga0070708_100444065 Ga0070708_1004440652 206
112 3300005467 Ga0070706_100102462 Ga0070706_1001024622 206
113 3300005471 Ga0070698_100004089 Ga0070698_10000408914 206
114 3300005518 Ga0070699_100007845 Ga0070699_1000078459 206
115 3300005539 Ga0068853_100000001 Ga0068853_10000000147 206
116 3300005539 Ga0068853_101081468 Ga0068853_1010814681 206
117 3300005563 Ga0068855_100285878 Ga0068855_1002858782 206
118 3300005563 Ga0068855_100592610 Ga0068855_1005926102 206
119 3300005616 Ga0068852_100245266 Ga0068852_1002452663 206
120 3300005842 Ga0068858_100779888 Ga0068858_1007798882 206
121 3300005985 Ga0081539_10039758 Ga0081539_100397582 206
122 3300006028 Ga0070717_10014028 Ga0070717_100140282 206
123 3300006844 Ga0075428_100169680 Ga0075428_1001696802 206
124 3300007788 Ga0099795_10012662 Ga0099795_100126622 206
125 3300009094 Ga0111539_10061127 Ga0111539_100611272 206
126 3300009177 Ga0105248_11359952 Ga0105248_113599521 206
127 3300009545 Ga0105237_10004792 Ga0105237_1000479213 206
128 3300009545 Ga0105237_10288780 Ga0105237_102887802 206
129 3300025909 Ga0207705_10005194 Ga0207705_100051942 206
130 3300025914 Ga0207671_10011955 Ga0207671_100119556 206
131 3300025939 Ga0207665_10032087 Ga0207665_100320872 206
132 3300025941 Ga0207711_10731500 Ga0207711_107315002 206
133 3300026035 Ga0207703_10013245 Ga0207703_100132455 206
134 3300026035 Ga0207703_10077720 Ga0207703_100777205 206
135 3300026041 Ga0207639_10000001 Ga0207639_10000001398 206
136 3300026041 Ga0207639_11026578 Ga0207639_110265781 206
137 3300032002 Ga0307416_100559592 Ga0307416_1005595921 206
138 3300037471 Ga0395905_0132633 Ga0395905_0132633_1015_1644 206
139 3300046535 Ga0495586_0103936 Ga0495586_0103936_352_984 206
140 3300046543 Ga0495645_0017683 Ga0495645_0017683_1839_2468 206
141 3300049569 Ga0501032_0065580 Ga0501032_0065580_394_1017 206
142 3300049570 Ga0501033_0020366 Ga0501033_0020366_3668_4291 206
143 3300049571 Ga0501034_0000428 Ga0501034_0000428_44039_44662 206
144 3300049572 Ga0501036_0141617 Ga0501036_0141617_759_1382 206
145 3300049573 Ga0501037_0007225 Ga0501037_0007225_3022_3645 206
146 3300049574 Ga0501038_0003439 Ga0501038_0003439_988_1611 206
147 3300049579 Ga0501043_0182233 Ga0501043_0182233_739_1362 206
148 3300049579 Ga0501043_0204580 Ga0501043_0204580_729_1352 206
149 3300049581 Ga0501047_0084997 Ga0501047_0084997_2398_3021 206
150 3300049581 Ga0501047_0213625 Ga0501047_0213625_1138_1761 206
151 3300049589 Ga0501073_0113186 Ga0501073_0113186_30_653 206
152 3300049822 Ga0501035_0092205 Ga0501035_0092205_1953_2576 206
153 3300049823 Ga0501044_0248444 Ga0501044_0248444_242_865 206
154 3300049823 Ga0501044_0267255 Ga0501044_0267255_859_1482 206
155 iso_pu_bacteria 2582581311 2585291519 206
156 iso_pu_bacteria 2599185239 2599736551 206
157 iso_pu_bacteria 2599185240 2599744614 206
158 iso_pu_bacteria 2599185355 2600206025 206
159 iso_pu_bacteria 2675903129 2676742740 206
160 iso_pu_bacteria 2816332253 2817261249 206
161 iso_pu_bacteria 2816332256 2817278938 206
162 iso_pu_bacteria 2816332286 2817451347 206
163 iso_pu_bacteria 2818991452 2819631035 206
164 iso_pu_bacteria 2863421361 2863424861 206
165 iso_pu_bacteria 2904564687 2904568881 206
166 iso_pu_bacteria 2904571731 2904576363 206
167 iso_pu_bacteria 2928157003 2928160152 206
168 iso_pu_bacteria 2928163908 2928168593 206
169 iso_pu_bacteria 2928170801 2928171850 206
170 iso_pu_bacteria 2928536128 2928540059 206
171 iso_pu_bacteria 2981990288 2981994693 206
172 iso_pu_bacteria 641736154 642418172 206
173 iso_pu_bacteria 8018845410 8018851490 206
174 iso_pu_bacteria 8020807995 8020810770 206
175 iso_pu_bacteria 8020938398 8020941981 206
176 iso_pu_bacteria 8020945358 8020946157 206
177 iso_pu_bacteria 8020953355 8020956822 206
178 iso_pu_bacteria 8021120328 8021122325 206
179 iso_pu_bacteria 8040167225 8040168956 206
180 iso_pu_bacteria 8040173305 8040174826 206
181 3300005547 Ga0070693_100485592 Ga0070693_1004855922 207
182 3300005844 Ga0068862_100146030 Ga0068862_1001460303 207
183 3300006871 Ga0075434_100352522 Ga0075434_1003525222 207
184 3300039437 Ga0436365_0594925 Ga0436365_0594925_193_819 207
185 3300009093 Ga0105240_10495299 Ga0105240_104952992 208
186 3300009545 Ga0105237_10155838 Ga0105237_101558382 208
187 3300013105 Ga0157369_10261992 Ga0157369_102619922 208
188 3300025246 Ga0209646_1016188 Ga0209646_10161882 208
189 3300025913 Ga0207695_10416447 Ga0207695_104164472 208
190 3300046507 Ga0495606_0149982 Ga0495606_0149982_464_1090 208
191 3300046531 Ga0495665_0033069 Ga0495665_0033069_1203_1829 208
192 3300046535 Ga0495586_0137724 Ga0495586_0137724_306_932 208
193 3300047319 Ga0495674_0249887 Ga0495674_0249887_371_997 208
194 3300047322 Ga0495680_0053358 Ga0495680_0053358_1988_2614 208
195 3300048088 Ga0495602_0269787 Ga0495602_0269787_279_905 208
196 3300048906 Ga0496103_0231391 Ga0496103_0231391_247_873 208
197 3300048907 Ga0496104_0072629 Ga0496104_0072629_38_664 208
198 3300048922 Ga0496119_0068211 Ga0496119_0068211_769_1395 208
199 3300048929 Ga0496126_0259396 Ga0496126_0259396_65_691 208
200 3300005844 Ga0068862_100319524 Ga0068862_1003195242 209
201 3300025925 Ga0207650_10848153 Ga0207650_108481531 209
202 3300025926 Ga0207659_10060544 Ga0207659_100605442 209
203 3300025928 Ga0207700_10478662 Ga0207700_104786621 209
204 3300026035 Ga0207703_10988279 Ga0207703_109882791 209
205 3300041503 Ga0451847_0454310 Ga0451847_0454310_12_656 209
206 3300046517 Ga0495630_0550332 Ga0495630_0550332_17_742 209
207 3300046559 Ga0495667_0231605 Ga0495667_0231605_392_1117 209
208 3300001989 JGI24739J22299_10004240 JGI24739J22299_100042402 210
209 3300003320 rootH2_10106903 rootH2_101069032 210
210 3300003758 Ga0055532_1001848 Ga0055532_10018482 210
211 3300003758 Ga0055532_1001863 Ga0055532_10018633 210
212 3300003758 Ga0055532_1002185 Ga0055532_10021853 210
213 3300003760 Ga0055527_1000285 Ga0055527_100028528 210
214 3300003760 Ga0055527_1000469 Ga0055527_100046911 210
215 3300003761 Ga0055535_1000501 Ga0055535_100050133 210
216 3300003761 Ga0055535_1001165 Ga0055535_100116511 210
217 3300003762 Ga0055542_1000602 Ga0055542_10006023 210
218 3300003762 Ga0055542_1012813 Ga0055542_10128132 210
219 3300003763 Ga0055529_1000251 Ga0055529_100025117 210
220 3300003763 Ga0055529_1014118 Ga0055529_10141182 210
221 3300005327 Ga0070658_10231861 Ga0070658_102318612 210
222 3300005339 Ga0070660_100000007 Ga0070660_10000000710 210
223 3300005366 Ga0070659_100000019 Ga0070659_100000019123 210
224 3300005455 Ga0070663_100006300 Ga0070663_1000063003 210
225 3300005563 Ga0068855_100507042 Ga0068855_1005070422 210
226 3300005564 Ga0070664_100149721 Ga0070664_1001497212 210
227 3300005577 Ga0068857_100281820 Ga0068857_1002818202 210
228 3300005616 Ga0068852_100220209 Ga0068852_1002202092 210
229 3300009093 Ga0105240_10003575 Ga0105240_1000357514 210
230 3300009093 Ga0105240_10122905 Ga0105240_101229052 210
231 3300009177 Ga0105248_10608381 Ga0105248_106083812 210
232 3300009545 Ga0105237_10035442 Ga0105237_100354424 210
233 3300009551 Ga0105238_10887045 Ga0105238_108870452 210
234 3300015261 Ga0182006_1116341 Ga0182006_11163412 210
235 3300025225 Ga0209566_103062 Ga0209566_1030622 210
236 3300025228 Ga0209672_100014 Ga0209672_100014300 210
237 3300025228 Ga0209672_100023 Ga0209672_100023320 210
238 3300025229 Ga0209147_100094 Ga0209147_10009422 210
239 3300025229 Ga0209147_100186 Ga0209147_10018620 210
240 3300025229 Ga0209147_100208 Ga0209147_10020842 210
241 3300025242 Ga0209258_100040 Ga0209258_100040205 210
242 3300025242 Ga0209258_100142 Ga0209258_10014211 210
243 3300025254 Ga0209148_1000035 Ga0209148_1000035205 210
244 3300025254 Ga0209148_1000513 Ga0209148_10005133 210
245 3300025254 Ga0209148_1001094 Ga0209148_10010943 210
246 3300025256 Ga0209759_1002608 Ga0209759_10026084 210
247 3300025272 Ga0209455_1000072 Ga0209455_1000072247 210
248 3300025272 Ga0209455_1000634 Ga0209455_10006342 210
249 3300025273 Ga0209673_1000030 Ga0209673_1000030211 210
250 3300025295 Ga0209564_1003030 Ga0209564_10030303 210
251 3300025904 Ga0207647_10001702 Ga0207647_100017024 210
252 3300025913 Ga0207695_10001245 Ga0207695_1000124510 210
253 3300025913 Ga0207695_10404935 Ga0207695_104049352 210
254 3300025914 Ga0207671_10026320 Ga0207671_100263203 210
255 3300025919 Ga0207657_10000004 Ga0207657_10000004168 210
256 3300025924 Ga0207694_10194281 Ga0207694_101942812 210
257 3300025932 Ga0207690_10000015 Ga0207690_10000015124 210
258 3300025945 Ga0207679_11214290 Ga0207679_112142901 210
259 3300026041 Ga0207639_10392814 Ga0207639_103928141 210
260 3300026067 Ga0207678_10001093 Ga0207678_1000109315 210
261 3300026116 Ga0207674_10601250 Ga0207674_106012502 210
262 3300026142 Ga0207698_10017462 Ga0207698_100174623 210
263 3300027312 Ga0209371_1000290 Ga0209371_10002907 210
264 3300030500 Ga0268256_1000224 Ga0268256_100022413 210
265 3300037471 Ga0395905_0017838 Ga0395905_0017838_2931_3581 210
266 3300039437 Ga0436365_0253137 Ga0436365_0253137_715_1347 210
267 3300046463 Ga0495653_0490543 Ga0495653_0490543_99_743 210
268 3300047444 Ga0495675_0213128 Ga0495675_0213128_132_773 210
269 3300048915 Ga0496112_0828197 Ga0496112_0828197_144_776 210
270 3300048921 Ga0496118_0150251 Ga0496118_0150251_115_747 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

9

211

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.983 1 204
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.9641 1 204
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.9539 4 204
2h0r-assembly7.cif.gz_G structure of the yeast nicotinamidase pnc1p 0.9347 6 202
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.9252 5 202
ID Description Score Start End Superfamily
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.983 1 204 3.40.50.850
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9641 1 204 3.40.50.850
af_P21369_4_203_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9586 7 200 3.40.50.850
af_Q54BH7_1_207_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9584 6 204 3.40.50.850
3r2jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9479 4 204 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A375BF06-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 1 5 204 GO:0008936
GO:0019363
GO:0046872
AF-I3TMZ3-F1-model_v4 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (EC 2.1.1.200) (tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase) (tRNA Cm32/Um32 methyltransferase) 0.9995 5 204 GO:0003723
GO:0005737
GO:0008033
GO:0016811
GO:0019363
GO:0032259
GO:0046872
GO:0160206
AF-A0A2E3EKS4-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9995 5 204 GO:0016811
GO:0019363
GO:0046872
AF-A0A382WNS2-F1-model_v4 Uncharacterized protein 0.999 7 121 GO:0016811
AF-A0A536YUJ8-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9989 5 204 GO:0008936
GO:0019363
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.34 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map