F376552

General Info

Members Datasets Scaffolds Average Seq Length
269 166 269 125

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000009|Ga0500616_0000009_504959_505414
Length 151
Sequence MHFPIFRFSPIFGPLKISLTTLKFPLNMNIPDSLKYTKDHEWVKIEGNTATVGITDFAQGELGDIVYVDITSVGQEIAAHEIFGTVEAVKTVSDLYMPVGGKVLELNAILDGSPEKVNEDPYGDGWMIKIQISGSTNDLLSAAQYKELIGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
135 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
136 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
137 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
138 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
139 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
140 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
141 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
142 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
143 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
144 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
148 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
149 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
150 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
151 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
152 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
161 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
162 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
163 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 1.12
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
2 JGI24736J21556_1033868 3300001904 Unclassified 788
3 JGI24746J21847_1036130 3300001977 Bacteria 684
4 JGI24737J22298_10151344 3300001990 Unclassified 685
5 rootH1_10028492 3300003316 Bacteria 13537
6 rootH2_10000767 3300003320 Bacteria 103925
7 rootH2_10080527 3300003320 Bacteria 4897
8 rootH2_10147035 3300003320 Bacteria 2969
9 rootL2_10004785 3300003322 Bacteria 19054
10 rootL2_10042068 3300003322 Bacteria 14556
11 rootL2_10073219 3300003322 Bacteria 3982
12 rootH1_10000606 3300003323 Bacteria 38865
13 rootH1_10001507 3300003323 Bacteria 79355
14 rootH1_10008472 3300003323 Bacteria 18181
15 rootH1_10052348 3300003323 Bacteria 2385
16 rootH1_10052349 3300003323 Bacteria 2415
17 rootH1_10072596 3300003323 Bacteria 5936
18 rootH1_10167191 3300003323 Bacteria 3700
19 rootH1_10179536 3300003323 Bacteria 2491
20 Ga0055530_10082010 3300003791 Bacteria 675
21 Ga0065165_1001227 3300005262 Bacteria 29406
22 Ga0065165_1016469 3300005262 Bacteria 2766
23 Ga0065704_10070133 3300005289 Bacteria 1266035
24 Ga0065712_10188956 3300005290 Bacteria 1157
25 Ga0065715_10117379 3300005293 Bacteria 2350
26 Ga0070658_10100916 3300005327 Bacteria 2386
27 Ga0070658_11100598 3300005327 Bacteria 691
28 Ga0070658_11296021 3300005327 Bacteria 633
29 Ga0070683_100342567 3300005329 Bacteria 1423
30 Ga0070683_102093952 3300005329 Unclassified 543
31 Ga0070670_100091646 3300005331 Unclassified 2613
32 Ga0070670_100162564 3300005331 Bacteria 1935
33 Ga0070670_100287923 3300005331 Bacteria 1435
34 Ga0070682_101199883 3300005337 Archaea 640
35 Ga0070660_100033239 3300005339 Bacteria 3886
36 Ga0070660_100893000 3300005339 Bacteria 749
37 Ga0070660_101132160 3300005339 Unclassified 663
38 Ga0070671_100072402 3300005355 Bacteria 2878
39 Ga0070671_100177197 3300005355 Bacteria 1804
40 Ga0070673_102021005 3300005364 Bacteria 547
41 Ga0070659_100001893 3300005366 Bacteria 14974
42 Ga0070659_100028618 3300005366 Bacteria 4305
43 Ga0070659_101424391 3300005366 Unclassified 616
44 Ga0070667_100690051 3300005367 Unclassified 944
45 Ga0070706_101040890 3300005467 Unclassified 754
46 Ga0070684_100377671 3300005535 Bacteria 1305
47 Ga0068853_100138717 3300005539 Unclassified 2182
48 Ga0068853_100612227 3300005539 Bacteria 1035
49 Ga0068853_100648235 3300005539 Bacteria 1005
50 Ga0068853_100778843 3300005539 Bacteria 915
51 Ga0068853_101070209 3300005539 Bacteria 777
52 Ga0068853_101747277 3300005539 Unclassified 603
53 Ga0070672_100223406 3300005543 Bacteria 1580
54 Ga0070665_100001634 3300005548 Bacteria 25840
55 Ga0068855_100438308 3300005563 Bacteria 1427
56 Ga0070664_100107128 3300005564 Bacteria 2436
57 Ga0070664_100421630 3300005564 Bacteria 1222
58 Ga0068857_100107931 3300005577 Unclassified 2501
59 Ga0068857_100349622 3300005577 Unclassified 1369
60 Ga0068857_100606942 3300005577 Bacteria 1035
61 Ga0068857_100863947 3300005577 Bacteria 866
62 Ga0068854_100084390 3300005578 Bacteria 2350
63 Ga0068856_100587243 3300005614 Bacteria 1135
64 Ga0068856_101205050 3300005614 Bacteria 773
65 Ga0068852_100127915 3300005616 Bacteria 2335
66 Ga0068852_100291541 3300005616 Bacteria 1576
67 Ga0068852_100999965 3300005616 Unclassified 855
68 Ga0068852_101327889 3300005616 Bacteria 741
69 Ga0068859_100491007 3300005617 Unclassified 1323
70 Ga0068864_101010555 3300005618 Bacteria 825
71 Ga0068864_101861395 3300005618 Bacteria 607
72 Ga0068861_100384306 3300005719 Unclassified 1241
73 Ga0068851_10013246 3300005834 Bacteria 3902
74 Ga0068862_102673315 3300005844 Bacteria 511
75 Ga0081539_10129347 3300005985 Bacteria 1243
76 Ga0075428_100010645 3300006844 Bacteria 10221
77 Ga0075430_100203669 3300006846 Bacteria 1643
78 Ga0075431_100718787 3300006847 Bacteria 976
79 Ga0097620_100491054 3300006931 Unclassified 1323
80 Ga0099795_10516731 3300007788 Unclassified 559
81 Ga0105240_10006415 3300009093 Bacteria 17296
82 Ga0105240_12579129 3300009093 Bacteria 525
83 Ga0111539_10082897 3300009094 Bacteria 3771
84 Ga0111539_10108763 3300009094 Bacteria 3254
85 Ga0114129_10959817 3300009147 Bacteria 1079
86 Ga0105241_10190925 3300009174 Bacteria 1705
87 Ga0105237_10086307 3300009545 Bacteria 3128
88 Ga0105237_10109528 3300009545 Bacteria 2754
89 Ga0105238_10402081 3300009551 Bacteria 1363
90 Ga0105239_10684620 3300010375 Bacteria 1172
91 Ga0105239_10684622 3300010375 Bacteria 1172
92 Ga0157371_10005209 3300013102 Bacteria 11052
93 Ga0157371_10823010 3300013102 Bacteria 701
94 Ga0157370_10656499 3300013104 Unclassified 958
95 Ga0157370_11428401 3300013104 Bacteria 622
96 Ga0157369_10208942 3300013105 Bacteria 2047
97 Ga0157369_10444477 3300013105 Unclassified 1343
98 Ga0157374_10131068 3300013296 Unclassified 2426
99 Ga0157372_10022039 3300013307 Bacteria 6888
100 Ga0157372_10065195 3300013307 Bacteria 4089
101 Ga0157372_10101582 3300013307 Bacteria 3283
102 Ga0157372_10164426 3300013307 Bacteria 2566
103 Ga0157372_10209050 3300013307 Bacteria 2261
104 Ga0157372_10259521 3300013307 Bacteria 2018
105 Ga0157372_10315053 3300013307 Bacteria 1821
106 Ga0157372_10329635 3300013307 Bacteria 1777
107 Ga0157372_10681535 3300013307 Bacteria 1196
108 Ga0157372_10949805 3300013307 Bacteria 997
109 Ga0157372_11173382 3300013307 Bacteria 888
110 Ga0157372_11490252 3300013307 Bacteria 779
111 Ga0157372_11749286 3300013307 Unclassified 715
112 Ga0157375_13172057 3300013308 Bacteria 548
113 Ga0163163_10015885 3300014325 Bacteria 6973
114 Ga0163163_10600579 3300014325 Bacteria 1164
115 Ga0157380_10951977 3300014326 Bacteria 889
116 Ga0157380_11191517 3300014326 Bacteria 805
117 Ga0157377_10026055 3300014745 Bacteria 3125
118 Ga0209050_1002749 3300025298 Bacteria 14163
119 Ga0209257_1075894 3300025304 Bacteria 874
120 Ga0207656_10305377 3300025321 Bacteria 788
121 Ga0207647_10003135 3300025904 Bacteria 12418
122 Ga0207647_10053587 3300025904 Bacteria 2485
123 Ga0207705_10275132 3300025909 Bacteria 1288
124 Ga0207705_10503719 3300025909 Bacteria 941
125 Ga0207695_10007166 3300025913 Bacteria 14269
126 Ga0207671_10000728 3300025914 Bacteria 41791
127 Ga0207671_10583948 3300025914 Bacteria 891
128 Ga0207657_10706282 3300025919 Bacteria 783
129 Ga0207657_11356229 3300025919 Bacteria 535
130 Ga0207652_11472756 3300025921 Bacteria 585
131 Ga0207681_11532009 3300025923 Bacteria 559
132 Ga0207694_10107942 3300025924 Bacteria 2212
133 Ga0207650_10007076 3300025925 Bacteria 7646
134 Ga0207644_10045941 3300025931 Bacteria 3109
135 Ga0207644_10069655 3300025931 Unclassified 2569
136 Ga0207690_10017905 3300025932 Bacteria 4336
137 Ga0207690_10057990 3300025932 Bacteria 2617
138 Ga0207690_11229933 3300025932 Unclassified 625
139 Ga0207709_10001606 3300025935 Bacteria 15395
140 Ga0207661_10353354 3300025944 Bacteria 1326
141 Ga0207661_11715732 3300025944 Bacteria 573
142 Ga0207661_11900594 3300025944 Unclassified 541
143 Ga0207679_10048066 3300025945 Unclassified 3104
144 Ga0207679_10122709 3300025945 Bacteria 2071
145 Ga0207651_10844043 3300025960 Bacteria 814
146 Ga0207651_11774582 3300025960 Bacteria 555
147 Ga0207658_10485256 3300025986 Bacteria 1099
148 Ga0207639_10086344 3300026041 Unclassified 2498
149 Ga0207639_10505620 3300026041 Bacteria 1105
150 Ga0207639_10547690 3300026041 Bacteria 1062
151 Ga0207639_10737408 3300026041 Bacteria 915
152 Ga0207648_11045756 3300026089 Bacteria 765
153 Ga0207676_10356794 3300026095 Bacteria 1354
154 Ga0207674_10181309 3300026116 Unclassified 2057
155 Ga0207674_11244147 3300026116 Bacteria 714
156 Ga0207675_100663663 3300026118 Unclassified 1050
157 Ga0207698_10036510 3300026142 Bacteria 3608
158 Ga0207698_10276294 3300026142 Bacteria 1551
159 Ga0207698_11559521 3300026142 Bacteria 676
160 Ga0268266_10001407 3300028379 Bacteria 28741
161 Ga0307517_10477451 3300028786 Bacteria 640
162 Ga0265327_10000006 3300031251 Bacteria 693716
163 Ga0265327_10000038 3300031251 Bacteria 292416
164 Ga0265327_10002974 3300031251 Bacteria 16860
165 Ga0265327_10059291 3300031251 Bacteria 1961
166 Ga0307513_10122136 3300031456 Bacteria 2569
167 Ga0307509_10702372 3300031507 Bacteria 678
168 Ga0307408_100043471 3300031548 Bacteria 3197
169 Ga0307408_100793915 3300031548 Bacteria 859
170 Ga0307405_10106099 3300031731 Bacteria 1894
171 Ga0307406_10243647 3300031901 Bacteria 1350
172 Ga0307407_10043096 3300031903 Bacteria 2535
173 Ga0307412_10130730 3300031911 Bacteria 1823
174 Ga0307412_11658281 3300031911 Bacteria 585
175 Ga0307416_100000031 3300032002 Bacteria 159059
176 Ga0307416_100001911 3300032002 Bacteria 11624
177 Ga0307416_102770379 3300032002 Bacteria 586
178 Ga0307414_10311313 3300032004 Bacteria 1336
179 Ga0307411_11022159 3300032005 Unclassified 741
180 Ga0307415_100000951 3300032126 Bacteria 13333
181 Ga0307415_100661739 3300032126 Unclassified 938
182 Ga0395899_0039370 3300037312 Bacteria 3538
183 Ga0395900_0086607 3300037418 Bacteria 3219
184 Ga0395900_0194917 3300037418 Unclassified 2053
185 Ga0395905_0003427 3300037471 Bacteria 16971
186 Ga0395905_0014030 3300037471 Bacteria 7661
187 Ga0395905_0066812 3300037471 Bacteria 3367
188 Ga0395905_0110429 3300037471 Bacteria 2582
189 Ga0395905_0650237 3300037471 Bacteria 956
190 Ga0395905_0703621 3300037471 Bacteria 913
191 Ga0395901_0063048 3300038443 Bacteria 3857
192 Ga0451800_1526366 3300041459 Bacteria 578
193 Ga0451833_1286260 3300041491 Bacteria 705
194 Ga0439435_0040983 3300042436 Bacteria 1296
195 Ga0451577_0000547 3300042876 Bacteria 61495
196 Ga0451577_0000939 3300042876 Bacteria 42828
197 Ga0451577_0008113 3300042876 Bacteria 10249
198 Ga0451577_0088817 3300042876 Bacteria 2758
199 Ga0451577_0697868 3300042876 Bacteria 919
200 Ga0466972_0490792 3300044658 Bacteria 578
201 Ga0466982_0108672 3300044672 Bacteria 1716
202 Ga0453684_0000039 3300044712 Bacteria 697730
203 Ga0453684_0032545 3300044712 Bacteria 7295
204 Ga0453684_0528484 3300044712 Bacteria 1302
205 Ga0453684_2279841 3300044712 Bacteria 539
206 Ga0466970_0725773 3300044765 Bacteria 580
207 Ga0466957_1150673 3300044842 Bacteria 560
208 Ga0451576_0004317 3300045051 Bacteria 18569
209 Ga0451576_0059412 3300045051 Bacteria 3991
210 Ga0451576_0588118 3300045051 Bacteria 1170
211 Ga0466967_2010913 3300045976 Bacteria 574
212 Ga0495638_0000001 3300046460 Bacteria 1114121
213 Ga0495632_0209812 3300046519 Bacteria 884
214 Ga0495643_0014118 3300046522 Bacteria 4761
215 Ga0495633_0080047 3300046558 Bacteria 1521
216 Ga0495668_0023534 3300046616 Bacteria 3511
217 Ga0495661_0565553 3300046665 Bacteria 537
218 Ga0495670_0413009 3300046691 Bacteria 730
219 Ga0495636_0000022 3300047318 Bacteria 72235
220 Ga0496110_0391976 3300048913 Unclassified 1266
221 Ga0496115_0039839 3300048918 Bacteria 3733
222 Ga0496122_0000188 3300048925 Bacteria 143808
223 Ga0496123_0021919 3300048926 Bacteria 4946
224 Ga0501291_012965 3300049514 Unclassified 1227
225 Ga0501033_0582832 3300049570 Bacteria 768
226 Ga0501040_0638210 3300049576 Bacteria 770
227 Ga0501068_0535807 3300049584 Unclassified 761
228 Ga0501073_0215995 3300049589 Bacteria 1325
229 Ga0501076_0057286 3300049592 Bacteria 3094
230 Ga0501077_0009097 3300049593 Bacteria 6165
231 Ga0501201_022698 3300049651 Unclassified 674
232 Ga0501202_012394 3300049652 Unclassified 1608
233 Ga0501217_166501 3300049661 Unclassified 668
234 Ga0501217_320474 3300049661 Bacteria 516
235 Ga0501222_004522 3300049662 Bacteria 1889
236 Ga0501240_019407 3300049673 Unclassified 1010
237 Ga0501242_005824 3300049674 Unclassified 1396
238 Ga0501249_012041 3300049679 Bacteria 1825
239 Ga0501250_000575 3300049680 Bacteria 2564
240 Ga0501251_002135 3300049681 Bacteria 1891
241 Ga0501251_008755 3300049681 Unclassified 1151
242 Ga0501253_033886 3300049683 Bacteria 991
243 Ga0501257_006726 3300049686 Bacteria 2557
244 Ga0501225_0025047 3300049705 Unclassified 1642
245 Ga0501079_0130072 3300049741 Bacteria 1959
246 Ga0501263_001472 3300049760 Bacteria 2226
247 Ga0501266_001621 3300049763 Bacteria 2868
248 Ga0501266_013282 3300049763 Bacteria 1070
249 Ga0501266_021230 3300049763 Unclassified 887
250 Ga0501268_006478 3300049765 Bacteria 1720
251 Ga0501270_043996 3300049767 Unclassified 787
252 Ga0501276_002755 3300049773 Unclassified 1251
253 Ga0501283_096686 3300049779 Bacteria 571
254 Ga0501035_0268576 3300049822 Bacteria 1444
255 Ga0501044_0024855 3300049823 Bacteria 6354
256 Ga0501044_1584116 3300049823 Bacteria 520
257 Ga0501284_01186 3300050005 Bacteria 1371
258 nmdc:mga09592_1172246_c1 3300050508 Bacteria 636
259 nmdc:mga0qj67_972812_c1 3300050509 Bacteria 667
260 nmdc:mga06r32_125475_c1 3300050510 Bacteria 2535
261 nmdc:mga08y16_180231_c1 3300050511 Bacteria 2194
262 nmdc:mga08y16_32296_c1 3300050511 Bacteria 5504
263 Ga0500651_0626195 3300053093 Unclassified 581
264 Ga0500556_0121796 3300053104 Bacteria 1018
265 Ga0500557_004929 3300053105 Bacteria 2865
266 Ga0500655_004610 3300053133 Bacteria 2477
267 Ga0500616_0000009 3300053153 Bacteria 779095
268 Ga0500645_161727 3300053730 Bacteria 614
269 Ga0501084_0487416 3300054114 Bacteria 1042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_11296021 Ga0070658_112960211 101
2 3300006846 Ga0075430_100203669 Ga0075430_1002036691 101
3 3300006847 Ga0075431_100718787 Ga0075431_1007187872 101
4 3300025919 Ga0207657_11356229 Ga0207657_113562291 101
5 3300050509 nmdc:mga0qj67_972812_c1 nmdc:mga0qj67_972812_c1_66_452 101
6 3300050510 nmdc:mga06r32_125475_c1 nmdc:mga06r32_125475_c1_1641_2027 101
7 3300003316 rootH1_10028492 rootH1_100284924 123
8 3300003320 rootH2_10000767 rootH2_1000076783 123
9 3300003320 rootH2_10080527 rootH2_100805276 123
10 3300003322 rootL2_10004785 rootL2_100047856 123
11 3300003322 rootL2_10042068 rootL2_100420684 123
12 3300003322 rootL2_10073219 rootL2_100732192 123
13 3300003323 rootH1_10000606 rootH1_1000060617 123
14 3300003323 rootH1_10001507 rootH1_1000150754 123
15 3300003323 rootH1_10052348 rootH1_100523483 123
16 3300003323 rootH1_10052349 rootH1_100523493 123
17 3300003323 rootH1_10072596 rootH1_100725962 123
18 3300003323 rootH1_10167191 rootH1_101671912 123
19 3300003323 rootH1_10179536 rootH1_101795362 123
20 3300003791 Ga0055530_10082010 Ga0055530_100820101 123
21 3300005262 Ga0065165_1001227 Ga0065165_10012276 123
22 3300005262 Ga0065165_1016469 Ga0065165_10164692 123
23 3300005577 Ga0068857_100863947 Ga0068857_1008639471 123
24 3300005614 Ga0068856_100587243 Ga0068856_1005872432 123
25 3300005844 Ga0068862_102673315 Ga0068862_1026733152 123
26 3300006844 Ga0075428_100010645 Ga0075428_1000106459 123
27 3300007788 Ga0099795_10516731 Ga0099795_105167311 123
28 3300009094 Ga0111539_10082897 Ga0111539_100828973 123
29 3300009094 Ga0111539_10108763 Ga0111539_101087635 123
30 3300009147 Ga0114129_10959817 Ga0114129_109598172 123
31 3300014326 Ga0157380_10951977 Ga0157380_109519771 123
32 3300025298 Ga0209050_1002749 Ga0209050_10027492 123
33 3300025304 Ga0209257_1075894 Ga0209257_10758941 123
34 3300025909 Ga0207705_10503719 Ga0207705_105037192 123
35 3300025921 Ga0207652_11472756 Ga0207652_114727561 123
36 3300028786 Ga0307517_10477451 Ga0307517_104774511 123
37 3300031456 Ga0307513_10122136 Ga0307513_101221363 123
38 3300031548 Ga0307408_100043471 Ga0307408_1000434712 123
39 3300031731 Ga0307405_10106099 Ga0307405_101060992 123
40 3300031901 Ga0307406_10243647 Ga0307406_102436472 123
41 3300031903 Ga0307407_10043096 Ga0307407_100430963 123
42 3300031911 Ga0307412_10130730 Ga0307412_101307301 123
43 3300031911 Ga0307412_11658281 Ga0307412_116582811 123
44 3300032002 Ga0307416_100001911 Ga0307416_1000019112 123
45 3300032126 Ga0307415_100000951 Ga0307415_1000009516 123
46 3300037312 Ga0395899_0039370 Ga0395899_0039370_1941_2336 123
47 3300037418 Ga0395900_0086607 Ga0395900_0086607_1818_2213 123
48 3300037471 Ga0395905_0066812 Ga0395905_0066812_1915_2310 123
49 3300037471 Ga0395905_0110429 Ga0395905_0110429_1715_2098 123
50 3300038443 Ga0395901_0063048 Ga0395901_0063048_1908_2303 123
51 3300041459 Ga0451800_1526366 Ga0451800_1526366_160_534 123
52 3300041491 Ga0451833_1286260 Ga0451833_1286260_107_481 123
53 3300042876 Ga0451577_0088817 Ga0451577_0088817_612_986 123
54 3300044672 Ga0466982_0108672 Ga0466982_0108672_1194_1568 123
55 3300044712 Ga0453684_0528484 Ga0453684_0528484_785_1159 123
56 3300044712 Ga0453684_2279841 Ga0453684_2279841_19_393 123
57 3300045051 Ga0451576_0004317 Ga0451576_0004317_965_1339 123
58 3300045976 Ga0466967_2010913 Ga0466967_2010913_128_511 123
59 3300046460 Ga0495638_0000001 Ga0495638_0000001_218276_218650 123
60 3300046519 Ga0495632_0209812 Ga0495632_0209812_103_477 123
61 3300049661 Ga0501217_166501 Ga0501217_166501_36_410 123
62 3300049661 Ga0501217_320474 Ga0501217_320474_128_502 123
63 3300049662 Ga0501222_004522 Ga0501222_004522_474_848 123
64 3300049779 Ga0501283_096686 Ga0501283_096686_162_536 123
65 3300050508 nmdc:mga09592_1172246_c1 nmdc:mga09592_1172246_c1_28_402 123
66 3300050511 nmdc:mga08y16_180231_c1 nmdc:mga08y16_180231_c1_200_574 123
67 3300050511 nmdc:mga08y16_32296_c1 nmdc:mga08y16_32296_c1_1175_1549 123
68 3300053104 Ga0500556_0121796 Ga0500556_0121796_78_452 123
69 3300053105 Ga0500557_004929 Ga0500557_004929_2159_2533 123
70 3300053133 Ga0500655_004610 Ga0500655_004610_1175_1549 123
71 3300053153 Ga0500616_0000009 Ga0500616_0000009_504959_505414 123
72 3300053730 Ga0500645_161727 Ga0500645_161727_130_504 123
73 3300013307 Ga0157372_10065195 Ga0157372_100651954 124
74 3300013307 Ga0157372_10164426 Ga0157372_101644262 124
75 3300013307 Ga0157372_10681535 Ga0157372_106815352 124
76 3300026089 Ga0207648_11045756 Ga0207648_110457562 124
77 3300042876 Ga0451577_0000939 Ga0451577_0000939_26543_26944 124
78 3300042876 Ga0451577_0008113 Ga0451577_0008113_854_1255 124
79 3300045051 Ga0451576_0588118 Ga0451576_0588118_310_693 124
80 3300054114 Ga0501084_0487416 Ga0501084_0487416_334_714 124
81 2162886007 SwRhRL2b_contig_1759593 SwRhRL2b_0521.00008010 125
82 3300001904 JGI24736J21556_1033868 JGI24736J21556_10338682 125
83 3300001977 JGI24746J21847_1036130 JGI24746J21847_10361302 125
84 3300001990 JGI24737J22298_10151344 JGI24737J22298_101513442 125
85 3300003320 rootH2_10147035 rootH2_101470351 125
86 3300003323 rootH1_10008472 rootH1_1000847217 125
87 3300005289 Ga0065704_10070133 Ga0065704_1007013315 125
88 3300005290 Ga0065712_10188956 Ga0065712_101889561 125
89 3300005293 Ga0065715_10117379 Ga0065715_101173793 125
90 3300005327 Ga0070658_10100916 Ga0070658_101009162 125
91 3300005327 Ga0070658_11100598 Ga0070658_111005982 125
92 3300005329 Ga0070683_100342567 Ga0070683_1003425673 125
93 3300005329 Ga0070683_102093952 Ga0070683_1020939521 125
94 3300005331 Ga0070670_100091646 Ga0070670_1000916463 125
95 3300005331 Ga0070670_100162564 Ga0070670_1001625643 125
96 3300005331 Ga0070670_100287923 Ga0070670_1002879231 125
97 3300005337 Ga0070682_101199883 Ga0070682_1011998831 125
98 3300005339 Ga0070660_100033239 Ga0070660_1000332393 125
99 3300005339 Ga0070660_100893000 Ga0070660_1008930001 125
100 3300005339 Ga0070660_101132160 Ga0070660_1011321601 125
101 3300005355 Ga0070671_100072402 Ga0070671_1000724022 125
102 3300005355 Ga0070671_100177197 Ga0070671_1001771971 125
103 3300005364 Ga0070673_102021005 Ga0070673_1020210051 125
104 3300005366 Ga0070659_100001893 Ga0070659_1000018938 125
105 3300005366 Ga0070659_100028618 Ga0070659_1000286183 125
106 3300005366 Ga0070659_101424391 Ga0070659_1014243912 125
107 3300005367 Ga0070667_100690051 Ga0070667_1006900512 125
108 3300005467 Ga0070706_101040890 Ga0070706_1010408902 125
109 3300005535 Ga0070684_100377671 Ga0070684_1003776712 125
110 3300005539 Ga0068853_100138717 Ga0068853_1001387172 125
111 3300005539 Ga0068853_100612227 Ga0068853_1006122272 125
112 3300005539 Ga0068853_100648235 Ga0068853_1006482352 125
113 3300005539 Ga0068853_100778843 Ga0068853_1007788432 125
114 3300005539 Ga0068853_101070209 Ga0068853_1010702091 125
115 3300005539 Ga0068853_101747277 Ga0068853_1017472771 125
116 3300005543 Ga0070672_100223406 Ga0070672_1002234063 125
117 3300005548 Ga0070665_100001634 Ga0070665_1000016344 125
118 3300005563 Ga0068855_100438308 Ga0068855_1004383082 125
119 3300005564 Ga0070664_100107128 Ga0070664_1001071281 125
120 3300005564 Ga0070664_100421630 Ga0070664_1004216302 125
121 3300005577 Ga0068857_100107931 Ga0068857_1001079314 125
122 3300005577 Ga0068857_100349622 Ga0068857_1003496223 125
123 3300005577 Ga0068857_100606942 Ga0068857_1006069422 125
124 3300005578 Ga0068854_100084390 Ga0068854_1000843904 125
125 3300005614 Ga0068856_101205050 Ga0068856_1012050502 125
126 3300005616 Ga0068852_100127915 Ga0068852_1001279153 125
127 3300005616 Ga0068852_100291541 Ga0068852_1002915412 125
128 3300005616 Ga0068852_100999965 Ga0068852_1009999652 125
129 3300005616 Ga0068852_101327889 Ga0068852_1013278892 125
130 3300005617 Ga0068859_100491007 Ga0068859_1004910071 125
131 3300005618 Ga0068864_101010555 Ga0068864_1010105551 125
132 3300005618 Ga0068864_101861395 Ga0068864_1018613951 125
133 3300005719 Ga0068861_100384306 Ga0068861_1003843062 125
134 3300005834 Ga0068851_10013246 Ga0068851_100132463 125
135 3300005985 Ga0081539_10129347 Ga0081539_101293472 125
136 3300006931 Ga0097620_100491054 Ga0097620_1004910543 125
137 3300009093 Ga0105240_10006415 Ga0105240_100064151 125
138 3300009093 Ga0105240_12579129 Ga0105240_125791291 125
139 3300009174 Ga0105241_10190925 Ga0105241_101909252 125
140 3300009545 Ga0105237_10086307 Ga0105237_100863074 125
141 3300009545 Ga0105237_10109528 Ga0105237_101095283 125
142 3300009551 Ga0105238_10402081 Ga0105238_104020812 125
143 3300010375 Ga0105239_10684620 Ga0105239_106846203 125
144 3300010375 Ga0105239_10684622 Ga0105239_106846223 125
145 3300013102 Ga0157371_10005209 Ga0157371_100052094 125
146 3300013102 Ga0157371_10823010 Ga0157371_108230101 125
147 3300013104 Ga0157370_10656499 Ga0157370_106564991 125
148 3300013104 Ga0157370_11428401 Ga0157370_114284011 125
149 3300013105 Ga0157369_10208942 Ga0157369_102089422 125
150 3300013105 Ga0157369_10444477 Ga0157369_104444773 125
151 3300013296 Ga0157374_10131068 Ga0157374_101310682 125
152 3300013307 Ga0157372_10022039 Ga0157372_100220397 125
153 3300013307 Ga0157372_10101582 Ga0157372_101015825 125
154 3300013307 Ga0157372_10209050 Ga0157372_102090503 125
155 3300013307 Ga0157372_10259521 Ga0157372_102595214 125
156 3300013307 Ga0157372_10315053 Ga0157372_103150532 125
157 3300013307 Ga0157372_10329635 Ga0157372_103296353 125
158 3300013307 Ga0157372_10949805 Ga0157372_109498052 125
159 3300013307 Ga0157372_11173382 Ga0157372_111733821 125
160 3300013307 Ga0157372_11490252 Ga0157372_114902522 125
161 3300013307 Ga0157372_11749286 Ga0157372_117492862 125
162 3300013308 Ga0157375_13172057 Ga0157375_131720571 125
163 3300014325 Ga0163163_10015885 Ga0163163_100158857 125
164 3300014325 Ga0163163_10600579 Ga0163163_106005792 125
165 3300014326 Ga0157380_11191517 Ga0157380_111915171 125
166 3300014745 Ga0157377_10026055 Ga0157377_100260552 125
167 3300025321 Ga0207656_10305377 Ga0207656_103053772 125
168 3300025904 Ga0207647_10003135 Ga0207647_1000313512 125
169 3300025904 Ga0207647_10053587 Ga0207647_100535873 125
170 3300025909 Ga0207705_10275132 Ga0207705_102751321 125
171 3300025913 Ga0207695_10007166 Ga0207695_1000716610 125
172 3300025914 Ga0207671_10000728 Ga0207671_100007284 125
173 3300025914 Ga0207671_10583948 Ga0207671_105839482 125
174 3300025919 Ga0207657_10706282 Ga0207657_107062822 125
175 3300025923 Ga0207681_11532009 Ga0207681_115320091 125
176 3300025924 Ga0207694_10107942 Ga0207694_101079423 125
177 3300025925 Ga0207650_10007076 Ga0207650_100070767 125
178 3300025931 Ga0207644_10045941 Ga0207644_100459414 125
179 3300025931 Ga0207644_10069655 Ga0207644_100696553 125
180 3300025932 Ga0207690_10017905 Ga0207690_100179053 125
181 3300025932 Ga0207690_10057990 Ga0207690_100579904 125
182 3300025932 Ga0207690_11229933 Ga0207690_112299331 125
183 3300025935 Ga0207709_10001606 Ga0207709_100016065 125
184 3300025944 Ga0207661_10353354 Ga0207661_103533543 125
185 3300025944 Ga0207661_11715732 Ga0207661_117157321 125
186 3300025944 Ga0207661_11900594 Ga0207661_119005941 125
187 3300025945 Ga0207679_10048066 Ga0207679_100480663 125
188 3300025945 Ga0207679_10122709 Ga0207679_101227092 125
189 3300025960 Ga0207651_10844043 Ga0207651_108440431 125
190 3300025960 Ga0207651_11774582 Ga0207651_117745821 125
191 3300025986 Ga0207658_10485256 Ga0207658_104852562 125
192 3300026041 Ga0207639_10086344 Ga0207639_100863444 125
193 3300026041 Ga0207639_10505620 Ga0207639_105056202 125
194 3300026041 Ga0207639_10547690 Ga0207639_105476902 125
195 3300026041 Ga0207639_10737408 Ga0207639_107374082 125
196 3300026095 Ga0207676_10356794 Ga0207676_103567942 125
197 3300026116 Ga0207674_10181309 Ga0207674_101813094 125
198 3300026116 Ga0207674_11244147 Ga0207674_112441471 125
199 3300026118 Ga0207675_100663663 Ga0207675_1006636632 125
200 3300026142 Ga0207698_10036510 Ga0207698_100365102 125
201 3300026142 Ga0207698_10276294 Ga0207698_102762942 125
202 3300026142 Ga0207698_11559521 Ga0207698_115595212 125
203 3300028379 Ga0268266_10001407 Ga0268266_1000140719 125
204 3300031251 Ga0265327_10000006 Ga0265327_10000006435 125
205 3300031251 Ga0265327_10000038 Ga0265327_1000003883 125
206 3300031251 Ga0265327_10002974 Ga0265327_100029748 125
207 3300031251 Ga0265327_10059291 Ga0265327_100592913 125
208 3300031507 Ga0307509_10702372 Ga0307509_107023721 125
209 3300031548 Ga0307408_100793915 Ga0307408_1007939152 125
210 3300032002 Ga0307416_100000031 Ga0307416_10000003120 125
211 3300032002 Ga0307416_102770379 Ga0307416_1027703791 125
212 3300032004 Ga0307414_10311313 Ga0307414_103113132 125
213 3300032005 Ga0307411_11022159 Ga0307411_110221591 125
214 3300032126 Ga0307415_100661739 Ga0307415_1006617392 125
215 3300037418 Ga0395900_0194917 Ga0395900_0194917_530_907 125
216 3300037471 Ga0395905_0003427 Ga0395905_0003427_10782_11159 125
217 3300037471 Ga0395905_0014030 Ga0395905_0014030_5334_5711 125
218 3300037471 Ga0395905_0650237 Ga0395905_0650237_152_535 125
219 3300037471 Ga0395905_0703621 Ga0395905_0703621_258_638 125
220 3300042436 Ga0439435_0040983 Ga0439435_0040983_644_1090 125
221 3300042876 Ga0451577_0000547 Ga0451577_0000547_36467_36847 125
222 3300042876 Ga0451577_0697868 Ga0451577_0697868_341_721 125
223 3300044658 Ga0466972_0490792 Ga0466972_0490792_157_534 125
224 3300044712 Ga0453684_0000039 Ga0453684_0000039_396775_397155 125
225 3300044712 Ga0453684_0032545 Ga0453684_0032545_1610_1990 125
226 3300044765 Ga0466970_0725773 Ga0466970_0725773_73_450 125
227 3300044842 Ga0466957_1150673 Ga0466957_1150673_148_525 125
228 3300045051 Ga0451576_0059412 Ga0451576_0059412_1004_1384 125
229 3300046522 Ga0495643_0014118 Ga0495643_0014118_1616_1996 125
230 3300046558 Ga0495633_0080047 Ga0495633_0080047_306_686 125
231 3300046616 Ga0495668_0023534 Ga0495668_0023534_2622_3002 125
232 3300046665 Ga0495661_0565553 Ga0495661_0565553_119_499 125
233 3300046691 Ga0495670_0413009 Ga0495670_0413009_128_508 125
234 3300047318 Ga0495636_0000022 Ga0495636_0000022_67287_67667 125
235 3300048913 Ga0496110_0391976 Ga0496110_0391976_600_980 125
236 3300048918 Ga0496115_0039839 Ga0496115_0039839_1625_2005 125
237 3300048925 Ga0496122_0000188 Ga0496122_0000188_35990_36370 125
238 3300048926 Ga0496123_0021919 Ga0496123_0021919_827_1207 125
239 3300049514 Ga0501291_012965 Ga0501291_012965_655_1032 125
240 3300049570 Ga0501033_0582832 Ga0501033_0582832_123_503 125
241 3300049576 Ga0501040_0638210 Ga0501040_0638210_26_409 125
242 3300049584 Ga0501068_0535807 Ga0501068_0535807_143_532 125
243 3300049589 Ga0501073_0215995 Ga0501073_0215995_684_1073 125
244 3300049592 Ga0501076_0057286 Ga0501076_0057286_2663_3052 125
245 3300049593 Ga0501077_0009097 Ga0501077_0009097_602_991 125
246 3300049651 Ga0501201_022698 Ga0501201_022698_117_494 125
247 3300049652 Ga0501202_012394 Ga0501202_012394_789_1166 125
248 3300049673 Ga0501240_019407 Ga0501240_019407_368_745 125
249 3300049674 Ga0501242_005824 Ga0501242_005824_740_1117 125
250 3300049679 Ga0501249_012041 Ga0501249_012041_843_1220 125
251 3300049680 Ga0501250_000575 Ga0501250_000575_1140_1517 125
252 3300049681 Ga0501251_002135 Ga0501251_002135_653_1030 125
253 3300049681 Ga0501251_008755 Ga0501251_008755_149_526 125
254 3300049683 Ga0501253_033886 Ga0501253_033886_428_805 125
255 3300049686 Ga0501257_006726 Ga0501257_006726_246_623 125
256 3300049705 Ga0501225_0025047 Ga0501225_0025047_129_506 125
257 3300049741 Ga0501079_0130072 Ga0501079_0130072_331_720 125
258 3300049760 Ga0501263_001472 Ga0501263_001472_1068_1445 125
259 3300049763 Ga0501266_001621 Ga0501266_001621_2161_2538 125
260 3300049763 Ga0501266_013282 Ga0501266_013282_285_662 125
261 3300049763 Ga0501266_021230 Ga0501266_021230_435_812 125
262 3300049765 Ga0501268_006478 Ga0501268_006478_1289_1666 125
263 3300049767 Ga0501270_043996 Ga0501270_043996_140_517 125
264 3300049773 Ga0501276_002755 Ga0501276_002755_711_1088 125
265 3300049822 Ga0501035_0268576 Ga0501035_0268576_541_921 125
266 3300049823 Ga0501044_0024855 Ga0501044_0024855_2596_2976 125
267 3300049823 Ga0501044_1584116 Ga0501044_1584116_113_493 125
268 3300050005 Ga0501284_01186 Ga0501284_01186_276_656 125
269 3300053093 Ga0500651_0626195 Ga0500651_0626195_130_510 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

34

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9784 2 124
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9755 1 123
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9748 6 124
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.96 2 124
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9555 2 124
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9744 6 124 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9696 7 122 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9687 6 125 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9527 20 125 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9427 5 125 2.40.50.100
ID Description Score Start End GO Terms
AF-I4AGP6-F1-model_v4 Glycine cleavage system H protein 1 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A7D4ULF5-F1-model_v4 Glycine cleavage system H protein 0.9993 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A1H9G454-F1-model_v4 Glycine cleavage system H protein 0.9988 1 124 GO:0005829
GO:0005960
GO:0019464
AF-A0A3E1Y9Y3-F1-model_v4 Glycine cleavage system H protein 0.9985 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A3M7TI61-F1-model_v4 Glycine cleavage system H protein 0.9972 1 125 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
97.21 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map