F376559

General Info

Members Datasets Scaffolds Average Seq Length
269 154 269 115

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_169817|Ga0590075_169817_111_536
Length 141
Sequence MGEEGRGAQASALALPGYAAGVEALAASTCVACRADAPTVTDEEVAELRPQVPDWELVEVDGIKRLRRVFTFDDFAAALAFTDRVGELAEREGHHPALLTEWGRTTVSWWTHKIKGLHRNDFVMAAKTDELAKHAEIPLSG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
75 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
76 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
77 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
78 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
79 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
80 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
81 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
87 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
88 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
89 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
90 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
91 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.83
Rhizosphere 85.13
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8377115 2162886011 Bacteria 943
2 Ga0065712_10032103 3300005290 Bacteria 1314
3 Ga0070675_101302769 3300005354 Bacteria 669
4 Ga0070709_11042815 3300005434 Unclassified 652
5 Ga0070709_11500464 3300005434 Bacteria 547
6 Ga0070714_100117200 3300005435 Bacteria 2365
7 Ga0070710_11096136 3300005437 Bacteria 584
8 Ga0070708_100038414 3300005445 Bacteria 4182
9 Ga0070706_100277562 3300005467 Bacteria 1564
10 Ga0070707_100005217 3300005468 Bacteria 12160
11 Ga0070707_100012319 3300005468 Bacteria 7984
12 Ga0070707_100702820 3300005468 Unclassified 974
13 Ga0070707_101942902 3300005468 Unclassified 556
14 Ga0070699_100119131 3300005518 Bacteria 2320
15 Ga0070697_100057306 3300005536 Bacteria 3170
16 Ga0070704_100469664 3300005549 Bacteria 1087
17 Ga0068856_100080891 3300005614 Bacteria 3223
18 Ga0068856_100643898 3300005614 Bacteria 1080
19 Ga0068862_100160253 3300005844 Bacteria 2008
20 Ga0081455_10061591 3300005937 Bacteria 3157
21 Ga0081538_10190722 3300005981 Bacteria 860
22 Ga0070717_10054022 3300006028 Bacteria 3312
23 Ga0070716_100285423 3300006173 Bacteria 1141
24 Ga0070712_100056379 3300006175 Bacteria 2756
25 Ga0097621_100397584 3300006237 Bacteria 1233
26 Ga0068871_101911715 3300006358 Unclassified 564
27 Ga0075428_100003014 3300006844 Bacteria 18389
28 Ga0075428_100003224 3300006844 Bacteria 17853
29 Ga0075428_100005445 3300006844 Bacteria 14148
30 Ga0075428_102423952 3300006844 Bacteria 538
31 Ga0075428_102619440 3300006844 Bacteria 515
32 Ga0075430_100311058 3300006846 Bacteria 1303
33 Ga0075431_100073106 3300006847 Bacteria 3538
34 Ga0075431_100304940 3300006847 Bacteria 1608
35 Ga0075431_100625299 3300006847 Bacteria 1059
36 Ga0075433_10000028 3300006852 Bacteria 56798
37 Ga0075433_10650223 3300006852 Bacteria 924
38 Ga0075433_11263001 3300006852 Unclassified 640
39 Ga0075434_100005675 3300006871 Bacteria 11388
40 Ga0075429_100028216 3300006880 Bacteria 4873
41 Ga0075429_100821570 3300006880 Bacteria 814
42 Ga0075436_100000068 3300006914 Bacteria 62600
43 Ga0075435_100000647 3300007076 Bacteria 21451
44 Ga0111539_10007056 3300009094 Bacteria 14411
45 Ga0111539_10100540 3300009094 Bacteria 3395
46 Ga0111539_10131512 3300009094 Bacteria 2930
47 Ga0111539_10252561 3300009094 Unclassified 2053
48 Ga0111539_10428133 3300009094 Bacteria 1541
49 Ga0111539_10975866 3300009094 Bacteria 985
50 Ga0111539_12206442 3300009094 Unclassified 639
51 Ga0105245_11366870 3300009098 Bacteria 758
52 Ga0105245_11393375 3300009098 Unclassified 751
53 Ga0114129_10022962 3300009147 Bacteria 8850
54 Ga0114129_10079755 3300009147 Bacteria 4551
55 Ga0114129_10846451 3300009147 Bacteria 1163
56 Ga0114129_11010210 3300009147 Bacteria 1047
57 Ga0105243_10548983 3300009148 Bacteria 1104
58 Ga0105237_10723502 3300009545 Bacteria 1002
59 Ga0105238_10214909 3300009551 Bacteria 1899
60 Ga0105249_10787811 3300009553 Bacteria 1014
61 Ga0105246_11834205 3300011119 Unclassified 580
62 Ga0157374_11547777 3300013296 Bacteria 687
63 Ga0157378_10264328 3300013297 Bacteria 1652
64 Ga0157378_10324368 3300013297 Bacteria 1497
65 Ga0157378_11698362 3300013297 Bacteria 678
66 Ga0157378_13103810 3300013297 Bacteria 516
67 Ga0157380_10067103 3300014326 Unclassified 2888
68 Ga0157376_10095284 3300014969 Bacteria 2588
69 Ga0157376_12670064 3300014969 Unclassified 539
70 Ga0206356_10182092 3300020070 Bacteria 1668
71 Ga0206349_1288121 3300020075 Bacteria 849
72 Ga0206351_10361371 3300020077 Bacteria 957
73 Ga0206350_10396373 3300020080 Bacteria 1312
74 Ga0224712_10138409 3300022467 Bacteria 1069
75 Ga0207692_10011605 3300025898 Bacteria 3757
76 Ga0207693_10068410 3300025915 Bacteria 2779
77 Ga0207646_10004885 3300025922 Bacteria 14360
78 Ga0207646_10011023 3300025922 Bacteria 8779
79 Ga0207687_10918361 3300025927 Bacteria 749
80 Ga0207664_10305444 3300025929 Bacteria 1401
81 Ga0207665_10151561 3300025939 Bacteria 1661
82 Ga0207428_10204325 3300027907 Unclassified 1486
83 Ga0207428_10419186 3300027907 Bacteria 979
84 Ga0316575_10330117 3300031665 Bacteria 648
85 Ga0316579_10006424 3300031691 Bacteria 4799
86 Ga0316578_10116428 3300031728 Bacteria 1606
87 Ga0307405_10301427 3300031731 Bacteria 1216
88 Ga0307412_10719637 3300031911 Bacteria 859
89 Ga0307409_100118977 3300031995 Bacteria 2233
90 Ga0307416_100281218 3300032002 Bacteria 1641
91 Ga0307416_100357164 3300032002 Bacteria 1482
92 Ga0307416_100845383 3300032002 Bacteria 1013
93 Ga0307416_102046857 3300032002 Unclassified 675
94 Ga0307414_10732904 3300032004 Bacteria 897
95 Ga0307415_100963567 3300032126 Bacteria 790
96 Ga0316593_10054342 3300032168 Bacteria 1359
97 Ga0316592_1031582 3300033524 Bacteria 1154
98 Ga0316582_0658343 3300036647 Bacteria 720
99 Ga0316584_0563547 3300036712 Unclassified 794
100 Ga0373925_0952539 3300037068 Bacteria 707
101 Ga0395899_0012561 3300037312 Bacteria 6492
102 Ga0395899_0352456 3300037312 Bacteria 984
103 Ga0395899_0653893 3300037312 Bacteria 664
104 Ga0395899_0728435 3300037312 Bacteria 619
105 Ga0395900_0006395 3300037418 Bacteria 12280
106 Ga0395900_0015533 3300037418 Bacteria 7760
107 Ga0395900_0023052 3300037418 Bacteria 6370
108 Ga0395900_0045521 3300037418 Bacteria 4519
109 Ga0395900_0084484 3300037418 Bacteria 3262
110 Ga0395900_0900164 3300037418 Bacteria 808
111 Ga0395900_1702975 3300037418 Bacteria 541
112 Ga0395898_0010735 3300037466 Bacteria 9567
113 Ga0395898_0090924 3300037466 Bacteria 2937
114 Ga0395898_0098578 3300037466 Bacteria 2806
115 Ga0395898_0176767 3300037466 Bacteria 2040
116 Ga0395898_0251234 3300037466 Bacteria 1686
117 Ga0395898_1882463 3300037466 Bacteria 519
118 Ga0395905_0003639 3300037471 Bacteria 16380
119 Ga0395905_0149676 3300037471 Bacteria 2196
120 Ga0395905_0201199 3300037471 Bacteria 1867
121 Ga0395905_0204614 3300037471 Bacteria 1850
122 Ga0395905_0231587 3300037471 Bacteria 1727
123 Ga0395905_0520340 3300037471 Bacteria 1090
124 Ga0395905_0612274 3300037471 Bacteria 991
125 Ga0395905_0884501 3300037471 Bacteria 796
126 Ga0395905_0909107 3300037471 Bacteria 783
127 Ga0436364_1246290 3300037853 Unclassified 2544
128 Ga0395901_0010821 3300038443 Bacteria 9247
129 Ga0395901_0015028 3300038443 Bacteria 7871
130 Ga0395901_0016655 3300038443 Bacteria 7488
131 Ga0395901_0022895 3300038443 Bacteria 6406
132 Ga0395901_0041010 3300038443 Bacteria 4796
133 Ga0395901_0075706 3300038443 Bacteria 3511
134 Ga0395901_0174262 3300038443 Bacteria 2256
135 Ga0395901_0206045 3300038443 Bacteria 2060
136 Ga0395901_0517564 3300038443 Unclassified 1213
137 Ga0395901_0534788 3300038443 Bacteria 1189
138 Ga0395901_0575539 3300038443 Bacteria 1138
139 Ga0395901_0618442 3300038443 Bacteria 1090
140 Ga0395901_0704092 3300038443 Bacteria 1007
141 Ga0400484_06894 3300038725 Bacteria 9257
142 Ga0400484_32810 3300038725 Unclassified 2142
143 Ga0400484_36838 3300038725 Bacteria 8654
144 Ga0400484_45162 3300038725 Bacteria 7252
145 Ga0400490_17051 3300038726 Bacteria 12237
146 Ga0400490_52932 3300038726 Bacteria 14432
147 Ga0400491_17898 3300038727 Bacteria 16069
148 Ga0400485_17330 3300038735 Bacteria 13052
149 Ga0400485_22271 3300038735 Bacteria 16443
150 Ga0400485_22395 3300038735 Bacteria 1735
151 Ga0400488_06056 3300038741 Bacteria 1271
152 Ga0400488_18859 3300038741 Bacteria 38161
153 Ga0400486_03471 3300038742 Bacteria 77173
154 Ga0400486_03772 3300038742 Bacteria 12087
155 Ga0400486_17588 3300038742 Bacteria 2110
156 Ga0400486_22951 3300038742 Bacteria 4607
157 Ga0400483_081358 3300039062 Bacteria 5550
158 Ga0400483_178754 3300039062 Bacteria 13898
159 Ga0400483_192377 3300039062 Bacteria 36383
160 Ga0400487_30307 3300039110 Bacteria 53143
161 Ga0400487_30332 3300039110 Bacteria 2319
162 Ga0400487_32209 3300039110 Bacteria 30568
163 Ga0400487_52141 3300039110 Unclassified 1484
164 Ga0400487_54385 3300039110 Bacteria 5055
165 Ga0400487_57385 3300039110 Bacteria 12524
166 Ga0436363_1013900 3300039450 Bacteria 896
167 Ga0436362_1072941 3300039453 Bacteria 672
168 Ga0439431_0121426 3300041997 Bacteria 729
169 Ga0439448_0239347 3300042005 Bacteria 640
170 Ga0439448_0360836 3300042005 Bacteria 519
171 Ga0439455_0004923 3300042012 Bacteria 2680
172 Ga0439463_015328 3300042016 Bacteria 1896
173 Ga0450920_128214 3300042122 Bacteria 534
174 Ga0450907_035482 3300042146 Bacteria 851
175 Ga0439458_0031189 3300042157 Bacteria 1270
176 Ga0439458_0162583 3300042157 Bacteria 601
177 Ga0439434_0337505 3300042435 Bacteria 525
178 Ga0466969_0317626 3300044656 Bacteria 705
179 Ga0466972_0093294 3300044658 Bacteria 1427
180 Ga0453683_0009178 3300044673 Bacteria 6607
181 Ga0453683_0147877 3300044673 Bacteria 1484
182 Ga0466966_0665711 3300044684 Bacteria 627
183 Ga0466961_0075728 3300044693 Bacteria 2133
184 Ga0466959_0521784 3300045049 Bacteria 802
185 Ga0451576_1290503 3300045051 Bacteria 761
186 Ga0466967_1914256 3300045976 Bacteria 590
187 Ga0495641_0388985 3300046461 Bacteria 632
188 Ga0495630_0005757 3300046517 Bacteria 8758
189 Ga0495630_0332146 3300046517 Bacteria 1163
190 Ga0495644_0281639 3300046523 Bacteria 649
191 Ga0495656_0208908 3300046615 Bacteria 972
192 Ga0495656_0424554 3300046615 Bacteria 698
193 Ga0495611_0185786 3300046648 Bacteria 971
194 Ga0495659_0012002 3300046664 Bacteria 2798
195 Ga0495659_0475980 3300046664 Bacteria 546
196 Ga0496101_0000693 3300048904 Bacteria 20313
197 Ga0496102_0001895 3300048905 Bacteria 18038
198 Ga0496104_0060931 3300048907 Bacteria 3575
199 Ga0496105_0006173 3300048908 Bacteria 9187
200 Ga0496106_0001176 3300048909 Bacteria 19479
201 Ga0496107_0016594 3300048910 Bacteria 5173
202 Ga0496108_0001673 3300048911 Bacteria 17591
203 Ga0496109_0025400 3300048912 Bacteria 5278
204 Ga0496110_0021918 3300048913 Bacteria 5418
205 Ga0496112_0914053 3300048915 Bacteria 799
206 Ga0496113_0030069 3300048916 Bacteria 3929
207 Ga0496114_0000668 3300048917 Bacteria 25433
208 Ga0496115_0010835 3300048918 Bacteria 6820
209 Ga0501031_0480094 3300049568 Unclassified 802
210 Ga0501031_0535045 3300049568 Bacteria 755
211 Ga0501032_0409611 3300049569 Unclassified 870
212 Ga0501032_1007416 3300049569 Bacteria 523
213 Ga0501033_0002883 3300049570 Bacteria 14397
214 Ga0501034_0000842 3300049571 Bacteria 45502
215 Ga0501036_0018513 3300049572 Bacteria 5838
216 Ga0501036_0902534 3300049572 Bacteria 725
217 Ga0501037_0007648 3300049573 Bacteria 7911
218 Ga0501037_0022456 3300049573 Bacteria 4667
219 Ga0501038_0002178 3300049574 Bacteria 18204
220 Ga0501039_0122559 3300049575 Bacteria 2038
221 Ga0501039_0372789 3300049575 Unclassified 1121
222 Ga0501039_0579270 3300049575 Bacteria 880
223 Ga0501039_1082180 3300049575 Bacteria 622
224 Ga0501040_0113610 3300049576 Bacteria 1895
225 Ga0501040_0341584 3300049576 Bacteria 1072
226 Ga0501041_0812894 3300049577 Bacteria 600
227 Ga0501042_0064690 3300049578 Bacteria 2614
228 Ga0501042_1044251 3300049578 Bacteria 596
229 Ga0501043_0000821 3300049579 Bacteria 27583
230 Ga0501046_0216914 3300049580 Bacteria 1418
231 Ga0501047_0023952 3300049581 Bacteria 5862
232 Ga0501048_0374297 3300049582 Bacteria 1017
233 Ga0501068_0540368 3300049584 Unclassified 757
234 Ga0501073_0000774 3300049589 Bacteria 22725
235 Ga0501073_0571254 3300049589 Bacteria 781
236 Ga0501074_0036580 3300049590 Bacteria 3556
237 Ga0501074_0368184 3300049590 Bacteria 1020
238 Ga0501075_0706170 3300049591 Bacteria 768
239 Ga0501076_0482034 3300049592 Bacteria 1022
240 Ga0501079_0231092 3300049741 Unclassified 1445
241 Ga0501080_0000333 3300049742 Bacteria 36064
242 Ga0501083_0039937 3300049744 Bacteria 3186
243 Ga0501035_0048596 3300049822 Bacteria 3805
244 Ga0501044_0000979 3300049823 Bacteria 34342
245 nmdc:mga05p37_1222615_c1 3300050507 Bacteria 774
246 nmdc:mga05p37_43790_c1 3300050507 Bacteria 5507
247 nmdc:mga05p37_97709_c1 3300050507 Bacteria 3617
248 nmdc:mga09592_78302_c1 3300050508 Bacteria 2813
249 nmdc:mga06r32_1470780_c1 3300050510 Bacteria 622
250 nmdc:mga06r32_350317_c1 3300050510 Bacteria 1461
251 nmdc:mga06r32_562254_c1 3300050510 Bacteria 1114
252 nmdc:mga08y16_1483626_c1 3300050511 Unclassified 639
253 nmdc:mga08y16_18061_c1 3300050511 Bacteria 7429
254 nmdc:mga08y16_57532_c1 3300050511 Bacteria 4063
255 nmdc:mga08y16_85191_c1 3300050511 Bacteria 3293
256 nmdc:mga0a205_1317844_c1 3300050515 Unclassified 570
257 nmdc:mga0a205_1598977_c1 3300050515 Bacteria 500
258 Ga0495612_0156140 3300053078 Bacteria 995
259 Ga0501084_0253644 3300054114 Unclassified 1485
260 Ga0501084_0677273 3300054114 Bacteria 870
261 Ga0501084_0740166 3300054114 Bacteria 829
262 Ga0501084_1220433 3300054114 Bacteria 631
263 Ga0590075_169817 3300059424 Bacteria 576
264 Ga0590077_006496 3300059426 Bacteria 2395
265 Ga0501082_0013277 3300060353 Bacteria 7084
266 Ga0501082_0631924 3300060353 Bacteria 937
267 Ga0530510_0236099 3300061734 Bacteria 1361
268 Ga0530510_0307433 3300061734 Bacteria 1187
269 Ga0530510_0333983 3300061734 Bacteria 1137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100080891 Ga0068856_1000808912 108
2 3300005434 Ga0070709_11042815 Ga0070709_110428151 112
3 3300006358 Ga0068871_101911715 Ga0068871_1019117151 112
4 3300006844 Ga0075428_100003224 Ga0075428_1000032249 112
5 3300006846 Ga0075430_100311058 Ga0075430_1003110582 112
6 3300006847 Ga0075431_100073106 Ga0075431_1000731063 112
7 3300006847 Ga0075431_100304940 Ga0075431_1003049402 112
8 3300006852 Ga0075433_11263001 Ga0075433_112630011 112
9 3300009094 Ga0111539_10975866 Ga0111539_109758662 112
10 3300009098 Ga0105245_11393375 Ga0105245_113933751 112
11 3300009147 Ga0114129_11010210 Ga0114129_110102101 112
12 3300009545 Ga0105237_10723502 Ga0105237_107235022 112
13 3300009551 Ga0105238_10214909 Ga0105238_102149092 112
14 3300011119 Ga0105246_11834205 Ga0105246_118342052 112
15 3300013297 Ga0157378_10324368 Ga0157378_103243681 112
16 3300013297 Ga0157378_13103810 Ga0157378_131038102 112
17 3300014969 Ga0157376_10095284 Ga0157376_100952842 112
18 3300041997 Ga0439431_0121426 Ga0439431_0121426_21_365 112
19 3300042435 Ga0439434_0337505 Ga0439434_0337505_32_376 112
20 3300050510 nmdc:mga06r32_562254_c1 nmdc:mga06r32_562254_c1_612_971 112
21 3300050515 nmdc:mga0a205_1317844_c1 nmdc:mga0a205_1317844_c1_188_529 112
22 3300005354 Ga0070675_101302769 Ga0070675_1013027691 113
23 3300005445 Ga0070708_100038414 Ga0070708_1000384144 113
24 3300005467 Ga0070706_100277562 Ga0070706_1002775622 113
25 3300005468 Ga0070707_100005217 Ga0070707_10000521712 113
26 3300005468 Ga0070707_100012319 Ga0070707_1000123196 113
27 3300005518 Ga0070699_100119131 Ga0070699_1001191311 113
28 3300005844 Ga0068862_100160253 Ga0068862_1001602532 113
29 3300005981 Ga0081538_10190722 Ga0081538_101907222 113
30 3300006844 Ga0075428_100003014 Ga0075428_1000030146 113
31 3300006844 Ga0075428_100005445 Ga0075428_1000054454 113
32 3300006847 Ga0075431_100625299 Ga0075431_1006252991 113
33 3300006852 Ga0075433_10650223 Ga0075433_106502232 113
34 3300006880 Ga0075429_100028216 Ga0075429_1000282164 113
35 3300009094 Ga0111539_10007056 Ga0111539_1000705614 113
36 3300009094 Ga0111539_10100540 Ga0111539_101005404 113
37 3300009094 Ga0111539_10131512 Ga0111539_101315126 113
38 3300009094 Ga0111539_10428133 Ga0111539_104281333 113
39 3300009094 Ga0111539_12206442 Ga0111539_122064422 113
40 3300009147 Ga0114129_10022962 Ga0114129_100229622 113
41 3300009147 Ga0114129_10079755 Ga0114129_100797552 113
42 3300009148 Ga0105243_10548983 Ga0105243_105489831 113
43 3300009553 Ga0105249_10787811 Ga0105249_107878111 113
44 3300013297 Ga0157378_11698362 Ga0157378_116983621 113
45 3300014326 Ga0157380_10067103 Ga0157380_100671031 113
46 3300014969 Ga0157376_12670064 Ga0157376_126700641 113
47 3300020075 Ga0206349_1288121 Ga0206349_12881211 113
48 3300020077 Ga0206351_10361371 Ga0206351_103613711 113
49 3300020080 Ga0206350_10396373 Ga0206350_103963733 113
50 3300022467 Ga0224712_10138409 Ga0224712_101384093 113
51 3300025922 Ga0207646_10004885 Ga0207646_100048857 113
52 3300025922 Ga0207646_10011023 Ga0207646_100110237 113
53 3300027907 Ga0207428_10419186 Ga0207428_104191861 113
54 3300031731 Ga0307405_10301427 Ga0307405_103014271 113
55 3300031911 Ga0307412_10719637 Ga0307412_107196372 113
56 3300032002 Ga0307416_100281218 Ga0307416_1002812182 113
57 3300032126 Ga0307415_100963567 Ga0307415_1009635671 113
58 3300036647 Ga0316582_0658343 Ga0316582_0658343_220_561 113
59 3300036712 Ga0316584_0563547 Ga0316584_0563547_102_443 113
60 3300037312 Ga0395899_0012561 Ga0395899_0012561_5027_5368 113
61 3300037312 Ga0395899_0653893 Ga0395899_0653893_237_578 113
62 3300037418 Ga0395900_0023052 Ga0395900_0023052_407_748 113
63 3300037418 Ga0395900_0045521 Ga0395900_0045521_804_1145 113
64 3300037418 Ga0395900_0900164 Ga0395900_0900164_19_360 113
65 3300037418 Ga0395900_1702975 Ga0395900_1702975_55_396 113
66 3300037466 Ga0395898_0090924 Ga0395898_0090924_1710_2051 113
67 3300037466 Ga0395898_0098578 Ga0395898_0098578_1246_1587 113
68 3300037466 Ga0395898_0251234 Ga0395898_0251234_438_779 113
69 3300037466 Ga0395898_1882463 Ga0395898_1882463_146_487 113
70 3300037471 Ga0395905_0003639 Ga0395905_0003639_13974_14315 113
71 3300037471 Ga0395905_0149676 Ga0395905_0149676_293_634 113
72 3300037471 Ga0395905_0231587 Ga0395905_0231587_1043_1384 113
73 3300037471 Ga0395905_0520340 Ga0395905_0520340_413_754 113
74 3300037471 Ga0395905_0909107 Ga0395905_0909107_369_710 113
75 3300038443 Ga0395901_0010821 Ga0395901_0010821_7709_8050 113
76 3300038443 Ga0395901_0015028 Ga0395901_0015028_1642_1983 113
77 3300038443 Ga0395901_0075706 Ga0395901_0075706_2650_2991 113
78 3300038443 Ga0395901_0174262 Ga0395901_0174262_1549_1890 113
79 3300038443 Ga0395901_0517564 Ga0395901_0517564_821_1162 113
80 3300038443 Ga0395901_0534788 Ga0395901_0534788_837_1178 113
81 3300038443 Ga0395901_0575539 Ga0395901_0575539_597_938 113
82 3300038443 Ga0395901_0618442 Ga0395901_0618442_176_517 113
83 3300038443 Ga0395901_0704092 Ga0395901_0704092_506_847 113
84 3300038725 Ga0400484_06894 Ga0400484_06894_2867_3208 113
85 3300038725 Ga0400484_32810 Ga0400484_32810_1539_1880 113
86 3300038725 Ga0400484_36838 Ga0400484_36838_7284_7625 113
87 3300038725 Ga0400484_45162 Ga0400484_45162_2898_3239 113
88 3300038726 Ga0400490_17051 Ga0400490_17051_10449_10790 113
89 3300038726 Ga0400490_52932 Ga0400490_52932_10693_11034 113
90 3300038727 Ga0400491_17898 Ga0400491_17898_15621_15962 113
91 3300038735 Ga0400485_17330 Ga0400485_17330_2557_2898 113
92 3300038735 Ga0400485_22271 Ga0400485_22271_11975_12316 113
93 3300038735 Ga0400485_22395 Ga0400485_22395_544_885 113
94 3300038741 Ga0400488_06056 Ga0400488_06056_252_593 113
95 3300038742 Ga0400486_03471 Ga0400486_03471_64744_65085 113
96 3300038742 Ga0400486_03772 Ga0400486_03772_1613_1954 113
97 3300038742 Ga0400486_22951 Ga0400486_22951_2322_2663 113
98 3300039062 Ga0400483_081358 Ga0400483_081358_3613_3954 113
99 3300039062 Ga0400483_178754 Ga0400483_178754_272_613 113
100 3300039062 Ga0400483_192377 Ga0400483_192377_4162_4503 113
101 3300039110 Ga0400487_30307 Ga0400487_30307_9780_10121 113
102 3300039110 Ga0400487_30332 Ga0400487_30332_1820_2161 113
103 3300039110 Ga0400487_32209 Ga0400487_32209_11985_12326 113
104 3300039110 Ga0400487_52141 Ga0400487_52141_823_1164 113
105 3300039110 Ga0400487_54385 Ga0400487_54385_2008_2349 113
106 3300042005 Ga0439448_0239347 Ga0439448_0239347_46_387 113
107 3300042005 Ga0439448_0360836 Ga0439448_0360836_134_475 113
108 3300042012 Ga0439455_0004923 Ga0439455_0004923_267_608 113
109 3300042016 Ga0439463_015328 Ga0439463_015328_1308_1649 113
110 3300042122 Ga0450920_128214 Ga0450920_128214_148_489 113
111 3300042146 Ga0450907_035482 Ga0450907_035482_228_569 113
112 3300042157 Ga0439458_0031189 Ga0439458_0031189_203_544 113
113 3300042157 Ga0439458_0162583 Ga0439458_0162583_175_516 113
114 3300045976 Ga0466967_1914256 Ga0466967_1914256_11_355 113
115 3300046461 Ga0495641_0388985 Ga0495641_0388985_148_489 113
116 3300046517 Ga0495630_0332146 Ga0495630_0332146_294_635 113
117 3300046523 Ga0495644_0281639 Ga0495644_0281639_25_366 113
118 3300046615 Ga0495656_0208908 Ga0495656_0208908_184_525 113
119 3300046615 Ga0495656_0424554 Ga0495656_0424554_150_491 113
120 3300046648 Ga0495611_0185786 Ga0495611_0185786_290_631 113
121 3300046664 Ga0495659_0012002 Ga0495659_0012002_307_648 113
122 3300046664 Ga0495659_0475980 Ga0495659_0475980_81_422 113
123 3300049568 Ga0501031_0535045 Ga0501031_0535045_43_384 113
124 3300049569 Ga0501032_1007416 Ga0501032_1007416_171_512 113
125 3300049572 Ga0501036_0902534 Ga0501036_0902534_245_586 113
126 3300049573 Ga0501037_0007648 Ga0501037_0007648_2764_3105 113
127 3300049575 Ga0501039_0122559 Ga0501039_0122559_79_420 113
128 3300049575 Ga0501039_0579270 Ga0501039_0579270_58_399 113
129 3300049575 Ga0501039_1082180 Ga0501039_1082180_228_569 113
130 3300049576 Ga0501040_0113610 Ga0501040_0113610_1325_1666 113
131 3300049577 Ga0501041_0812894 Ga0501041_0812894_219_560 113
132 3300049578 Ga0501042_0064690 Ga0501042_0064690_1680_2021 113
133 3300049580 Ga0501046_0216914 Ga0501046_0216914_390_731 113
134 3300049589 Ga0501073_0571254 Ga0501073_0571254_108_449 113
135 3300049590 Ga0501074_0368184 Ga0501074_0368184_514_855 113
136 3300049592 Ga0501076_0482034 Ga0501076_0482034_535_876 113
137 3300050507 nmdc:mga05p37_43790_c1 nmdc:mga05p37_43790_c1_2586_2927 113
138 3300050508 nmdc:mga09592_78302_c1 nmdc:mga09592_78302_c1_1995_2336 113
139 3300050510 nmdc:mga06r32_1470780_c1 nmdc:mga06r32_1470780_c1_194_535 113
140 3300050511 nmdc:mga08y16_1483626_c1 nmdc:mga08y16_1483626_c1_83_424 113
141 3300050511 nmdc:mga08y16_18061_c1 nmdc:mga08y16_18061_c1_6881_7222 113
142 3300050511 nmdc:mga08y16_57532_c1 nmdc:mga08y16_57532_c1_3256_3597 113
143 3300050515 nmdc:mga0a205_1598977_c1 nmdc:mga0a205_1598977_c1_124_465 113
144 3300054114 Ga0501084_0677273 Ga0501084_0677273_515_856 113
145 3300054114 Ga0501084_1220433 Ga0501084_1220433_209_550 113
146 3300060353 Ga0501082_0631924 Ga0501082_0631924_287_628 113
147 3300061734 Ga0530510_0236099 Ga0530510_0236099_90_431 113
148 3300061734 Ga0530510_0333983 Ga0530510_0333983_775_1116 113
149 2162886011 MRS1b_contig_8377115 MRS1b_0709.00003130 114
150 3300005290 Ga0065712_10032103 Ga0065712_100321032 114
151 3300005434 Ga0070709_11500464 Ga0070709_115004641 114
152 3300005435 Ga0070714_100117200 Ga0070714_1001172002 114
153 3300005437 Ga0070710_11096136 Ga0070710_110961361 114
154 3300005468 Ga0070707_100702820 Ga0070707_1007028202 114
155 3300005468 Ga0070707_101942902 Ga0070707_1019429021 114
156 3300005536 Ga0070697_100057306 Ga0070697_1000573063 114
157 3300005549 Ga0070704_100469664 Ga0070704_1004696642 114
158 3300005614 Ga0068856_100643898 Ga0068856_1006438982 114
159 3300005937 Ga0081455_10061591 Ga0081455_100615914 114
160 3300006028 Ga0070717_10054022 Ga0070717_100540222 114
161 3300006173 Ga0070716_100285423 Ga0070716_1002854232 114
162 3300006175 Ga0070712_100056379 Ga0070712_1000563792 114
163 3300006237 Ga0097621_100397584 Ga0097621_1003975842 114
164 3300006844 Ga0075428_102423952 Ga0075428_1024239522 114
165 3300006844 Ga0075428_102619440 Ga0075428_1026194401 114
166 3300006852 Ga0075433_10000028 Ga0075433_100000284 114
167 3300006871 Ga0075434_100005675 Ga0075434_10000567513 114
168 3300006880 Ga0075429_100821570 Ga0075429_1008215702 114
169 3300006914 Ga0075436_100000068 Ga0075436_10000006844 114
170 3300007076 Ga0075435_100000647 Ga0075435_1000006479 114
171 3300009094 Ga0111539_10252561 Ga0111539_102525612 114
172 3300009098 Ga0105245_11366870 Ga0105245_113668702 114
173 3300009147 Ga0114129_10846451 Ga0114129_108464514 114
174 3300013296 Ga0157374_11547777 Ga0157374_115477771 114
175 3300013297 Ga0157378_10264328 Ga0157378_102643282 114
176 3300020070 Ga0206356_10182092 Ga0206356_101820921 114
177 3300025898 Ga0207692_10011605 Ga0207692_100116052 114
178 3300025915 Ga0207693_10068410 Ga0207693_100684102 114
179 3300025927 Ga0207687_10918361 Ga0207687_109183612 114
180 3300025929 Ga0207664_10305444 Ga0207664_103054442 114
181 3300025939 Ga0207665_10151561 Ga0207665_101515612 114
182 3300027907 Ga0207428_10204325 Ga0207428_102043252 114
183 3300031665 Ga0316575_10330117 Ga0316575_103301171 114
184 3300031691 Ga0316579_10006424 Ga0316579_100064242 114
185 3300031728 Ga0316578_10116428 Ga0316578_101164281 114
186 3300031995 Ga0307409_100118977 Ga0307409_1001189773 114
187 3300032002 Ga0307416_100357164 Ga0307416_1003571642 114
188 3300032002 Ga0307416_100845383 Ga0307416_1008453832 114
189 3300032002 Ga0307416_102046857 Ga0307416_1020468571 114
190 3300032004 Ga0307414_10732904 Ga0307414_107329041 114
191 3300032168 Ga0316593_10054342 Ga0316593_100543422 114
192 3300033524 Ga0316592_1031582 Ga0316592_10315822 114
193 3300037068 Ga0373925_0952539 Ga0373925_0952539_202_546 114
194 3300037312 Ga0395899_0352456 Ga0395899_0352456_119_484 114
195 3300037312 Ga0395899_0728435 Ga0395899_0728435_86_430 114
196 3300037418 Ga0395900_0006395 Ga0395900_0006395_4641_5027 114
197 3300037418 Ga0395900_0015533 Ga0395900_0015533_5520_5864 114
198 3300037418 Ga0395900_0084484 Ga0395900_0084484_933_1280 114
199 3300037466 Ga0395898_0010735 Ga0395898_0010735_4365_4751 114
200 3300037466 Ga0395898_0176767 Ga0395898_0176767_1496_1840 114
201 3300037471 Ga0395905_0201199 Ga0395905_0201199_1491_1835 114
202 3300037471 Ga0395905_0204614 Ga0395905_0204614_834_1181 114
203 3300037471 Ga0395905_0612274 Ga0395905_0612274_216_602 114
204 3300037471 Ga0395905_0884501 Ga0395905_0884501_82_447 114
205 3300037853 Ga0436364_1246290 Ga0436364_1246290_1236_1592 114
206 3300038443 Ga0395901_0016655 Ga0395901_0016655_3639_3983 114
207 3300038443 Ga0395901_0022895 Ga0395901_0022895_2970_3335 114
208 3300038443 Ga0395901_0041010 Ga0395901_0041010_598_984 114
209 3300038443 Ga0395901_0206045 Ga0395901_0206045_1390_1737 114
210 3300038741 Ga0400488_18859 Ga0400488_18859_5708_6055 114
211 3300038742 Ga0400486_17588 Ga0400486_17588_559_906 114
212 3300039110 Ga0400487_57385 Ga0400487_57385_1773_2120 114
213 3300039450 Ga0436363_1013900 Ga0436363_1013900_125_490 114
214 3300039453 Ga0436362_1072941 Ga0436362_1072941_277_621 114
215 3300044656 Ga0466969_0317626 Ga0466969_0317626_156_512 114
216 3300044658 Ga0466972_0093294 Ga0466972_0093294_529_882 114
217 3300044673 Ga0453683_0009178 Ga0453683_0009178_1807_2157 114
218 3300044673 Ga0453683_0147877 Ga0453683_0147877_934_1290 114
219 3300044684 Ga0466966_0665711 Ga0466966_0665711_219_581 114
220 3300044693 Ga0466961_0075728 Ga0466961_0075728_1435_1839 114
221 3300045049 Ga0466959_0521784 Ga0466959_0521784_282_635 114
222 3300045051 Ga0451576_1290503 Ga0451576_1290503_104_472 114
223 3300046517 Ga0495630_0005757 Ga0495630_0005757_5073_5417 114
224 3300048904 Ga0496101_0000693 Ga0496101_0000693_5197_5553 114
225 3300048905 Ga0496102_0001895 Ga0496102_0001895_16178_16534 114
226 3300048907 Ga0496104_0060931 Ga0496104_0060931_1542_1907 114
227 3300048908 Ga0496105_0006173 Ga0496105_0006173_1398_1763 114
228 3300048909 Ga0496106_0001176 Ga0496106_0001176_10300_10665 114
229 3300048910 Ga0496107_0016594 Ga0496107_0016594_128_484 114
230 3300048911 Ga0496108_0001673 Ga0496108_0001673_16156_16521 114
231 3300048912 Ga0496109_0025400 Ga0496109_0025400_3960_4325 114
232 3300048913 Ga0496110_0021918 Ga0496110_0021918_1238_1603 114
233 3300048915 Ga0496112_0914053 Ga0496112_0914053_273_623 114
234 3300048916 Ga0496113_0030069 Ga0496113_0030069_2041_2406 114
235 3300048917 Ga0496114_0000668 Ga0496114_0000668_10764_11129 114
236 3300048918 Ga0496115_0010835 Ga0496115_0010835_6221_6586 114
237 3300049568 Ga0501031_0480094 Ga0501031_0480094_244_588 114
238 3300049569 Ga0501032_0409611 Ga0501032_0409611_265_609 114
239 3300049570 Ga0501033_0002883 Ga0501033_0002883_1140_1484 114
240 3300049571 Ga0501034_0000842 Ga0501034_0000842_9245_9589 114
241 3300049572 Ga0501036_0018513 Ga0501036_0018513_172_516 114
242 3300049573 Ga0501037_0022456 Ga0501037_0022456_4039_4383 114
243 3300049574 Ga0501038_0002178 Ga0501038_0002178_13019_13363 114
244 3300049575 Ga0501039_0372789 Ga0501039_0372789_466_810 114
245 3300049576 Ga0501040_0341584 Ga0501040_0341584_592_954 114
246 3300049578 Ga0501042_1044251 Ga0501042_1044251_44_406 114
247 3300049579 Ga0501043_0000821 Ga0501043_0000821_12217_12561 114
248 3300049581 Ga0501047_0023952 Ga0501047_0023952_5169_5513 114
249 3300049582 Ga0501048_0374297 Ga0501048_0374297_16_360 114
250 3300049584 Ga0501068_0540368 Ga0501068_0540368_189_533 114
251 3300049589 Ga0501073_0000774 Ga0501073_0000774_17497_17841 114
252 3300049590 Ga0501074_0036580 Ga0501074_0036580_2089_2433 114
253 3300049591 Ga0501075_0706170 Ga0501075_0706170_97_459 114
254 3300049741 Ga0501079_0231092 Ga0501079_0231092_710_1054 114
255 3300049742 Ga0501080_0000333 Ga0501080_0000333_20153_20497 114
256 3300049744 Ga0501083_0039937 Ga0501083_0039937_904_1248 114
257 3300049822 Ga0501035_0048596 Ga0501035_0048596_2660_3004 114
258 3300049823 Ga0501044_0000979 Ga0501044_0000979_21654_21998 114
259 3300050507 nmdc:mga05p37_1222615_c1 nmdc:mga05p37_1222615_c1_189_551 114
260 3300050507 nmdc:mga05p37_97709_c1 nmdc:mga05p37_97709_c1_1825_2169 114
261 3300050510 nmdc:mga06r32_350317_c1 nmdc:mga06r32_350317_c1_14_361 114
262 3300050511 nmdc:mga08y16_85191_c1 nmdc:mga08y16_85191_c1_2385_2741 114
263 3300053078 Ga0495612_0156140 Ga0495612_0156140_207_563 114
264 3300054114 Ga0501084_0253644 Ga0501084_0253644_366_710 114
265 3300054114 Ga0501084_0740166 Ga0501084_0740166_94_438 114
266 3300059424 Ga0590075_169817 Ga0590075_169817_111_536 114
267 3300059426 Ga0590077_006496 Ga0590077_006496_1509_1856 114
268 3300060353 Ga0501082_0013277 Ga0501082_0013277_6436_6780 114
269 3300061734 Ga0530510_0307433 Ga0530510_0307433_832_1176 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

38

131

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9824 33 111
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.97 33 111
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9583 33 110
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.9139 17 109
1dco-assembly1.cif.gz_D dcoh, a bifunctional protein-binding transcriptional coactivator 0.9138 17 109
ID Description Score Start End Superfamily
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.981 33 111 3.30.1360.20
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9447 33 111 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9343 19 110 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9229 16 110 3.30.1360.20
af_C6S3E6_5_100_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.92 25 110 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A3D0U0L9-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9993 32 111 GO:0006729
GO:0008124
AF-A0A367LW71-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9956 20 109 GO:0006729
GO:0008124
AF-A0A1I7CCC5-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9921 4 109 GO:0006729
GO:0008124
AF-A0A0P9MXI2-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9903 1 109 GO:0004505
GO:0005506
GO:0006559
GO:0006729
GO:0008124
AF-A0A7V9N8K4-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9895 3 110 GO:0006729
GO:0008124

Feature Viewer

pLDDT pTM Quality
93.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map