F376472

General Info

Members Datasets Scaffolds Average Seq Length
269 163 538 159

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0940672|Ga0496100_0940672_24_566
Length 180
Sequence VSDNGGPAPRPVRRCVCPGSYDPVTNGHLDVIERAARLFDEVVVAVLHNPAKSGLFPVEERLALFRHALDDRLGSGHQVSVGAWSGRLLVDVCRELAAVAVVKGLRGTGDLGYELPMALMNRHLTGVETVFLPGDPAWGHVSSTLVKEVSAYGGDVAGLVPPEVNERLVARRERGPEEGA

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
49 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
61 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
62 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
63 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
72 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
73 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
152 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
153 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
154 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
155 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
156 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
157 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
158 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
159 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
160 2920879853 Kocuria salina CV6 Isolate Unclassified
161 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
162 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
163 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 0
Isolates 4.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.13
Rhizosphere 81.04
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0940672 3300048903 Bacteria 679
2 JGI24739J22299_10139306 3300001989 Bacteria 720
3 JGI24735J21928_10098508 3300002067 Bacteria 839
4 Ga0070680_100762772 3300005336 Bacteria 833
5 Ga0070709_10258575 3300005434 Bacteria 1257
6 Ga0070711_100229608 3300005439 Bacteria 1446
7 Ga0070711_100526315 3300005439 Bacteria 978
8 Ga0070705_100006026 3300005440 Bacteria 5930
9 Ga0068867_100213754 3300005459 Bacteria 1550
10 Ga0068854_100225299 3300005578 Bacteria 1485
11 Ga0068864_100988525 3300005618 Bacteria 834
12 Ga0068866_10007443 3300005718 Bacteria 4584
13 Ga0081540_1029579 3300005983 Bacteria 3048
14 Ga0075431_100056425 3300006847 Bacteria 4051
15 Ga0105240_12148038 3300009093 Bacteria 579
16 Ga0105245_11733463 3300009098 Bacteria 677
17 Ga0105247_10895087 3300009101 Bacteria 685
18 Ga0105243_10072897 3300009148 Bacteria 2781
19 Ga0105242_10265303 3300009176 Bacteria 1553
20 Ga0105238_10032248 3300009551 Bacteria 5332
21 Ga0105249_10033625 3300009553 Bacteria 4643
22 Ga0157371_10216161 3300013102 Bacteria 1376
23 Ga0157370_10026489 3300013104 Bacteria 5724
24 Ga0157369_10555580 3300013105 Bacteria 1186
25 Ga0157369_11243474 3300013105 Bacteria 759
26 Ga0157369_11583733 3300013105 Bacteria 666
27 Ga0157378_10761721 3300013297 Bacteria 992
28 Ga0163162_10075135 3300013306 Bacteria 3439
29 Ga0157375_10023351 3300013308 Bacteria 5706
30 Ga0157380_11271091 3300014326 Bacteria 782
31 Ga0157380_12497947 3300014326 Bacteria 582
32 Ga0157379_10981962 3300014968 Bacteria 804
33 Ga0207642_10358604 3300025899 Bacteria 862
34 Ga0207663_10148622 3300025916 Bacteria 1641
35 Ga0207663_11034647 3300025916 Bacteria 659
36 Ga0207660_11094830 3300025917 Bacteria 649
37 Ga0207659_10164946 3300025926 Bacteria 1743
38 Ga0207709_10117584 3300025935 Bacteria 1789
39 Ga0207709_10225546 3300025935 Bacteria 1354
40 Ga0207669_10333127 3300025937 Bacteria 1166
41 Ga0207691_10121178 3300025940 Bacteria 2318
42 Ga0207712_10083324 3300025961 Bacteria 2334
43 Ga0207668_10237859 3300025972 Bacteria 1472
44 Ga0207702_10038013 3300026078 Bacteria 4031
45 Ga0207648_10250200 3300026089 Bacteria 1580
46 Ga0207674_10796480 3300026116 Bacteria 912
47 Ga0207675_100647422 3300026118 Bacteria 1063
48 Ga0207683_10325918 3300026121 Bacteria 1407
49 Ga0307515_10450194 3300028794 Bacteria 903
50 Ga0265327_10005465 3300031251 Bacteria 10602
51 Ga0265327_10049256 3300031251 Bacteria 2211
52 Ga0265327_10109867 3300031251 Bacteria 1319
53 Ga0307408_100928151 3300031548 Bacteria 798
54 Ga0316579_10026904 3300031691 Bacteria 2608
55 Ga0316579_10173354 3300031691 Bacteria 1043
56 Ga0316579_10492068 3300031691 Bacteria 593
57 Ga0265314_10229845 3300031711 Bacteria 1077
58 Ga0316576_10177821 3300031727 Unclassified 1605
59 Ga0316576_10261134 3300031727 Bacteria 1299
60 Ga0316576_10274620 3300031727 Bacteria 1263
61 Ga0316578_10227105 3300031728 Bacteria 1122
62 Ga0316578_10293271 3300031728 Unclassified 973
63 Ga0307405_10096382 3300031731 Bacteria 1972
64 Ga0316577_10000602 3300031733 Bacteria 14833
65 Ga0316577_10086125 3300031733 Bacteria 1758
66 Ga0316577_10121614 3300031733 Bacteria 1467
67 Ga0307413_10482944 3300031824 Bacteria 991
68 Ga0307410_10006536 3300031852 Bacteria 6299
69 Ga0307410_10408909 3300031852 Bacteria 1098
70 Ga0307406_10207928 3300031901 Bacteria 1446
71 Ga0307407_10025989 3300031903 Bacteria 3095
72 Ga0307409_100044515 3300031995 Bacteria 3343
73 Ga0307409_100125421 3300031995 Bacteria 2183
74 Ga0307409_100545459 3300031995 Bacteria 1137
75 Ga0307416_100036871 3300032002 Bacteria 3756
76 Ga0307416_100158162 3300032002 Bacteria 2090
77 Ga0307416_100244807 3300032002 Bacteria 1741
78 Ga0307416_101530528 3300032002 Bacteria 773
79 Ga0307414_10149822 3300032004 Bacteria 1839
80 Ga0307415_100213921 3300032126 Bacteria 1540
81 Ga0316583_10020605 3300032133 Bacteria 2362
82 Ga0316583_10086151 3300032133 Bacteria 1097
83 Ga0316585_10012328 3300032137 Bacteria 2531
84 Ga0316580_10061115 3300032139 Bacteria 1157
85 Ga0373951_0004401 3300035091 Bacteria 3348
86 Ga0316582_0003086 3300036647 Bacteria 8053
87 Ga0316582_0038606 3300036647 Bacteria 2968
88 Ga0316582_0081465 3300036647 Bacteria 2114
89 Ga0316582_0119612 3300036647 Bacteria 1761
90 Ga0316584_0031287 3300036712 Bacteria 3935
91 Ga0316584_0056328 3300036712 Unclassified 2943
92 Ga0316584_0066170 3300036712 Bacteria 2708
93 Ga0316584_0493284 3300036712 Bacteria 861
94 Ga0316584_0512618 3300036712 Bacteria 841
95 Ga0395899_0017442 3300037312 Bacteria 5469
96 Ga0395900_0318894 3300037418 Bacteria 1535
97 Ga0395898_0006373 3300037466 Bacteria 12606
98 Ga0395905_0000599 3300037471 Bacteria 48178
99 Ga0395905_0766890 3300037471 Bacteria 867
100 Ga0395901_0008991 3300038443 Bacteria 10115
101 Ga0395901_0027176 3300038443 Bacteria 5878
102 Ga0395901_0451169 3300038443 Bacteria 1315
103 Ga0400488_28019 3300038741 Bacteria 4275
104 Ga0400486_08631 3300038742 Bacteria 3472
105 Ga0400487_65088 3300039110 Bacteria 3172
106 Ga0436365_0751132 3300039437 Bacteria 1421
107 Ga0451843_1294647 3300041509 Bacteria 1138
108 Ga0451577_0210057 3300042876 Bacteria 1758
109 Ga0453683_0031532 3300044673 Bacteria 3348
110 Ga0453683_0037842 3300044673 Bacteria 3034
111 Ga0466966_0163825 3300044684 Bacteria 1353
112 Ga0466966_0193768 3300044684 Bacteria 1231
113 Ga0466966_0208584 3300044684 Bacteria 1181
114 Ga0466963_0397477 3300044694 Bacteria 972
115 Ga0453684_0012048 3300044712 Bacteria 14370
116 Ga0453684_0030725 3300044712 Bacteria 7578
117 Ga0453684_0404377 3300044712 Bacteria 1528
118 Ga0453684_0432745 3300044712 Bacteria 1467
119 Ga0466971_0048136 3300044719 Bacteria 1917
120 Ga0466970_0085810 3300044765 Bacteria 1706
121 Ga0466970_0378371 3300044765 Bacteria 806
122 Ga0466957_0924249 3300044842 Bacteria 624
123 Ga0466960_0093446 3300044901 Bacteria 1537
124 Ga0466960_0352736 3300044901 Bacteria 839
125 Ga0466960_0647056 3300044901 Bacteria 631
126 Ga0466959_0391443 3300045049 Bacteria 945
127 Ga0451576_0005011 3300045051 Bacteria 16829
128 Ga0451576_0040882 3300045051 Bacteria 4903
129 Ga0466967_0026269 3300045976 Bacteria 4820
130 Ga0466967_0081144 3300045976 Bacteria 2929
131 Ga0466967_0491124 3300045976 Bacteria 1204
132 Ga0466967_2111838 3300045976 Bacteria 560
133 Ga0495641_0429306 3300046461 Bacteria 600
134 Ga0495653_0014310 3300046463 Bacteria 6470
135 Ga0495582_0904203 3300046473 Bacteria 510
136 Ga0495594_0823554 3300046499 Bacteria 523
137 Ga0495608_0042322 3300046511 Bacteria 3046
138 Ga0495628_0287434 3300046516 Bacteria 1220
139 Ga0495630_0632819 3300046517 Bacteria 820
140 Ga0495665_0217227 3300046531 Bacteria 989
141 Ga0495665_0399974 3300046531 Bacteria 697
142 Ga0495640_0236541 3300046533 Bacteria 1147
143 Ga0495667_0048705 3300046559 Bacteria 2798
144 Ga0495634_0428162 3300046642 Bacteria 783
145 Ga0495658_0039496 3300046683 Bacteria 2619
146 Ga0495658_0609712 3300046683 Bacteria 699
147 Ga0495613_0174005 3300046689 Bacteria 1527
148 Ga0495613_0178430 3300046689 Bacteria 1505
149 Ga0495600_0280516 3300046809 Bacteria 1055
150 Ga0495674_0326927 3300047319 Bacteria 1248
151 Ga0495676_0303546 3300047321 Bacteria 1076
152 Ga0495676_0322910 3300047321 Bacteria 1037
153 Ga0495676_0654214 3300047321 Bacteria 682
154 Ga0495684_0095459 3300047471 Bacteria 2251
155 Ga0495602_0198345 3300048088 Bacteria 1533
156 Ga0496100_0013406 3300048903 Bacteria 4727
157 Ga0496100_0078017 3300048903 Bacteria 2228
158 Ga0496100_0362635 3300048903 Bacteria 1097
159 Ga0496100_0656281 3300048903 Bacteria 817
160 Ga0496100_0726583 3300048903 Bacteria 776
161 Ga0496101_0425363 3300048904 Bacteria 1047
162 Ga0496101_0721466 3300048904 Bacteria 787
163 Ga0496101_0739361 3300048904 Bacteria 776
164 Ga0496102_0024562 3300048905 Bacteria 5357
165 Ga0496102_0099798 3300048905 Bacteria 2695
166 Ga0496103_0051222 3300048906 Bacteria 2555
167 Ga0496103_0377250 3300048906 Bacteria 911
168 Ga0496104_0020774 3300048907 Bacteria 6022
169 Ga0496104_0215825 3300048907 Bacteria 1830
170 Ga0496104_1331544 3300048907 Bacteria 621
171 Ga0496105_0022989 3300048908 Bacteria 5055
172 Ga0496105_0103077 3300048908 Bacteria 2356
173 Ga0496105_0568611 3300048908 Bacteria 883
174 Ga0496106_1359160 3300048909 Bacteria 550
175 Ga0496107_0460877 3300048910 Bacteria 944
176 Ga0496108_0162305 3300048911 Bacteria 1932
177 Ga0496108_0465321 3300048911 Bacteria 1105
178 Ga0496109_0495639 3300048912 Bacteria 1153
179 Ga0496109_0764611 3300048912 Bacteria 904
180 Ga0496110_0342924 3300048913 Bacteria 1361
181 Ga0496110_0571957 3300048913 Bacteria 1026
182 Ga0496110_0918738 3300048913 Bacteria 781
183 Ga0496111_0003325 3300048914 Bacteria 9942
184 Ga0496111_0069856 3300048914 Bacteria 2554
185 Ga0496111_0559376 3300048914 Bacteria 839
186 Ga0496114_0058580 3300048917 Bacteria 3216
187 Ga0496114_0175230 3300048917 Bacteria 1871
188 Ga0496114_0194916 3300048917 Bacteria 1773
189 Ga0496114_0317445 3300048917 Bacteria 1376
190 Ga0496115_0207911 3300048918 Bacteria 1617
191 Ga0496115_0209711 3300048918 Bacteria 1609
192 Ga0496115_0767489 3300048918 Bacteria 753
193 Ga0501031_0006015 3300049568 Bacteria 7920
194 Ga0501031_0031674 3300049568 Bacteria 3449
195 Ga0501032_0118919 3300049569 Bacteria 1747
196 Ga0501032_0150594 3300049569 Bacteria 1530
197 Ga0501036_0003829 3300049572 Bacteria 12073
198 Ga0501036_0102297 3300049572 Bacteria 2424
199 Ga0501037_0138676 3300049573 Bacteria 1741
200 Ga0501038_0061110 3300049574 Bacteria 3223
201 Ga0501038_0072061 3300049574 Bacteria 2928
202 Ga0501039_0017043 3300049575 Bacteria 5569
203 Ga0501039_0139346 3300049575 Bacteria 1905
204 Ga0501039_1307000 3300049575 Bacteria 559
205 Ga0501040_0006153 3300049576 Bacteria 7785
206 Ga0501040_0014731 3300049576 Bacteria 5158
207 Ga0501040_0197288 3300049576 Bacteria 1429
208 Ga0501041_0007197 3300049577 Bacteria 6530
209 Ga0501041_0016329 3300049577 Bacteria 4414
210 Ga0501042_0012858 3300049578 Bacteria 5684
211 Ga0501042_0074986 3300049578 Bacteria 2420
212 Ga0501042_0402982 3300049578 Bacteria 991
213 Ga0501042_1439668 3300049578 Bacteria 503
214 Ga0501043_0082560 3300049579 Bacteria 2526
215 Ga0501046_0132910 3300049580 Bacteria 1886
216 Ga0501046_0223966 3300049580 Bacteria 1391
217 Ga0501048_0011086 3300049582 Bacteria 6720
218 Ga0501048_0028410 3300049582 Bacteria 4059
219 Ga0501067_0159146 3300049583 Bacteria 1258
220 Ga0501067_0200701 3300049583 Bacteria 1111
221 Ga0501067_0348346 3300049583 Bacteria 826
222 Ga0501068_0197395 3300049584 Bacteria 1276
223 Ga0501069_0701068 3300049585 Bacteria 611
224 Ga0501071_0013824 3300049587 Bacteria 5509
225 Ga0501071_0068492 3300049587 Bacteria 2582
226 Ga0501071_0346799 3300049587 Bacteria 1130
227 Ga0501072_0008099 3300049588 Bacteria 7976
228 Ga0501072_0015735 3300049588 Bacteria 5798
229 Ga0501073_0601358 3300049589 Bacteria 759
230 Ga0501074_0025723 3300049590 Bacteria 4271
231 Ga0501075_0000816 3300049591 Bacteria 19523
232 Ga0501075_0004866 3300049591 Bacteria 9150
233 Ga0501076_0002789 3300049592 Bacteria 12092
234 Ga0501076_0054084 3300049592 Bacteria 3181
235 Ga0501076_0400972 3300049592 Bacteria 1128
236 Ga0501077_0032894 3300049593 Bacteria 3302
237 Ga0501079_0033721 3300049741 Bacteria 3939
238 Ga0501079_0052842 3300049741 Bacteria 3135
239 Ga0501080_0024628 3300049742 Bacteria 5581
240 Ga0501080_0129224 3300049742 Bacteria 2339
241 Ga0501081_0584201 3300049743 Bacteria 836
242 Ga0501035_0051905 3300049822 Bacteria 3670
243 Ga0501035_0072998 3300049822 Bacteria 3036
244 Ga0501045_0024657 3300049824 Bacteria 4319
245 Ga0501045_0108106 3300049824 Bacteria 2061
246 Ga0501045_0207912 3300049824 Bacteria 1458
247 Ga0501045_0265264 3300049824 Bacteria 1279
248 Ga0495619_0194308 3300053085 Bacteria 1405
249 Ga0501084_0047729 3300054114 Bacteria 3586
250 Ga0501082_0016788 3300060353 Bacteria 6305
251 Ga0501082_0087409 3300060353 Bacteria 2689
252 Ga0501082_0473425 3300060353 Bacteria 1095
253 Ga0466962_0217592 3300061719 Bacteria 935
254 Ga0530510_0005213 3300061734 Bacteria 8970
255 Ga0530510_0187149 3300061734 Bacteria 1536
256 Ga0530510_1141563 3300061734 Bacteria 597
257 2731906513 2731639228 Bacteria 4187555
258 2799185233 2799112218 Bacteria 4315149
259 2808873412 2808606365 Bacteria 4301966
260 2819426790 2818991318 Bacteria 5266538
261 2857479739 2857479173 Bacteria 2469263
262 2857634763 2857632687 Bacteria 2448521
263 2870802768 2870801768 Bacteria 2710986
264 2870804842 2870804320 Bacteria 2552467
265 2919449688 2919446982 Bacteria 3994487
266 2920882027 2920879853 Bacteria 4216831
267 2946026187 2946024296 Bacteria 3508095
268 8004023201 8004021418 Bacteria 4313954
269 8004029352 8004025490 Bacteria 4327753
270 Ga0496100_0940672
271 JGI24739J22299_10139306
272 JGI24735J21928_10098508
273 Ga0070680_100762772
274 Ga0070709_10258575
275 Ga0070711_100229608
276 Ga0070711_100526315
277 Ga0070705_100006026
278 Ga0068867_100213754
279 Ga0068854_100225299
280 Ga0068864_100988525
281 Ga0068866_10007443
282 Ga0081540_1029579
283 Ga0075431_100056425
284 Ga0105240_12148038
285 Ga0105245_11733463
286 Ga0105247_10895087
287 Ga0105243_10072897
288 Ga0105242_10265303
289 Ga0105238_10032248
290 Ga0105249_10033625
291 Ga0157371_10216161
292 Ga0157370_10026489
293 Ga0157369_10555580
294 Ga0157369_11243474
295 Ga0157369_11583733
296 Ga0157378_10761721
297 Ga0163162_10075135
298 Ga0157375_10023351
299 Ga0157380_11271091
300 Ga0157380_12497947
301 Ga0157379_10981962
302 Ga0207642_10358604
303 Ga0207663_10148622
304 Ga0207663_11034647
305 Ga0207660_11094830
306 Ga0207659_10164946
307 Ga0207709_10117584
308 Ga0207709_10225546
309 Ga0207669_10333127
310 Ga0207691_10121178
311 Ga0207712_10083324
312 Ga0207668_10237859
313 Ga0207702_10038013
314 Ga0207648_10250200
315 Ga0207674_10796480
316 Ga0207675_100647422
317 Ga0207683_10325918
318 Ga0307515_10450194
319 Ga0265327_10005465
320 Ga0265327_10049256
321 Ga0265327_10109867
322 Ga0307408_100928151
323 Ga0316579_10026904
324 Ga0316579_10173354
325 Ga0316579_10492068
326 Ga0265314_10229845
327 Ga0316576_10177821
328 Ga0316576_10261134
329 Ga0316576_10274620
330 Ga0316578_10227105
331 Ga0316578_10293271
332 Ga0307405_10096382
333 Ga0316577_10000602
334 Ga0316577_10086125
335 Ga0316577_10121614
336 Ga0307413_10482944
337 Ga0307410_10006536
338 Ga0307410_10408909
339 Ga0307406_10207928
340 Ga0307407_10025989
341 Ga0307409_100044515
342 Ga0307409_100125421
343 Ga0307409_100545459
344 Ga0307416_100036871
345 Ga0307416_100158162
346 Ga0307416_100244807
347 Ga0307416_101530528
348 Ga0307414_10149822
349 Ga0307415_100213921
350 Ga0316583_10020605
351 Ga0316583_10086151
352 Ga0316585_10012328
353 Ga0316580_10061115
354 Ga0373951_0004401
355 Ga0316582_0003086
356 Ga0316582_0038606
357 Ga0316582_0081465
358 Ga0316582_0119612
359 Ga0316584_0031287
360 Ga0316584_0056328
361 Ga0316584_0066170
362 Ga0316584_0493284
363 Ga0316584_0512618
364 Ga0395899_0017442
365 Ga0395900_0318894
366 Ga0395898_0006373
367 Ga0395905_0000599
368 Ga0395905_0766890
369 Ga0395901_0008991
370 Ga0395901_0027176
371 Ga0395901_0451169
372 Ga0400488_28019
373 Ga0400486_08631
374 Ga0400487_65088
375 Ga0436365_0751132
376 Ga0451843_1294647
377 Ga0451577_0210057
378 Ga0453683_0031532
379 Ga0453683_0037842
380 Ga0466966_0163825
381 Ga0466966_0193768
382 Ga0466966_0208584
383 Ga0466963_0397477
384 Ga0453684_0012048
385 Ga0453684_0030725
386 Ga0453684_0404377
387 Ga0453684_0432745
388 Ga0466971_0048136
389 Ga0466970_0085810
390 Ga0466970_0378371
391 Ga0466957_0924249
392 Ga0466960_0093446
393 Ga0466960_0352736
394 Ga0466960_0647056
395 Ga0466959_0391443
396 Ga0451576_0005011
397 Ga0451576_0040882
398 Ga0466967_0026269
399 Ga0466967_0081144
400 Ga0466967_0491124
401 Ga0466967_2111838
402 Ga0495641_0429306
403 Ga0495653_0014310
404 Ga0495582_0904203
405 Ga0495594_0823554
406 Ga0495608_0042322
407 Ga0495628_0287434
408 Ga0495630_0632819
409 Ga0495665_0217227
410 Ga0495665_0399974
411 Ga0495640_0236541
412 Ga0495667_0048705
413 Ga0495634_0428162
414 Ga0495658_0039496
415 Ga0495658_0609712
416 Ga0495613_0174005
417 Ga0495613_0178430
418 Ga0495600_0280516
419 Ga0495674_0326927
420 Ga0495676_0303546
421 Ga0495676_0322910
422 Ga0495676_0654214
423 Ga0495684_0095459
424 Ga0495602_0198345
425 Ga0496100_0013406
426 Ga0496100_0078017
427 Ga0496100_0362635
428 Ga0496100_0656281
429 Ga0496100_0726583
430 Ga0496101_0425363
431 Ga0496101_0721466
432 Ga0496101_0739361
433 Ga0496102_0024562
434 Ga0496102_0099798
435 Ga0496103_0051222
436 Ga0496103_0377250
437 Ga0496104_0020774
438 Ga0496104_0215825
439 Ga0496104_1331544
440 Ga0496105_0022989
441 Ga0496105_0103077
442 Ga0496105_0568611
443 Ga0496106_1359160
444 Ga0496107_0460877
445 Ga0496108_0162305
446 Ga0496108_0465321
447 Ga0496109_0495639
448 Ga0496109_0764611
449 Ga0496110_0342924
450 Ga0496110_0571957
451 Ga0496110_0918738
452 Ga0496111_0003325
453 Ga0496111_0069856
454 Ga0496111_0559376
455 Ga0496114_0058580
456 Ga0496114_0175230
457 Ga0496114_0194916
458 Ga0496114_0317445
459 Ga0496115_0207911
460 Ga0496115_0209711
461 Ga0496115_0767489
462 Ga0501031_0006015
463 Ga0501031_0031674
464 Ga0501032_0118919
465 Ga0501032_0150594
466 Ga0501036_0003829
467 Ga0501036_0102297
468 Ga0501037_0138676
469 Ga0501038_0061110
470 Ga0501038_0072061
471 Ga0501039_0017043
472 Ga0501039_0139346
473 Ga0501039_1307000
474 Ga0501040_0006153
475 Ga0501040_0014731
476 Ga0501040_0197288
477 Ga0501041_0007197
478 Ga0501041_0016329
479 Ga0501042_0012858
480 Ga0501042_0074986
481 Ga0501042_0402982
482 Ga0501042_1439668
483 Ga0501043_0082560
484 Ga0501046_0132910
485 Ga0501046_0223966
486 Ga0501048_0011086
487 Ga0501048_0028410
488 Ga0501067_0159146
489 Ga0501067_0200701
490 Ga0501067_0348346
491 Ga0501068_0197395
492 Ga0501069_0701068
493 Ga0501071_0013824
494 Ga0501071_0068492
495 Ga0501071_0346799
496 Ga0501072_0008099
497 Ga0501072_0015735
498 Ga0501073_0601358
499 Ga0501074_0025723
500 Ga0501075_0000816
501 Ga0501075_0004866
502 Ga0501076_0002789
503 Ga0501076_0054084
504 Ga0501076_0400972
505 Ga0501077_0032894
506 Ga0501079_0033721
507 Ga0501079_0052842
508 Ga0501080_0024628
509 Ga0501080_0129224
510 Ga0501081_0584201
511 Ga0501035_0051905
512 Ga0501035_0072998
513 Ga0501045_0024657
514 Ga0501045_0108106
515 Ga0501045_0207912
516 Ga0501045_0265264
517 Ga0495619_0194308
518 Ga0501084_0047729
519 Ga0501082_0016788
520 Ga0501082_0087409
521 Ga0501082_0473425
522 Ga0466962_0217592
523 Ga0530510_0005213
524 Ga0530510_0187149
525 Ga0530510_1141563
526 2731906513
527 2799185233
528 2808873412
529 2819426790
530 2857479739
531 2857634763
532 2870802768
533 2870804842
534 2919449688
535 2920882027
536 2946026187
537 8004023201
538 8004029352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

16

149

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9709 7 162
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9697 7 162
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.9682 7 161
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9662 7 161
7yyb-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 15 0.9656 7 162
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9662 7 161 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9596 7 161 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9469 7 161 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.938 6 159 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9338 1 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1C4ZIG2-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9781 7 161 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A851HKX1-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9773 7 157 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A1F9KBP4-F1-model_v4 deleted 0.9768 7 164
AF-A0A846YQB0-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9767 7 163 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0L6CPE2-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9765 18 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map