F376910
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 194 | 242 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10608381|Ga0105248_106083812 |
| Length | 245 |
| Sequence | MKTARKSRRALILVDLQNDFLPGGALAVPGGDAVIPVANKLQRSGNFDLIVATQDWHPRDHGSFAPNHRGKTPGEVVNLNGLRQILWPIHCVQNTRGAEFSPALDVSRINKIIHKGTDPWIDSYSTFFDNGHRKNTGLDRYLKARGVTDVYLAGLATDYCVKFSALDARQLGFNVHVIEDGCRGIDLRHGDVDAAIEQMRRAGAQITRSTRVATAAKTRSRTRGKDVTSQPARRRSKRKLASAKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 2 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 3 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 4 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 5 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 6 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 7 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 8 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 9 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 10 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 11 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 12 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 13 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 14 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 15 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 16 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 17 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 18 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 19 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 80 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 134 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 135 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 136 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 161 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 176 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 177 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 178 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 184 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 185 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 186 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 187 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 188 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 189 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 190 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 191 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 192 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 193 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 194 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.63 |
| Metatranscriptomes | 0 |
| Isolates | 10.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.3 |
| Nodule | 0 |
| Rhizoplane | 3.33 |
| Rhizosphere | 71.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10004240 | 3300001989 | Bacteria | 5489 |
| 2 | rootH2_10091819 | 3300003320 | Bacteria | 1525 |
| 3 | rootH2_10106903 | 3300003320 | Bacteria | 1785 |
| 4 | Ga0055532_1001848 | 3300003758 | Bacteria | 5195 |
| 5 | Ga0055532_1001863 | 3300003758 | Bacteria | 5152 |
| 6 | Ga0055532_1002185 | 3300003758 | Bacteria | 4334 |
| 7 | Ga0055527_1000285 | 3300003760 | Bacteria | 29822 |
| 8 | Ga0055527_1000469 | 3300003760 | Bacteria | 15440 |
| 9 | Ga0055535_1000501 | 3300003761 | Bacteria | 34751 |
| 10 | Ga0055535_1001165 | 3300003761 | Bacteria | 15440 |
| 11 | Ga0055542_1000602 | 3300003762 | Bacteria | 30738 |
| 12 | Ga0055542_1012813 | 3300003762 | Bacteria | 1436 |
| 13 | Ga0055529_1000251 | 3300003763 | Bacteria | 65519 |
| 14 | Ga0055529_1014118 | 3300003763 | Bacteria | 1013 |
| 15 | Ga0065704_10088356 | 3300005289 | Bacteria | 2944 |
| 16 | Ga0070658_10000253 | 3300005327 | Bacteria | 46941 |
| 17 | Ga0070658_10231861 | 3300005327 | Bacteria | 1563 |
| 18 | Ga0070660_100000007 | 3300005339 | Bacteria | 162039 |
| 19 | Ga0070689_100001067 | 3300005340 | Bacteria | 17193 |
| 20 | Ga0070687_100078672 | 3300005343 | Bacteria | 1793 |
| 21 | Ga0070675_100176879 | 3300005354 | Bacteria | 1843 |
| 22 | Ga0070659_100000019 | 3300005366 | Bacteria | 156016 |
| 23 | Ga0070714_100254334 | 3300005435 | Bacteria | 1625 |
| 24 | Ga0070713_100098173 | 3300005436 | Bacteria | 2532 |
| 25 | Ga0070705_100554368 | 3300005440 | Bacteria | 882 |
| 26 | Ga0070708_100218344 | 3300005445 | Bacteria | 1788 |
| 27 | Ga0070708_100444065 | 3300005445 | Bacteria | 1224 |
| 28 | Ga0070663_100006300 | 3300005455 | Bacteria | 7120 |
| 29 | Ga0070685_10072496 | 3300005466 | Bacteria | 2045 |
| 30 | Ga0070706_100001357 | 3300005467 | Bacteria | 26038 |
| 31 | Ga0070706_100101031 | 3300005467 | Unclassified | 2681 |
| 32 | Ga0070706_100102462 | 3300005467 | Bacteria | 2661 |
| 33 | Ga0070698_100004089 | 3300005471 | Bacteria | 16027 |
| 34 | Ga0070699_100007845 | 3300005518 | Bacteria | 9274 |
| 35 | Ga0068853_100000001 | 3300005539 | Bacteria | 715840 |
| 36 | Ga0068853_101081468 | 3300005539 | Bacteria | 773 |
| 37 | Ga0070693_100485592 | 3300005547 | Bacteria | 873 |
| 38 | Ga0068855_100285878 | 3300005563 | Bacteria | 1830 |
| 39 | Ga0068855_100507042 | 3300005563 | Bacteria | 1310 |
| 40 | Ga0068855_100592610 | 3300005563 | Bacteria | 1196 |
| 41 | Ga0068855_100724845 | 3300005563 | Bacteria | 1062 |
| 42 | Ga0070664_100149721 | 3300005564 | Bacteria | 2060 |
| 43 | Ga0068857_100281820 | 3300005577 | Bacteria | 1529 |
| 44 | Ga0070702_100354077 | 3300005615 | Bacteria | 1035 |
| 45 | Ga0068852_100220209 | 3300005616 | Bacteria | 1804 |
| 46 | Ga0068852_100245266 | 3300005616 | Bacteria | 1714 |
| 47 | Ga0068864_100298249 | 3300005618 | Bacteria | 1508 |
| 48 | Ga0068861_100012065 | 3300005719 | Bacteria | 6021 |
| 49 | Ga0068858_100779888 | 3300005842 | Bacteria | 932 |
| 50 | Ga0068862_100146030 | 3300005844 | Bacteria | 2102 |
| 51 | Ga0068862_100319524 | 3300005844 | Bacteria | 1433 |
| 52 | Ga0081539_10039758 | 3300005985 | Bacteria | 2771 |
| 53 | Ga0070717_10014028 | 3300006028 | Bacteria | 6157 |
| 54 | Ga0075365_10000019 | 3300006038 | Bacteria | 65113 |
| 55 | Ga0075363_100001712 | 3300006048 | Bacteria | 8524 |
| 56 | Ga0075363_100007297 | 3300006048 | Bacteria | 5069 |
| 57 | Ga0075364_10007715 | 3300006051 | Bacteria | 6404 |
| 58 | Ga0075364_10008355 | 3300006051 | Bacteria | 6184 |
| 59 | Ga0075364_10145796 | 3300006051 | Eukaryota | 1594 |
| 60 | Ga0075369_10000270 | 3300006186 | Bacteria | 15473 |
| 61 | Ga0075370_10000137 | 3300006353 | Bacteria | 24856 |
| 62 | Ga0075428_100169680 | 3300006844 | Bacteria | 2366 |
| 63 | Ga0075434_100034907 | 3300006871 | Eukaryota | 4970 |
| 64 | Ga0075434_100352522 | 3300006871 | Bacteria | 1493 |
| 65 | Ga0075429_100032299 | 3300006880 | Eukaryota | 4550 |
| 66 | Ga0099795_10012662 | 3300007788 | Unclassified | 2565 |
| 67 | Ga0105240_10003575 | 3300009093 | Bacteria | 24117 |
| 68 | Ga0105240_10122905 | 3300009093 | Bacteria | 3124 |
| 69 | Ga0105240_10495299 | 3300009093 | Bacteria | 1360 |
| 70 | Ga0111539_10061127 | 3300009094 | Unclassified | 4463 |
| 71 | Ga0114129_10092210 | 3300009147 | Bacteria | 4197 |
| 72 | Ga0105248_10608381 | 3300009177 | Unclassified | 1233 |
| 73 | Ga0105248_11359952 | 3300009177 | Bacteria | 803 |
| 74 | Ga0105237_10004792 | 3300009545 | Bacteria | 15543 |
| 75 | Ga0105237_10035442 | 3300009545 | Bacteria | 5049 |
| 76 | Ga0105237_10155838 | 3300009545 | Bacteria | 2281 |
| 77 | Ga0105237_10288780 | 3300009545 | Bacteria | 1643 |
| 78 | Ga0105238_10887045 | 3300009551 | Bacteria | 910 |
| 79 | Ga0105249_10019631 | 3300009553 | Bacteria | 6032 |
| 80 | Ga0099796_10077117 | 3300010159 | Bacteria | 1215 |
| 81 | Ga0157373_10000471 | 3300013100 | Bacteria | 31950 |
| 82 | Ga0157371_10059636 | 3300013102 | Bacteria | 2705 |
| 83 | Ga0157371_10691413 | 3300013102 | Bacteria | 763 |
| 84 | Ga0157369_10261992 | 3300013105 | Bacteria | 1803 |
| 85 | Ga0182006_1116341 | 3300015261 | Bacteria | 934 |
| 86 | Ga0213872_10121179 | 3300021361 | Bacteria | 1156 |
| 87 | Ga0213876_10031111 | 3300021384 | Bacteria | 2817 |
| 88 | Ga0213871_10000805 | 3300021441 | Unclassified | 4686 |
| 89 | Ga0213871_10010964 | 3300021441 | Bacteria | 2070 |
| 90 | Ga0213871_10012710 | 3300021441 | Bacteria | 1963 |
| 91 | Ga0209566_103062 | 3300025225 | Bacteria | 2736 |
| 92 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 93 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 94 | Ga0209147_100094 | 3300025229 | Bacteria | 167145 |
| 95 | Ga0209147_100186 | 3300025229 | Bacteria | 73135 |
| 96 | Ga0209147_100208 | 3300025229 | Bacteria | 62998 |
| 97 | Ga0209258_100040 | 3300025242 | Bacteria | 385401 |
| 98 | Ga0209258_100142 | 3300025242 | Bacteria | 165865 |
| 99 | Ga0209646_1016188 | 3300025246 | Bacteria | 1108 |
| 100 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 101 | Ga0209148_1000513 | 3300025254 | Bacteria | 38858 |
| 102 | Ga0209148_1001094 | 3300025254 | Bacteria | 16351 |
| 103 | Ga0209759_1002608 | 3300025256 | Bacteria | 7776 |
| 104 | Ga0209455_1000072 | 3300025272 | Bacteria | 293074 |
| 105 | Ga0209455_1000634 | 3300025272 | Bacteria | 21681 |
| 106 | Ga0209673_1000030 | 3300025273 | Bacteria | 351933 |
| 107 | Ga0209564_1003030 | 3300025295 | Bacteria | 11975 |
| 108 | Ga0207647_10001702 | 3300025904 | Bacteria | 16928 |
| 109 | Ga0207705_10005194 | 3300025909 | Bacteria | 9759 |
| 110 | Ga0207684_10015100 | 3300025910 | Bacteria | 6648 |
| 111 | Ga0207684_10154075 | 3300025910 | Unclassified | 1977 |
| 112 | Ga0207695_10001245 | 3300025913 | Bacteria | 43532 |
| 113 | Ga0207695_10404935 | 3300025913 | Bacteria | 1249 |
| 114 | Ga0207695_10416447 | 3300025913 | Bacteria | 1228 |
| 115 | Ga0207671_10011955 | 3300025914 | Bacteria | 7017 |
| 116 | Ga0207671_10026320 | 3300025914 | Bacteria | 4362 |
| 117 | Ga0207662_10048906 | 3300025918 | Bacteria | 2507 |
| 118 | Ga0207657_10000004 | 3300025919 | Bacteria | 247179 |
| 119 | Ga0207649_10113817 | 3300025920 | Bacteria | 1812 |
| 120 | Ga0207694_10194281 | 3300025924 | Bacteria | 1649 |
| 121 | Ga0207650_10848153 | 3300025925 | Bacteria | 775 |
| 122 | Ga0207659_10060544 | 3300025926 | Bacteria | 2725 |
| 123 | Ga0207659_10143592 | 3300025926 | Bacteria | 1856 |
| 124 | Ga0207659_10764622 | 3300025926 | Bacteria | 829 |
| 125 | Ga0207700_10231676 | 3300025928 | Bacteria | 1571 |
| 126 | Ga0207700_10478662 | 3300025928 | Bacteria | 1100 |
| 127 | Ga0207664_10431978 | 3300025929 | Bacteria | 1174 |
| 128 | Ga0207690_10000015 | 3300025932 | Bacteria | 257457 |
| 129 | Ga0207670_10013640 | 3300025936 | Bacteria | 4798 |
| 130 | Ga0207665_10032087 | 3300025939 | Bacteria | 3477 |
| 131 | Ga0207711_10731500 | 3300025941 | Bacteria | 922 |
| 132 | Ga0207689_10945183 | 3300025942 | Bacteria | 727 |
| 133 | Ga0207679_11214290 | 3300025945 | Bacteria | 692 |
| 134 | Ga0207712_10032208 | 3300025961 | Unclassified | 3537 |
| 135 | Ga0207703_10013245 | 3300026035 | Bacteria | 6423 |
| 136 | Ga0207703_10077720 | 3300026035 | Bacteria | 2756 |
| 137 | Ga0207703_10988279 | 3300026035 | Bacteria | 807 |
| 138 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 139 | Ga0207639_10392814 | 3300026041 | Bacteria | 1248 |
| 140 | Ga0207639_11026578 | 3300026041 | Bacteria | 773 |
| 141 | Ga0207678_10001093 | 3300026067 | Bacteria | 24884 |
| 142 | Ga0207641_10869703 | 3300026088 | Bacteria | 894 |
| 143 | Ga0207676_10235892 | 3300026095 | Bacteria | 1638 |
| 144 | Ga0207676_10422126 | 3300026095 | Unclassified | 1251 |
| 145 | Ga0207674_10601250 | 3300026116 | Bacteria | 1062 |
| 146 | Ga0207675_100006220 | 3300026118 | Bacteria | 11336 |
| 147 | Ga0207698_10017462 | 3300026142 | Bacteria | 4869 |
| 148 | Ga0209371_1000290 | 3300027312 | Bacteria | 57261 |
| 149 | Ga0207428_10098996 | 3300027907 | Bacteria | 2255 |
| 150 | Ga0268256_1000224 | 3300030500 | Bacteria | 61981 |
| 151 | Ga0265330_10000339 | 3300031235 | Bacteria | 33381 |
| 152 | Ga0265325_10035815 | 3300031241 | Bacteria | 2633 |
| 153 | Ga0265327_10000601 | 3300031251 | Bacteria | 59701 |
| 154 | Ga0265316_10000272 | 3300031344 | Bacteria | 58100 |
| 155 | Ga0265314_10001045 | 3300031711 | Bacteria | 32296 |
| 156 | Ga0307416_100559592 | 3300032002 | Bacteria | 1218 |
| 157 | Ga0307414_10000019 | 3300032004 | Bacteria | 235390 |
| 158 | Ga0373943_0184476 | 3300035170 | Bacteria | 1148 |
| 159 | Ga0373925_0226994 | 3300037068 | Bacteria | 1492 |
| 160 | Ga0395905_0017838 | 3300037471 | Bacteria | 6743 |
| 161 | Ga0395905_0132633 | 3300037471 | Bacteria | 2343 |
| 162 | Ga0436364_0262393 | 3300037853 | Unclassified | 878 |
| 163 | Ga0436364_0695500 | 3300037853 | Bacteria | 1677 |
| 164 | Ga0436365_0253137 | 3300039437 | Bacteria | 1668 |
| 165 | Ga0436365_0594925 | 3300039437 | Bacteria | 1182 |
| 166 | Ga0436365_0712819 | 3300039437 | Bacteria | 66345 |
| 167 | Ga0436360_0188981 | 3300039438 | Unclassified | 2459 |
| 168 | Ga0436360_0614620 | 3300039438 | Bacteria | 2844 |
| 169 | Ga0436360_0898544 | 3300039438 | Unclassified | 4607 |
| 170 | Ga0436360_0979639 | 3300039438 | Unclassified | 828 |
| 171 | Ga0436360_1334329 | 3300039438 | Bacteria | 2191 |
| 172 | Ga0436361_0571094 | 3300039447 | Unclassified | 1554 |
| 173 | Ga0436361_0639752 | 3300039447 | Bacteria | 1516 |
| 174 | Ga0436361_0698608 | 3300039447 | Bacteria | 2512 |
| 175 | Ga0436362_0733281 | 3300039453 | Bacteria | 1141 |
| 176 | Ga0436362_0872268 | 3300039453 | Bacteria | 1121 |
| 177 | Ga0451847_0454310 | 3300041503 | Bacteria | 687 |
| 178 | Ga0451577_0000006 | 3300042876 | Bacteria | 709265 |
| 179 | Ga0451577_0008708 | 3300042876 | Bacteria | 9839 |
| 180 | Ga0451577_0264556 | 3300042876 | Bacteria | 1557 |
| 181 | Ga0451577_0801001 | 3300042876 | Bacteria | 851 |
| 182 | Ga0453683_0000096 | 3300044673 | Bacteria | 132402 |
| 183 | Ga0453684_0000037 | 3300044712 | Bacteria | 709327 |
| 184 | Ga0453684_0020468 | 3300044712 | Bacteria | 9974 |
| 185 | Ga0453684_0158611 | 3300044712 | Bacteria | 2679 |
| 186 | Ga0453684_0554026 | 3300044712 | Bacteria | 1266 |
| 187 | Ga0453684_0562658 | 3300044712 | Bacteria | 1254 |
| 188 | Ga0451576_0073201 | 3300045051 | Bacteria | 3566 |
| 189 | Ga0495592_0315043 | 3300046454 | Bacteria | 1013 |
| 190 | Ga0495653_0490543 | 3300046463 | Bacteria | 767 |
| 191 | Ga0495606_0149982 | 3300046507 | Bacteria | 1369 |
| 192 | Ga0495628_0017519 | 3300046516 | Bacteria | 5961 |
| 193 | Ga0495630_0550332 | 3300046517 | Bacteria | 885 |
| 194 | Ga0495652_0138714 | 3300046529 | Bacteria | 1915 |
| 195 | Ga0495665_0033069 | 3300046531 | Bacteria | 2766 |
| 196 | Ga0495586_0103936 | 3300046535 | Bacteria | 1578 |
| 197 | Ga0495586_0137724 | 3300046535 | Bacteria | 1369 |
| 198 | Ga0495645_0017683 | 3300046543 | Bacteria | 5110 |
| 199 | Ga0495645_0218884 | 3300046543 | Bacteria | 1282 |
| 200 | Ga0495667_0231605 | 3300046559 | Bacteria | 1178 |
| 201 | Ga0495674_0249887 | 3300047319 | Bacteria | 1459 |
| 202 | Ga0495680_0053358 | 3300047322 | Bacteria | 3147 |
| 203 | Ga0495675_0070281 | 3300047444 | Bacteria | 2210 |
| 204 | Ga0495675_0213128 | 3300047444 | Bacteria | 1172 |
| 205 | Ga0495684_0081477 | 3300047471 | Bacteria | 2456 |
| 206 | Ga0495602_0269787 | 3300048088 | Bacteria | 1258 |
| 207 | Ga0496103_0231391 | 3300048906 | Bacteria | 1189 |
| 208 | Ga0496104_0072629 | 3300048907 | Bacteria | 3272 |
| 209 | Ga0496112_0828197 | 3300048915 | Bacteria | 849 |
| 210 | Ga0496114_0232943 | 3300048917 | Bacteria | 1618 |
| 211 | Ga0496118_0150251 | 3300048921 | Bacteria | 1459 |
| 212 | Ga0496119_0068211 | 3300048922 | Bacteria | 2095 |
| 213 | Ga0496126_0259396 | 3300048929 | Bacteria | 1446 |
| 214 | Ga0501032_0065580 | 3300049569 | Bacteria | 2428 |
| 215 | Ga0501033_0020366 | 3300049570 | Bacteria | 5010 |
| 216 | Ga0501034_0000428 | 3300049571 | Bacteria | 69991 |
| 217 | Ga0501036_0141617 | 3300049572 | Bacteria | 2029 |
| 218 | Ga0501037_0007225 | 3300049573 | Bacteria | 8116 |
| 219 | Ga0501038_0003439 | 3300049574 | Bacteria | 14763 |
| 220 | Ga0501043_0182233 | 3300049579 | Bacteria | 1636 |
| 221 | Ga0501043_0204580 | 3300049579 | Bacteria | 1531 |
| 222 | Ga0501047_0084997 | 3300049581 | Bacteria | 3041 |
| 223 | Ga0501047_0213625 | 3300049581 | Bacteria | 1787 |
| 224 | Ga0501073_0113186 | 3300049589 | Bacteria | 1882 |
| 225 | Ga0501227_000920 | 3300049665 | Bacteria | 6448 |
| 226 | Ga0501035_0092205 | 3300049822 | Bacteria | 2666 |
| 227 | Ga0501044_0248444 | 3300049823 | Bacteria | 1721 |
| 228 | Ga0501044_0267255 | 3300049823 | Bacteria | 1647 |
| 229 | nmdc:mga03n38_317_c1 | 3300050490 | Bacteria | 11640 |
| 230 | nmdc:mga00v17_29902_c1 | 3300050491 | Bacteria | 3200 |
| 231 | nmdc:mga00v17_463_c1 | 3300050491 | Bacteria | 22736 |
| 232 | nmdc:mga00v17_94_c1 | 3300050491 | Bacteria | 52910 |
| 233 | nmdc:mga0yw44_48_c1 | 3300050492 | Bacteria | 40823 |
| 234 | nmdc:mga06z11_17636_c1 | 3300050494 | Eukaryota | 3245 |
| 235 | nmdc:mga07m45_184_c1 | 3300050496 | Bacteria | 24886 |
| 236 | nmdc:mga09592_10430_c1 | 3300050508 | Eukaryota | 7561 |
| 237 | nmdc:mga09592_903169_c1 | 3300050508 | Bacteria | 742 |
| 238 | nmdc:mga08y16_201329_c1 | 3300050511 | Bacteria | 2063 |
| 239 | nmdc:mga0n895_28648_c1 | 3300050512 | Bacteria | 5300 |
| 240 | nmdc:mga0sz30_143_c1 | 3300050516 | Bacteria | 26630 |
| 241 | Ga0500635_0014530 | 3300053080 | Bacteria | 2309 |
| 242 | Ga0500559_0014932 | 3300053136 | Bacteria | 3282 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_0979639 | Ga0436360_0979639_31_549 | 169 |
| 2 | 3300050511 | nmdc:mga08y16_201329_c1 | nmdc:mga08y16_201329_c1_1480_2034 | 180 |
| 3 | 3300005618 | Ga0068864_100298249 | Ga0068864_1002982491 | 189 |
| 4 | 3300026095 | Ga0207676_10235892 | Ga0207676_102358922 | 189 |
| 5 | 3300006048 | Ga0075363_100001712 | Ga0075363_10000171212 | 196 |
| 6 | 3300006051 | Ga0075364_10145796 | Ga0075364_101457962 | 196 |
| 7 | 3300006186 | Ga0075369_10000270 | Ga0075369_1000027018 | 196 |
| 8 | 3300006353 | Ga0075370_10000137 | Ga0075370_1000013712 | 196 |
| 9 | 3300006871 | Ga0075434_100034907 | Ga0075434_1000349075 | 196 |
| 10 | 3300006880 | Ga0075429_100032299 | Ga0075429_1000322993 | 196 |
| 11 | 3300009147 | Ga0114129_10092210 | Ga0114129_100922103 | 196 |
| 12 | 3300042876 | Ga0451577_0264556 | Ga0451577_0264556_237_830 | 196 |
| 13 | 3300042876 | Ga0451577_0801001 | Ga0451577_0801001_41_637 | 196 |
| 14 | 3300050490 | nmdc:mga03n38_317_c1 | nmdc:mga03n38_317_c1_7892_8509 | 196 |
| 15 | 3300050491 | nmdc:mga00v17_29902_c1 | nmdc:mga00v17_29902_c1_2547_3164 | 196 |
| 16 | 3300050494 | nmdc:mga06z11_17636_c1 | nmdc:mga06z11_17636_c1_2466_3083 | 196 |
| 17 | 3300050496 | nmdc:mga07m45_184_c1 | nmdc:mga07m45_184_c1_14230_14847 | 196 |
| 18 | 3300050508 | nmdc:mga09592_10430_c1 | nmdc:mga09592_10430_c1_1881_2498 | 196 |
| 19 | 3300050512 | nmdc:mga0n895_28648_c1 | nmdc:mga0n895_28648_c1_1964_2581 | 196 |
| 20 | 3300050516 | nmdc:mga0sz30_143_c1 | nmdc:mga0sz30_143_c1_14310_14927 | 196 |
| 21 | 3300005435 | Ga0070714_100254334 | Ga0070714_1002543341 | 197 |
| 22 | 3300005436 | Ga0070713_100098173 | Ga0070713_1000981732 | 197 |
| 23 | 3300021361 | Ga0213872_10121179 | Ga0213872_101211792 | 197 |
| 24 | 3300021384 | Ga0213876_10031111 | Ga0213876_100311112 | 197 |
| 25 | 3300021441 | Ga0213871_10000805 | Ga0213871_100008052 | 197 |
| 26 | 3300021441 | Ga0213871_10010964 | Ga0213871_100109641 | 197 |
| 27 | 3300021441 | Ga0213871_10012710 | Ga0213871_100127102 | 197 |
| 28 | 3300025928 | Ga0207700_10231676 | Ga0207700_102316761 | 197 |
| 29 | 3300025929 | Ga0207664_10431978 | Ga0207664_104319782 | 197 |
| 30 | 3300037853 | Ga0436364_0262393 | Ga0436364_0262393_243_845 | 197 |
| 31 | 3300037853 | Ga0436364_0695500 | Ga0436364_0695500_828_1430 | 197 |
| 32 | 3300039437 | Ga0436365_0712819 | Ga0436365_0712819_37346_37948 | 197 |
| 33 | 3300039438 | Ga0436360_0188981 | Ga0436360_0188981_798_1400 | 197 |
| 34 | 3300039438 | Ga0436360_0614620 | Ga0436360_0614620_302_904 | 197 |
| 35 | 3300039438 | Ga0436360_0898544 | Ga0436360_0898544_2687_3289 | 197 |
| 36 | 3300039438 | Ga0436360_1334329 | Ga0436360_1334329_358_960 | 197 |
| 37 | 3300039447 | Ga0436361_0571094 | Ga0436361_0571094_25_627 | 197 |
| 38 | 3300039447 | Ga0436361_0639752 | Ga0436361_0639752_679_1281 | 197 |
| 39 | 3300039447 | Ga0436361_0698608 | Ga0436361_0698608_314_916 | 197 |
| 40 | 3300039453 | Ga0436362_0733281 | Ga0436362_0733281_444_1046 | 197 |
| 41 | 3300039453 | Ga0436362_0872268 | Ga0436362_0872268_414_1016 | 197 |
| 42 | 3300031251 | Ga0265327_10000601 | Ga0265327_1000060151 | 199 |
| 43 | 3300044712 | Ga0453684_0562658 | Ga0453684_0562658_492_1100 | 199 |
| 44 | 3300003320 | rootH2_10091819 | rootH2_100918192 | 200 |
| 45 | 3300005289 | Ga0065704_10088356 | Ga0065704_100883561 | 200 |
| 46 | 3300013102 | Ga0157371_10059636 | Ga0157371_100596362 | 200 |
| 47 | 3300013102 | Ga0157371_10691413 | Ga0157371_106914131 | 200 |
| 48 | 3300025920 | Ga0207649_10113817 | Ga0207649_101138172 | 200 |
| 49 | 3300032004 | Ga0307414_10000019 | Ga0307414_1000001971 | 200 |
| 50 | 3300044712 | Ga0453684_0554026 | Ga0453684_0554026_265_870 | 200 |
| 51 | 3300053136 | Ga0500559_0014932 | Ga0500559_0014932_2534_3139 | 200 |
| 52 | iso_pu_bacteria | 2599185156 | 2599331722 | 200 |
| 53 | iso_pu_bacteria | 2842922631 | 2842924127 | 200 |
| 54 | 3300005563 | Ga0068855_100724845 | Ga0068855_1007248452 | 201 |
| 55 | 3300027907 | Ga0207428_10098996 | Ga0207428_100989961 | 201 |
| 56 | 3300005440 | Ga0070705_100554368 | Ga0070705_1005543681 | 202 |
| 57 | 3300005467 | Ga0070706_100101031 | Ga0070706_1001010313 | 202 |
| 58 | 3300010159 | Ga0099796_10077117 | Ga0099796_100771172 | 202 |
| 59 | 3300013100 | Ga0157373_10000471 | Ga0157373_100004711 | 202 |
| 60 | 3300025910 | Ga0207684_10154075 | Ga0207684_101540752 | 202 |
| 61 | 3300042876 | Ga0451577_0000006 | Ga0451577_0000006_322350_322961 | 202 |
| 62 | 3300042876 | Ga0451577_0008708 | Ga0451577_0008708_4172_4783 | 202 |
| 63 | 3300044673 | Ga0453683_0000096 | Ga0453683_0000096_36139_36750 | 202 |
| 64 | 3300044712 | Ga0453684_0000037 | Ga0453684_0000037_322345_322956 | 202 |
| 65 | 3300044712 | Ga0453684_0020468 | Ga0453684_0020468_5264_5875 | 202 |
| 66 | 3300049665 | Ga0501227_000920 | Ga0501227_000920_2027_2638 | 202 |
| 67 | 3300005340 | Ga0070689_100001067 | Ga0070689_1000010678 | 203 |
| 68 | 3300005343 | Ga0070687_100078672 | Ga0070687_1000786722 | 203 |
| 69 | 3300005354 | Ga0070675_100176879 | Ga0070675_1001768792 | 203 |
| 70 | 3300005466 | Ga0070685_10072496 | Ga0070685_100724963 | 203 |
| 71 | 3300025918 | Ga0207662_10048906 | Ga0207662_100489062 | 203 |
| 72 | 3300025926 | Ga0207659_10143592 | Ga0207659_101435922 | 203 |
| 73 | 3300025936 | Ga0207670_10013640 | Ga0207670_100136403 | 203 |
| 74 | 3300031235 | Ga0265330_10000339 | Ga0265330_1000033919 | 203 |
| 75 | 3300031241 | Ga0265325_10035815 | Ga0265325_100358153 | 203 |
| 76 | 3300031344 | Ga0265316_10000272 | Ga0265316_1000027237 | 203 |
| 77 | 3300031711 | Ga0265314_10001045 | Ga0265314_1000104519 | 203 |
| 78 | 3300046543 | Ga0495645_0218884 | Ga0495645_0218884_131_745 | 203 |
| 79 | 3300048917 | Ga0496114_0232943 | Ga0496114_0232943_273_887 | 203 |
| 80 | 3300005467 | Ga0070706_100001357 | Ga0070706_1000013571 | 204 |
| 81 | 3300005615 | Ga0070702_100354077 | Ga0070702_1003540771 | 204 |
| 82 | 3300006038 | Ga0075365_10000019 | Ga0075365_1000001945 | 204 |
| 83 | 3300006048 | Ga0075363_100007297 | Ga0075363_1000072973 | 204 |
| 84 | 3300006051 | Ga0075364_10007715 | Ga0075364_100077155 | 204 |
| 85 | 3300006051 | Ga0075364_10008355 | Ga0075364_100083557 | 204 |
| 86 | 3300025910 | Ga0207684_10015100 | Ga0207684_100151002 | 204 |
| 87 | 3300025926 | Ga0207659_10764622 | Ga0207659_107646221 | 204 |
| 88 | 3300026088 | Ga0207641_10869703 | Ga0207641_108697032 | 204 |
| 89 | 3300026095 | Ga0207676_10422126 | Ga0207676_104221262 | 204 |
| 90 | 3300046454 | Ga0495592_0315043 | Ga0495592_0315043_253_870 | 204 |
| 91 | 3300046516 | Ga0495628_0017519 | Ga0495628_0017519_4174_4791 | 204 |
| 92 | 3300046529 | Ga0495652_0138714 | Ga0495652_0138714_1197_1814 | 204 |
| 93 | 3300047444 | Ga0495675_0070281 | Ga0495675_0070281_1431_2048 | 204 |
| 94 | 3300047471 | Ga0495684_0081477 | Ga0495684_0081477_715_1332 | 204 |
| 95 | 3300050491 | nmdc:mga00v17_463_c1 | nmdc:mga00v17_463_c1_5381_5998 | 204 |
| 96 | 3300050491 | nmdc:mga00v17_94_c1 | nmdc:mga00v17_94_c1_2549_3166 | 204 |
| 97 | 3300050492 | nmdc:mga0yw44_48_c1 | nmdc:mga0yw44_48_c1_22576_23193 | 204 |
| 98 | 3300050508 | nmdc:mga09592_903169_c1 | nmdc:mga09592_903169_c1_97_714 | 204 |
| 99 | 3300053080 | Ga0500635_0014530 | Ga0500635_0014530_753_1382 | 204 |
| 100 | 3300005719 | Ga0068861_100012065 | Ga0068861_1000120654 | 205 |
| 101 | 3300009553 | Ga0105249_10019631 | Ga0105249_100196313 | 205 |
| 102 | 3300025942 | Ga0207689_10945183 | Ga0207689_109451831 | 205 |
| 103 | 3300025961 | Ga0207712_10032208 | Ga0207712_100322082 | 205 |
| 104 | 3300026118 | Ga0207675_100006220 | Ga0207675_1000062202 | 205 |
| 105 | 3300035170 | Ga0373943_0184476 | Ga0373943_0184476_145_765 | 205 |
| 106 | 3300037068 | Ga0373925_0226994 | Ga0373925_0226994_115_735 | 205 |
| 107 | 3300044712 | Ga0453684_0158611 | Ga0453684_0158611_447_1067 | 205 |
| 108 | 3300045051 | Ga0451576_0073201 | Ga0451576_0073201_2822_3442 | 205 |
| 109 | 3300005327 | Ga0070658_10000253 | Ga0070658_1000025315 | 206 |
| 110 | 3300005445 | Ga0070708_100218344 | Ga0070708_1002183442 | 206 |
| 111 | 3300005445 | Ga0070708_100444065 | Ga0070708_1004440652 | 206 |
| 112 | 3300005467 | Ga0070706_100102462 | Ga0070706_1001024622 | 206 |
| 113 | 3300005471 | Ga0070698_100004089 | Ga0070698_10000408914 | 206 |
| 114 | 3300005518 | Ga0070699_100007845 | Ga0070699_1000078459 | 206 |
| 115 | 3300005539 | Ga0068853_100000001 | Ga0068853_10000000147 | 206 |
| 116 | 3300005539 | Ga0068853_101081468 | Ga0068853_1010814681 | 206 |
| 117 | 3300005563 | Ga0068855_100285878 | Ga0068855_1002858782 | 206 |
| 118 | 3300005563 | Ga0068855_100592610 | Ga0068855_1005926102 | 206 |
| 119 | 3300005616 | Ga0068852_100245266 | Ga0068852_1002452663 | 206 |
| 120 | 3300005842 | Ga0068858_100779888 | Ga0068858_1007798882 | 206 |
| 121 | 3300005985 | Ga0081539_10039758 | Ga0081539_100397582 | 206 |
| 122 | 3300006028 | Ga0070717_10014028 | Ga0070717_100140282 | 206 |
| 123 | 3300006844 | Ga0075428_100169680 | Ga0075428_1001696802 | 206 |
| 124 | 3300007788 | Ga0099795_10012662 | Ga0099795_100126622 | 206 |
| 125 | 3300009094 | Ga0111539_10061127 | Ga0111539_100611272 | 206 |
| 126 | 3300009177 | Ga0105248_11359952 | Ga0105248_113599521 | 206 |
| 127 | 3300009545 | Ga0105237_10004792 | Ga0105237_1000479213 | 206 |
| 128 | 3300009545 | Ga0105237_10288780 | Ga0105237_102887802 | 206 |
| 129 | 3300025909 | Ga0207705_10005194 | Ga0207705_100051942 | 206 |
| 130 | 3300025914 | Ga0207671_10011955 | Ga0207671_100119556 | 206 |
| 131 | 3300025939 | Ga0207665_10032087 | Ga0207665_100320872 | 206 |
| 132 | 3300025941 | Ga0207711_10731500 | Ga0207711_107315002 | 206 |
| 133 | 3300026035 | Ga0207703_10013245 | Ga0207703_100132455 | 206 |
| 134 | 3300026035 | Ga0207703_10077720 | Ga0207703_100777205 | 206 |
| 135 | 3300026041 | Ga0207639_10000001 | Ga0207639_10000001398 | 206 |
| 136 | 3300026041 | Ga0207639_11026578 | Ga0207639_110265781 | 206 |
| 137 | 3300032002 | Ga0307416_100559592 | Ga0307416_1005595921 | 206 |
| 138 | 3300037471 | Ga0395905_0132633 | Ga0395905_0132633_1015_1644 | 206 |
| 139 | 3300046535 | Ga0495586_0103936 | Ga0495586_0103936_352_984 | 206 |
| 140 | 3300046543 | Ga0495645_0017683 | Ga0495645_0017683_1839_2468 | 206 |
| 141 | 3300049569 | Ga0501032_0065580 | Ga0501032_0065580_394_1017 | 206 |
| 142 | 3300049570 | Ga0501033_0020366 | Ga0501033_0020366_3668_4291 | 206 |
| 143 | 3300049571 | Ga0501034_0000428 | Ga0501034_0000428_44039_44662 | 206 |
| 144 | 3300049572 | Ga0501036_0141617 | Ga0501036_0141617_759_1382 | 206 |
| 145 | 3300049573 | Ga0501037_0007225 | Ga0501037_0007225_3022_3645 | 206 |
| 146 | 3300049574 | Ga0501038_0003439 | Ga0501038_0003439_988_1611 | 206 |
| 147 | 3300049579 | Ga0501043_0182233 | Ga0501043_0182233_739_1362 | 206 |
| 148 | 3300049579 | Ga0501043_0204580 | Ga0501043_0204580_729_1352 | 206 |
| 149 | 3300049581 | Ga0501047_0084997 | Ga0501047_0084997_2398_3021 | 206 |
| 150 | 3300049581 | Ga0501047_0213625 | Ga0501047_0213625_1138_1761 | 206 |
| 151 | 3300049589 | Ga0501073_0113186 | Ga0501073_0113186_30_653 | 206 |
| 152 | 3300049822 | Ga0501035_0092205 | Ga0501035_0092205_1953_2576 | 206 |
| 153 | 3300049823 | Ga0501044_0248444 | Ga0501044_0248444_242_865 | 206 |
| 154 | 3300049823 | Ga0501044_0267255 | Ga0501044_0267255_859_1482 | 206 |
| 155 | iso_pu_bacteria | 2582581311 | 2585291519 | 206 |
| 156 | iso_pu_bacteria | 2599185239 | 2599736551 | 206 |
| 157 | iso_pu_bacteria | 2599185240 | 2599744614 | 206 |
| 158 | iso_pu_bacteria | 2599185355 | 2600206025 | 206 |
| 159 | iso_pu_bacteria | 2675903129 | 2676742740 | 206 |
| 160 | iso_pu_bacteria | 2816332253 | 2817261249 | 206 |
| 161 | iso_pu_bacteria | 2816332256 | 2817278938 | 206 |
| 162 | iso_pu_bacteria | 2816332286 | 2817451347 | 206 |
| 163 | iso_pu_bacteria | 2818991452 | 2819631035 | 206 |
| 164 | iso_pu_bacteria | 2863421361 | 2863424861 | 206 |
| 165 | iso_pu_bacteria | 2904564687 | 2904568881 | 206 |
| 166 | iso_pu_bacteria | 2904571731 | 2904576363 | 206 |
| 167 | iso_pu_bacteria | 2928157003 | 2928160152 | 206 |
| 168 | iso_pu_bacteria | 2928163908 | 2928168593 | 206 |
| 169 | iso_pu_bacteria | 2928170801 | 2928171850 | 206 |
| 170 | iso_pu_bacteria | 2928536128 | 2928540059 | 206 |
| 171 | iso_pu_bacteria | 2981990288 | 2981994693 | 206 |
| 172 | iso_pu_bacteria | 641736154 | 642418172 | 206 |
| 173 | iso_pu_bacteria | 8018845410 | 8018851490 | 206 |
| 174 | iso_pu_bacteria | 8020807995 | 8020810770 | 206 |
| 175 | iso_pu_bacteria | 8020938398 | 8020941981 | 206 |
| 176 | iso_pu_bacteria | 8020945358 | 8020946157 | 206 |
| 177 | iso_pu_bacteria | 8020953355 | 8020956822 | 206 |
| 178 | iso_pu_bacteria | 8021120328 | 8021122325 | 206 |
| 179 | iso_pu_bacteria | 8040167225 | 8040168956 | 206 |
| 180 | iso_pu_bacteria | 8040173305 | 8040174826 | 206 |
| 181 | 3300005547 | Ga0070693_100485592 | Ga0070693_1004855922 | 207 |
| 182 | 3300005844 | Ga0068862_100146030 | Ga0068862_1001460303 | 207 |
| 183 | 3300006871 | Ga0075434_100352522 | Ga0075434_1003525222 | 207 |
| 184 | 3300039437 | Ga0436365_0594925 | Ga0436365_0594925_193_819 | 207 |
| 185 | 3300009093 | Ga0105240_10495299 | Ga0105240_104952992 | 208 |
| 186 | 3300009545 | Ga0105237_10155838 | Ga0105237_101558382 | 208 |
| 187 | 3300013105 | Ga0157369_10261992 | Ga0157369_102619922 | 208 |
| 188 | 3300025246 | Ga0209646_1016188 | Ga0209646_10161882 | 208 |
| 189 | 3300025913 | Ga0207695_10416447 | Ga0207695_104164472 | 208 |
| 190 | 3300046507 | Ga0495606_0149982 | Ga0495606_0149982_464_1090 | 208 |
| 191 | 3300046531 | Ga0495665_0033069 | Ga0495665_0033069_1203_1829 | 208 |
| 192 | 3300046535 | Ga0495586_0137724 | Ga0495586_0137724_306_932 | 208 |
| 193 | 3300047319 | Ga0495674_0249887 | Ga0495674_0249887_371_997 | 208 |
| 194 | 3300047322 | Ga0495680_0053358 | Ga0495680_0053358_1988_2614 | 208 |
| 195 | 3300048088 | Ga0495602_0269787 | Ga0495602_0269787_279_905 | 208 |
| 196 | 3300048906 | Ga0496103_0231391 | Ga0496103_0231391_247_873 | 208 |
| 197 | 3300048907 | Ga0496104_0072629 | Ga0496104_0072629_38_664 | 208 |
| 198 | 3300048922 | Ga0496119_0068211 | Ga0496119_0068211_769_1395 | 208 |
| 199 | 3300048929 | Ga0496126_0259396 | Ga0496126_0259396_65_691 | 208 |
| 200 | 3300005844 | Ga0068862_100319524 | Ga0068862_1003195242 | 209 |
| 201 | 3300025925 | Ga0207650_10848153 | Ga0207650_108481531 | 209 |
| 202 | 3300025926 | Ga0207659_10060544 | Ga0207659_100605442 | 209 |
| 203 | 3300025928 | Ga0207700_10478662 | Ga0207700_104786621 | 209 |
| 204 | 3300026035 | Ga0207703_10988279 | Ga0207703_109882791 | 209 |
| 205 | 3300041503 | Ga0451847_0454310 | Ga0451847_0454310_12_656 | 209 |
| 206 | 3300046517 | Ga0495630_0550332 | Ga0495630_0550332_17_742 | 209 |
| 207 | 3300046559 | Ga0495667_0231605 | Ga0495667_0231605_392_1117 | 209 |
| 208 | 3300001989 | JGI24739J22299_10004240 | JGI24739J22299_100042402 | 210 |
| 209 | 3300003320 | rootH2_10106903 | rootH2_101069032 | 210 |
| 210 | 3300003758 | Ga0055532_1001848 | Ga0055532_10018482 | 210 |
| 211 | 3300003758 | Ga0055532_1001863 | Ga0055532_10018633 | 210 |
| 212 | 3300003758 | Ga0055532_1002185 | Ga0055532_10021853 | 210 |
| 213 | 3300003760 | Ga0055527_1000285 | Ga0055527_100028528 | 210 |
| 214 | 3300003760 | Ga0055527_1000469 | Ga0055527_100046911 | 210 |
| 215 | 3300003761 | Ga0055535_1000501 | Ga0055535_100050133 | 210 |
| 216 | 3300003761 | Ga0055535_1001165 | Ga0055535_100116511 | 210 |
| 217 | 3300003762 | Ga0055542_1000602 | Ga0055542_10006023 | 210 |
| 218 | 3300003762 | Ga0055542_1012813 | Ga0055542_10128132 | 210 |
| 219 | 3300003763 | Ga0055529_1000251 | Ga0055529_100025117 | 210 |
| 220 | 3300003763 | Ga0055529_1014118 | Ga0055529_10141182 | 210 |
| 221 | 3300005327 | Ga0070658_10231861 | Ga0070658_102318612 | 210 |
| 222 | 3300005339 | Ga0070660_100000007 | Ga0070660_10000000710 | 210 |
| 223 | 3300005366 | Ga0070659_100000019 | Ga0070659_100000019123 | 210 |
| 224 | 3300005455 | Ga0070663_100006300 | Ga0070663_1000063003 | 210 |
| 225 | 3300005563 | Ga0068855_100507042 | Ga0068855_1005070422 | 210 |
| 226 | 3300005564 | Ga0070664_100149721 | Ga0070664_1001497212 | 210 |
| 227 | 3300005577 | Ga0068857_100281820 | Ga0068857_1002818202 | 210 |
| 228 | 3300005616 | Ga0068852_100220209 | Ga0068852_1002202092 | 210 |
| 229 | 3300009093 | Ga0105240_10003575 | Ga0105240_1000357514 | 210 |
| 230 | 3300009093 | Ga0105240_10122905 | Ga0105240_101229052 | 210 |
| 231 | 3300009177 | Ga0105248_10608381 | Ga0105248_106083812 | 210 |
| 232 | 3300009545 | Ga0105237_10035442 | Ga0105237_100354424 | 210 |
| 233 | 3300009551 | Ga0105238_10887045 | Ga0105238_108870452 | 210 |
| 234 | 3300015261 | Ga0182006_1116341 | Ga0182006_11163412 | 210 |
| 235 | 3300025225 | Ga0209566_103062 | Ga0209566_1030622 | 210 |
| 236 | 3300025228 | Ga0209672_100014 | Ga0209672_100014300 | 210 |
| 237 | 3300025228 | Ga0209672_100023 | Ga0209672_100023320 | 210 |
| 238 | 3300025229 | Ga0209147_100094 | Ga0209147_10009422 | 210 |
| 239 | 3300025229 | Ga0209147_100186 | Ga0209147_10018620 | 210 |
| 240 | 3300025229 | Ga0209147_100208 | Ga0209147_10020842 | 210 |
| 241 | 3300025242 | Ga0209258_100040 | Ga0209258_100040205 | 210 |
| 242 | 3300025242 | Ga0209258_100142 | Ga0209258_10014211 | 210 |
| 243 | 3300025254 | Ga0209148_1000035 | Ga0209148_1000035205 | 210 |
| 244 | 3300025254 | Ga0209148_1000513 | Ga0209148_10005133 | 210 |
| 245 | 3300025254 | Ga0209148_1001094 | Ga0209148_10010943 | 210 |
| 246 | 3300025256 | Ga0209759_1002608 | Ga0209759_10026084 | 210 |
| 247 | 3300025272 | Ga0209455_1000072 | Ga0209455_1000072247 | 210 |
| 248 | 3300025272 | Ga0209455_1000634 | Ga0209455_10006342 | 210 |
| 249 | 3300025273 | Ga0209673_1000030 | Ga0209673_1000030211 | 210 |
| 250 | 3300025295 | Ga0209564_1003030 | Ga0209564_10030303 | 210 |
| 251 | 3300025904 | Ga0207647_10001702 | Ga0207647_100017024 | 210 |
| 252 | 3300025913 | Ga0207695_10001245 | Ga0207695_1000124510 | 210 |
| 253 | 3300025913 | Ga0207695_10404935 | Ga0207695_104049352 | 210 |
| 254 | 3300025914 | Ga0207671_10026320 | Ga0207671_100263203 | 210 |
| 255 | 3300025919 | Ga0207657_10000004 | Ga0207657_10000004168 | 210 |
| 256 | 3300025924 | Ga0207694_10194281 | Ga0207694_101942812 | 210 |
| 257 | 3300025932 | Ga0207690_10000015 | Ga0207690_10000015124 | 210 |
| 258 | 3300025945 | Ga0207679_11214290 | Ga0207679_112142901 | 210 |
| 259 | 3300026041 | Ga0207639_10392814 | Ga0207639_103928141 | 210 |
| 260 | 3300026067 | Ga0207678_10001093 | Ga0207678_1000109315 | 210 |
| 261 | 3300026116 | Ga0207674_10601250 | Ga0207674_106012502 | 210 |
| 262 | 3300026142 | Ga0207698_10017462 | Ga0207698_100174623 | 210 |
| 263 | 3300027312 | Ga0209371_1000290 | Ga0209371_10002907 | 210 |
| 264 | 3300030500 | Ga0268256_1000224 | Ga0268256_100022413 | 210 |
| 265 | 3300037471 | Ga0395905_0017838 | Ga0395905_0017838_2931_3581 | 210 |
| 266 | 3300039437 | Ga0436365_0253137 | Ga0436365_0253137_715_1347 | 210 |
| 267 | 3300046463 | Ga0495653_0490543 | Ga0495653_0490543_99_743 | 210 |
| 268 | 3300047444 | Ga0495675_0213128 | Ga0495675_0213128_132_773 | 210 |
| 269 | 3300048915 | Ga0496112_0828197 | Ga0496112_0828197_144_776 | 210 |
| 270 | 3300048921 | Ga0496118_0150251 | Ga0496118_0150251_115_747 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wt9-assembly1.cif.gz_A | acinetobacter baumanii nicotinamidase pyrazinamidease | 0.983 | 1 | 204 |
| 2wt9-assembly1.cif.gz_A | acinetobacter baumanii nicotinamidase pyrazinamidease | 0.9641 | 1 | 204 |
| 3r2j-assembly2.cif.gz_C | crystal structure of pnc1 from l. infantum in complex with nicotinate | 0.9539 | 4 | 204 |
| 2h0r-assembly7.cif.gz_G | structure of the yeast nicotinamidase pnc1p | 0.9347 | 6 | 202 |
| 1im5-assembly1.cif.gz_A | crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc | 0.9252 | 5 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wt9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.983 | 1 | 204 | 3.40.50.850 |
| 2wt9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9641 | 1 | 204 | 3.40.50.850 |
| af_P21369_4_203_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9586 | 7 | 200 | 3.40.50.850 |
| af_Q54BH7_1_207_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9584 | 6 | 204 | 3.40.50.850 |
| 3r2jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9479 | 4 | 204 | 3.40.50.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A375BF06-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 1 | 5 | 204 |
GO:0008936
GO:0019363 GO:0046872 |
| AF-I3TMZ3-F1-model_v4 | tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (EC 2.1.1.200) (tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase) (tRNA Cm32/Um32 methyltransferase) | 0.9995 | 5 | 204 |
GO:0003723
GO:0005737 GO:0008033 GO:0016811 GO:0019363 GO:0032259 GO:0046872 GO:0160206 |
| AF-A0A2E3EKS4-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.9995 | 5 | 204 |
GO:0016811
GO:0019363 GO:0046872 |
| AF-A0A382WNS2-F1-model_v4 | Uncharacterized protein | 0.999 | 7 | 121 |
GO:0016811
|
| AF-A0A536YUJ8-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.9989 | 5 | 204 |
GO:0008936
GO:0019363 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar