F376404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 183 | 538 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0233370|Ga0466961_0233370_142_933 |
| Length | 263 |
| Sequence | MGTVPAAAAALAMLRLLGQQAGPIPAAVLVRELALPRSTVYHLLATMVDEGFVTHLPEDRRYALGIAAYELGTGYSRQAPLQRLARVPLAELVDRTGHTAHLAVQHGREVVYVIEERARGRPPLVTDVGVRLPAQLTASGRALLAALPATQVRALFPDPSTFVLRTEHGPRSLSALRTLLVEVRRRGGIAVEDGEITPGWASIAAAVLDHSGHPVAAVAATFPATETDDAQREQVGGAVTRTAATLTRRIGGNPAQLARMRSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 20 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 22 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 26 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 27 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 68 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 69 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 70 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 71 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 72 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 73 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 74 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 77 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 78 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 79 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 80 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 81 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 82 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 83 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 84 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 85 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 86 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 87 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 88 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 89 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 90 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 91 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 92 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 93 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 94 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 95 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 96 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 99 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 100 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 101 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 102 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 118 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 119 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 120 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 121 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 122 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 123 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 124 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 125 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 126 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 127 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 128 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 129 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 130 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 131 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 132 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 133 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 134 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 144 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 145 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 153 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 154 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 155 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 156 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 157 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 158 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 159 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 160 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 161 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 162 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 163 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 164 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 165 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 166 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 167 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 168 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 169 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 170 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 171 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 172 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 173 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 174 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 175 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 176 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 177 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 178 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 179 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 180 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 181 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 182 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 183 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.85 |
| Metatranscriptomes | 0.37 |
| Isolates | 10.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.35 |
| Nodule | 0 |
| Rhizoplane | 9.67 |
| Rhizosphere | 73.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466961_0233370 | 3300044693 | Bacteria | 1132 |
| 2 | rootH2_10042129 | 3300003320 | Bacteria | 4806 |
| 3 | rootH1_10088026 | 3300003323 | Bacteria | 1491 |
| 4 | rootH1_10265299 | 3300003323 | Bacteria | 1413 |
| 5 | Ga0070658_10204756 | 3300005327 | Bacteria | 1666 |
| 6 | Ga0070658_10559520 | 3300005327 | Bacteria | 990 |
| 7 | Ga0070682_100274125 | 3300005337 | Bacteria | 1227 |
| 8 | Ga0070682_100283886 | 3300005337 | Bacteria | 1208 |
| 9 | Ga0070660_100220443 | 3300005339 | Bacteria | 1542 |
| 10 | Ga0070689_100136967 | 3300005340 | Bacteria | 1966 |
| 11 | Ga0070709_10295104 | 3300005434 | Bacteria | 1182 |
| 12 | Ga0070714_100425780 | 3300005435 | Bacteria | 1258 |
| 13 | Ga0070714_100729627 | 3300005435 | Bacteria | 957 |
| 14 | Ga0070700_100032195 | 3300005441 | Bacteria | 3149 |
| 15 | Ga0070662_100089202 | 3300005457 | Bacteria | 2313 |
| 16 | Ga0070681_10004827 | 3300005458 | Bacteria | 12921 |
| 17 | Ga0070681_10305901 | 3300005458 | Bacteria | 1499 |
| 18 | Ga0070707_100040769 | 3300005468 | Bacteria | 4443 |
| 19 | Ga0070679_100209889 | 3300005530 | Bacteria | 1911 |
| 20 | Ga0070696_100008849 | 3300005546 | Bacteria | 6733 |
| 21 | Ga0070665_100156847 | 3300005548 | Bacteria | 2278 |
| 22 | Ga0068855_100011718 | 3300005563 | Bacteria | 10596 |
| 23 | Ga0068855_100270500 | 3300005563 | Bacteria | 1889 |
| 24 | Ga0068864_100312029 | 3300005618 | Bacteria | 1474 |
| 25 | Ga0068866_10080820 | 3300005718 | Bacteria | 1744 |
| 26 | Ga0081455_10004007 | 3300005937 | Bacteria | 16710 |
| 27 | Ga0081455_10046257 | 3300005937 | Bacteria | 3777 |
| 28 | Ga0075364_10007741 | 3300006051 | Bacteria | 6397 |
| 29 | Ga0075364_10019801 | 3300006051 | Bacteria | 4228 |
| 30 | Ga0075364_10115550 | 3300006051 | Bacteria | 1794 |
| 31 | Ga0070715_10057825 | 3300006163 | Bacteria | 1691 |
| 32 | Ga0070716_100010646 | 3300006173 | Bacteria | 4616 |
| 33 | Ga0070712_100104564 | 3300006175 | Bacteria | 2101 |
| 34 | Ga0075430_100031732 | 3300006846 | Bacteria | 4483 |
| 35 | Ga0075431_100003397 | 3300006847 | Bacteria | 15429 |
| 36 | Ga0075431_100006711 | 3300006847 | Bacteria | 11430 |
| 37 | Ga0075429_100000465 | 3300006880 | Bacteria | 30271 |
| 38 | Ga0105240_10060567 | 3300009093 | Bacteria | 4719 |
| 39 | Ga0111539_10041264 | 3300009094 | Bacteria | 5549 |
| 40 | Ga0111539_10081541 | 3300009094 | Bacteria | 3805 |
| 41 | Ga0105245_10124741 | 3300009098 | Bacteria | 2409 |
| 42 | Ga0105247_10047880 | 3300009101 | Bacteria | 2626 |
| 43 | Ga0114129_10036509 | 3300009147 | Bacteria | 6938 |
| 44 | Ga0105243_10044565 | 3300009148 | Bacteria | 3481 |
| 45 | Ga0105241_10532246 | 3300009174 | Bacteria | 1052 |
| 46 | Ga0105242_10734992 | 3300009176 | Bacteria | 970 |
| 47 | Ga0105248_10410664 | 3300009177 | Bacteria | 1524 |
| 48 | Ga0105237_10103218 | 3300009545 | Bacteria | 2843 |
| 49 | Ga0105238_10485537 | 3300009551 | Bacteria | 1235 |
| 50 | Ga0105239_10252521 | 3300010375 | Bacteria | 1981 |
| 51 | Ga0105239_10633814 | 3300010375 | Bacteria | 1220 |
| 52 | Ga0157371_10122847 | 3300013102 | Bacteria | 1846 |
| 53 | Ga0157370_10069332 | 3300013104 | Bacteria | 3331 |
| 54 | Ga0157369_10049346 | 3300013105 | Bacteria | 4564 |
| 55 | Ga0157369_10185286 | 3300013105 | Bacteria | 2189 |
| 56 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 57 | Ga0157374_10581079 | 3300013296 | Bacteria | 1129 |
| 58 | Ga0163162_10039734 | 3300013306 | Bacteria | 4703 |
| 59 | Ga0157375_10962300 | 3300013308 | Bacteria | 995 |
| 60 | Ga0163163_10268409 | 3300014325 | Bacteria | 1757 |
| 61 | Ga0206353_10118850 | 3300020082 | Bacteria | 4719 |
| 62 | Ga0207688_10035686 | 3300025901 | Bacteria | 2755 |
| 63 | Ga0207647_10027490 | 3300025904 | Bacteria | 3708 |
| 64 | Ga0207647_10149526 | 3300025904 | Bacteria | 1365 |
| 65 | Ga0207699_10069448 | 3300025906 | Bacteria | 2148 |
| 66 | Ga0207645_10043309 | 3300025907 | Bacteria | 2881 |
| 67 | Ga0207643_10092981 | 3300025908 | Bacteria | 1760 |
| 68 | Ga0207705_10022256 | 3300025909 | Bacteria | 4521 |
| 69 | Ga0207705_10078801 | 3300025909 | Bacteria | 2398 |
| 70 | Ga0207707_10401808 | 3300025912 | Bacteria | 1176 |
| 71 | Ga0207671_10047565 | 3300025914 | Bacteria | 3175 |
| 72 | Ga0207663_10152874 | 3300025916 | Bacteria | 1621 |
| 73 | Ga0207660_10218960 | 3300025917 | Bacteria | 1493 |
| 74 | Ga0207657_10418285 | 3300025919 | Bacteria | 1054 |
| 75 | Ga0207652_10210059 | 3300025921 | Bacteria | 1752 |
| 76 | Ga0207709_10040398 | 3300025935 | Bacteria | 2793 |
| 77 | Ga0207665_10009507 | 3300025939 | Bacteria | 6385 |
| 78 | Ga0207665_10146927 | 3300025939 | Bacteria | 1685 |
| 79 | Ga0207667_10027884 | 3300025949 | Bacteria | 6139 |
| 80 | Ga0207667_10140069 | 3300025949 | Bacteria | 2491 |
| 81 | Ga0207703_10049033 | 3300026035 | Bacteria | 3412 |
| 82 | Ga0207708_10024267 | 3300026075 | Bacteria | 4586 |
| 83 | Ga0207698_10335971 | 3300026142 | Bacteria | 1421 |
| 84 | Ga0207428_10013004 | 3300027907 | Bacteria | 7290 |
| 85 | Ga0265340_10000078 | 3300031247 | Bacteria | 46872 |
| 86 | Ga0307513_10000476 | 3300031456 | Bacteria | 57781 |
| 87 | Ga0307513_10033449 | 3300031456 | Bacteria | 5779 |
| 88 | Ga0307408_100025323 | 3300031548 | Bacteria | 4063 |
| 89 | Ga0307413_10291220 | 3300031824 | Bacteria | 1233 |
| 90 | Ga0307413_10456476 | 3300031824 | Bacteria | 1016 |
| 91 | Ga0307410_10077818 | 3300031852 | Bacteria | 2320 |
| 92 | Ga0307410_10436429 | 3300031852 | Bacteria | 1065 |
| 93 | Ga0307406_10004445 | 3300031901 | Bacteria | 7630 |
| 94 | Ga0307406_10416523 | 3300031901 | Bacteria | 1069 |
| 95 | Ga0307406_10473035 | 3300031901 | Bacteria | 1010 |
| 96 | Ga0307407_10007126 | 3300031903 | Bacteria | 5039 |
| 97 | Ga0307407_10103744 | 3300031903 | Bacteria | 1770 |
| 98 | Ga0307407_10119260 | 3300031903 | Bacteria | 1670 |
| 99 | Ga0307407_10250613 | 3300031903 | Bacteria | 1213 |
| 100 | Ga0307407_10282731 | 3300031903 | Bacteria | 1150 |
| 101 | Ga0307412_10106246 | 3300031911 | Bacteria | 1996 |
| 102 | Ga0307409_100073852 | 3300031995 | Bacteria | 2722 |
| 103 | Ga0307409_100305347 | 3300031995 | Bacteria | 1482 |
| 104 | Ga0307409_100324433 | 3300031995 | Bacteria | 1442 |
| 105 | Ga0307409_100519032 | 3300031995 | Bacteria | 1163 |
| 106 | Ga0307416_100129130 | 3300032002 | Bacteria | 2271 |
| 107 | Ga0307416_100438920 | 3300032002 | Bacteria | 1355 |
| 108 | Ga0307414_10124677 | 3300032004 | Bacteria | 1988 |
| 109 | Ga0307414_10275806 | 3300032004 | Bacteria | 1411 |
| 110 | Ga0307414_10287726 | 3300032004 | Bacteria | 1384 |
| 111 | Ga0307414_10377429 | 3300032004 | Bacteria | 1225 |
| 112 | Ga0307415_100267656 | 3300032126 | Bacteria | 1398 |
| 113 | Ga0373924_0068570 | 3300035410 | Bacteria | 1493 |
| 114 | Ga0373927_0211860 | 3300035695 | Bacteria | 1273 |
| 115 | Ga0373933_0015476 | 3300035724 | Bacteria | 4252 |
| 116 | Ga0395898_0018032 | 3300037466 | Bacteria | 7202 |
| 117 | Ga0395898_0279680 | 3300037466 | Bacteria | 1592 |
| 118 | Ga0395898_0337691 | 3300037466 | Bacteria | 1437 |
| 119 | Ga0395901_0002360 | 3300038443 | Bacteria | 19201 |
| 120 | Ga0395901_0389348 | 3300038443 | Bacteria | 1433 |
| 121 | Ga0395901_0449635 | 3300038443 | Bacteria | 1318 |
| 122 | Ga0436365_0901555 | 3300039437 | Bacteria | 1410 |
| 123 | Ga0451791_1926016 | 3300041451 | Bacteria | 1501 |
| 124 | Ga0451795_0844083 | 3300041456 | Bacteria | 1873 |
| 125 | Ga0451841_0823690 | 3300041498 | Bacteria | 1495 |
| 126 | Ga0451853_0235978 | 3300041512 | Bacteria | 1714 |
| 127 | Ga0466969_0080638 | 3300044656 | Bacteria | 1554 |
| 128 | Ga0466965_0002892 | 3300044683 | Bacteria | 7415 |
| 129 | Ga0466965_0065115 | 3300044683 | Bacteria | 1826 |
| 130 | Ga0466965_0150385 | 3300044683 | Bacteria | 1217 |
| 131 | Ga0466966_0143422 | 3300044684 | Bacteria | 1459 |
| 132 | Ga0466961_0058590 | 3300044693 | Bacteria | 2450 |
| 133 | Ga0466961_0178695 | 3300044693 | Bacteria | 1318 |
| 134 | Ga0466963_0029596 | 3300044694 | Bacteria | 3527 |
| 135 | Ga0466963_0125352 | 3300044694 | Bacteria | 1770 |
| 136 | Ga0466963_0214866 | 3300044694 | Bacteria | 1346 |
| 137 | Ga0466963_0220587 | 3300044694 | Bacteria | 1328 |
| 138 | Ga0466963_0229336 | 3300044694 | Bacteria | 1301 |
| 139 | Ga0466963_0374886 | 3300044694 | Bacteria | 1003 |
| 140 | Ga0466964_0264165 | 3300044706 | Bacteria | 854 |
| 141 | Ga0466968_0007585 | 3300044735 | Bacteria | 4130 |
| 142 | Ga0466970_0000149 | 3300044765 | Bacteria | 32553 |
| 143 | Ga0466970_0012905 | 3300044765 | Bacteria | 4278 |
| 144 | Ga0466970_0028197 | 3300044765 | Bacteria | 2949 |
| 145 | Ga0466957_0076371 | 3300044842 | Bacteria | 2080 |
| 146 | Ga0466957_0106427 | 3300044842 | Bacteria | 1774 |
| 147 | Ga0466960_0000526 | 3300044901 | Bacteria | 13127 |
| 148 | Ga0466960_0010883 | 3300044901 | Bacteria | 3789 |
| 149 | Ga0466960_0177387 | 3300044901 | Bacteria | 1153 |
| 150 | Ga0466959_0074470 | 3300045049 | Bacteria | 2455 |
| 151 | Ga0466959_0096265 | 3300045049 | Bacteria | 2122 |
| 152 | Ga0466959_0121542 | 3300045049 | Bacteria | 1856 |
| 153 | Ga0466959_0213617 | 3300045049 | Bacteria | 1340 |
| 154 | Ga0466959_0388155 | 3300045049 | Bacteria | 950 |
| 155 | Ga0466958_0072752 | 3300045836 | Bacteria | 2105 |
| 156 | Ga0466958_0080660 | 3300045836 | Bacteria | 2002 |
| 157 | Ga0466967_0000029 | 3300045976 | Bacteria | 56648 |
| 158 | Ga0466967_0013581 | 3300045976 | Bacteria | 6300 |
| 159 | Ga0466967_0049573 | 3300045976 | Bacteria | 3672 |
| 160 | Ga0466967_0051797 | 3300045976 | Bacteria | 3600 |
| 161 | Ga0466967_0064837 | 3300045976 | Bacteria | 3250 |
| 162 | Ga0466967_0070897 | 3300045976 | Bacteria | 3119 |
| 163 | Ga0466967_0112348 | 3300045976 | Bacteria | 2505 |
| 164 | Ga0466967_0214160 | 3300045976 | Bacteria | 1828 |
| 165 | Ga0466967_0377737 | 3300045976 | Bacteria | 1375 |
| 166 | Ga0495638_0264664 | 3300046460 | Bacteria | 941 |
| 167 | Ga0495651_0264640 | 3300046462 | Bacteria | 1168 |
| 168 | Ga0495653_0122143 | 3300046463 | Bacteria | 1854 |
| 169 | Ga0495618_0074558 | 3300046514 | Bacteria | 2161 |
| 170 | Ga0495628_0157313 | 3300046516 | Bacteria | 1728 |
| 171 | Ga0495652_0192612 | 3300046529 | Bacteria | 1554 |
| 172 | Ga0495587_0013998 | 3300046536 | Bacteria | 5037 |
| 173 | Ga0495645_0031450 | 3300046543 | Bacteria | 3868 |
| 174 | Ga0495645_0037697 | 3300046543 | Bacteria | 3525 |
| 175 | Ga0495667_0086050 | 3300046559 | Bacteria | 2039 |
| 176 | Ga0495634_0101971 | 3300046642 | Bacteria | 1853 |
| 177 | Ga0495657_0088826 | 3300046675 | Bacteria | 1986 |
| 178 | Ga0495613_0312303 | 3300046689 | Bacteria | 1086 |
| 179 | Ga0495680_0230905 | 3300047322 | Bacteria | 1317 |
| 180 | Ga0495602_0138452 | 3300048088 | Bacteria | 1930 |
| 181 | Ga0496101_0023397 | 3300048904 | Bacteria | 4267 |
| 182 | Ga0496101_0308632 | 3300048904 | Bacteria | 1240 |
| 183 | Ga0496102_0085145 | 3300048905 | Bacteria | 2918 |
| 184 | Ga0496102_0422039 | 3300048905 | Unclassified | 1253 |
| 185 | Ga0496103_0012127 | 3300048906 | Bacteria | 5120 |
| 186 | Ga0496104_0012236 | 3300048907 | Bacteria | 7712 |
| 187 | Ga0496104_0024630 | 3300048907 | Bacteria | 5536 |
| 188 | Ga0496105_0093768 | 3300048908 | Bacteria | 2479 |
| 189 | Ga0496105_0109344 | 3300048908 | Bacteria | 2282 |
| 190 | Ga0496105_0255549 | 3300048908 | Bacteria | 1418 |
| 191 | Ga0496106_0114083 | 3300048909 | Bacteria | 2107 |
| 192 | Ga0496107_0006293 | 3300048910 | Bacteria | 8159 |
| 193 | Ga0496110_0108042 | 3300048913 | Bacteria | 2498 |
| 194 | Ga0496110_0282656 | 3300048913 | Bacteria | 1511 |
| 195 | Ga0496111_0051944 | 3300048914 | Bacteria | 2960 |
| 196 | Ga0496112_0610181 | 3300048915 | Bacteria | 1023 |
| 197 | Ga0496113_0019095 | 3300048916 | Bacteria | 4789 |
| 198 | Ga0496113_0083089 | 3300048916 | Bacteria | 2457 |
| 199 | Ga0496114_0048513 | 3300048917 | Bacteria | 3532 |
| 200 | Ga0496114_0050340 | 3300048917 | Bacteria | 3467 |
| 201 | Ga0496114_0074882 | 3300048917 | Bacteria | 2850 |
| 202 | Ga0496114_0185800 | 3300048917 | Bacteria | 1816 |
| 203 | Ga0496114_0220966 | 3300048917 | Bacteria | 1663 |
| 204 | Ga0496115_0048130 | 3300048918 | Bacteria | 3410 |
| 205 | Ga0496117_0111717 | 3300048920 | Bacteria | 1701 |
| 206 | Ga0496119_0002757 | 3300048922 | Bacteria | 18904 |
| 207 | Ga0496119_0246839 | 3300048922 | Bacteria | 902 |
| 208 | Ga0496120_0096122 | 3300048923 | Bacteria | 1574 |
| 209 | Ga0496125_0001688 | 3300048928 | Bacteria | 30874 |
| 210 | Ga0496126_0016617 | 3300048929 | Bacteria | 7355 |
| 211 | Ga0496126_0125755 | 3300048929 | Bacteria | 2219 |
| 212 | Ga0501031_0410770 | 3300049568 | Bacteria | 875 |
| 213 | Ga0501034_0007246 | 3300049571 | Bacteria | 11837 |
| 214 | Ga0501034_0266355 | 3300049571 | Bacteria | 1655 |
| 215 | Ga0501036_0308695 | 3300049572 | Bacteria | 1323 |
| 216 | Ga0501036_0750959 | 3300049572 | Bacteria | 805 |
| 217 | Ga0501038_0035984 | 3300049574 | Bacteria | 4345 |
| 218 | Ga0501038_0041696 | 3300049574 | Bacteria | 4002 |
| 219 | Ga0501039_0315595 | 3300049575 | Bacteria | 1229 |
| 220 | Ga0501039_0452046 | 3300049575 | Bacteria | 1009 |
| 221 | Ga0501040_0134403 | 3300049576 | Bacteria | 1740 |
| 222 | Ga0501042_0026557 | 3300049578 | Bacteria | 4068 |
| 223 | Ga0501070_0293071 | 3300049586 | Bacteria | 1326 |
| 224 | Ga0501081_0207555 | 3300049743 | Bacteria | 1422 |
| 225 | nmdc:mga00v17_31409_c1 | 3300050491 | Bacteria | 3132 |
| 226 | nmdc:mga00v17_6258_c1 | 3300050491 | Bacteria | 6309 |
| 227 | nmdc:mga0yw44_792_c1 | 3300050492 | Bacteria | 11766 |
| 228 | nmdc:mga05p37_157_c1 | 3300050507 | Bacteria | 65045 |
| 229 | nmdc:mga09592_79_c1 | 3300050508 | Bacteria | 56100 |
| 230 | nmdc:mga0qj67_11706_c1 | 3300050509 | Bacteria | 6583 |
| 231 | nmdc:mga06r32_122_c1 | 3300050510 | Bacteria | 55812 |
| 232 | nmdc:mga06r32_6768_c1 | 3300050510 | Bacteria | 10302 |
| 233 | nmdc:mga08y16_16969_c1 | 3300050511 | Bacteria | 7667 |
| 234 | Ga0495612_0155409 | 3300053078 | Bacteria | 997 |
| 235 | Ga0495595_0061209 | 3300053084 | Bacteria | 1763 |
| 236 | Ga0500556_0000380 | 3300053104 | Bacteria | 32387 |
| 237 | Ga0500616_0000116 | 3300053153 | Bacteria | 145790 |
| 238 | Ga0500616_0001061 | 3300053153 | Bacteria | 28911 |
| 239 | Ga0466962_0035369 | 3300061719 | Bacteria | 2391 |
| 240 | Ga0466962_0209952 | 3300061719 | Bacteria | 952 |
| 241 | 2643886154 | 2643221575 | Bacteria | 4022601 |
| 242 | 2643995308 | 2643221597 | Bacteria | 3347721 |
| 243 | 2644092854 | 2643221615 | Bacteria | 5487866 |
| 244 | 2644322467 | 2643221657 | Bacteria | 5490246 |
| 245 | 2644447435 | 2643221679 | Bacteria | 3839507 |
| 246 | 2731907629 | 2731639228 | Bacteria | 4187555 |
| 247 | 2774381848 | 2773857758 | Bacteria | 3592392 |
| 248 | 2774383931 | 2773857759 | Bacteria | 2963774 |
| 249 | 2774398832 | 2773857763 | Bacteria | 4180068 |
| 250 | 2808886173 | 2808606368 | Bacteria | 3174172 |
| 251 | 2809227928 | 2808606447 | Bacteria | 3572005 |
| 252 | 2821270608 | 2821268502 | Bacteria | 3750023 |
| 253 | 2833711569 | 2833709550 | Bacteria | 4008291 |
| 254 | 2852635717 | 2852632344 | Bacteria | 3463163 |
| 255 | 2852648914 | 2852646457 | Bacteria | 3408613 |
| 256 | 2852680491 | 2852677369 | Bacteria | 3768884 |
| 257 | 2866618966 | 2866612099 | Bacteria | 7543886 |
| 258 | 2904511417 | 2904509784 | Bacteria | 3520416 |
| 259 | 2908679857 | 2908678064 | Bacteria | 3482747 |
| 260 | 2919072872 | 2919069694 | Bacteria | 3622919 |
| 261 | 2919396255 | 2919395869 | Bacteria | 3704152 |
| 262 | 2946036813 | 2946033335 | Bacteria | 3835514 |
| 263 | 2974296795 | 2974294766 | Bacteria | 3767688 |
| 264 | 2974326969 | 2974324384 | Bacteria | 3750535 |
| 265 | 2977231989 | 2977228692 | Bacteria | 3450105 |
| 266 | 2977237348 | 2977236895 | Bacteria | 3569373 |
| 267 | 2977254541 | 2977251589 | Bacteria | 2952848 |
| 268 | 2977267315 | 2977264416 | Bacteria | 3750737 |
| 269 | 8045830625 | 8045830549 | Bacteria | 4444727 |
| 270 | Ga0466961_0233370 | |||
| 271 | rootH2_10042129 | |||
| 272 | rootH1_10088026 | |||
| 273 | rootH1_10265299 | |||
| 274 | Ga0070658_10204756 | |||
| 275 | Ga0070658_10559520 | |||
| 276 | Ga0070682_100274125 | |||
| 277 | Ga0070682_100283886 | |||
| 278 | Ga0070660_100220443 | |||
| 279 | Ga0070689_100136967 | |||
| 280 | Ga0070709_10295104 | |||
| 281 | Ga0070714_100425780 | |||
| 282 | Ga0070714_100729627 | |||
| 283 | Ga0070700_100032195 | |||
| 284 | Ga0070662_100089202 | |||
| 285 | Ga0070681_10004827 | |||
| 286 | Ga0070681_10305901 | |||
| 287 | Ga0070707_100040769 | |||
| 288 | Ga0070679_100209889 | |||
| 289 | Ga0070696_100008849 | |||
| 290 | Ga0070665_100156847 | |||
| 291 | Ga0068855_100011718 | |||
| 292 | Ga0068855_100270500 | |||
| 293 | Ga0068864_100312029 | |||
| 294 | Ga0068866_10080820 | |||
| 295 | Ga0081455_10004007 | |||
| 296 | Ga0081455_10046257 | |||
| 297 | Ga0075364_10007741 | |||
| 298 | Ga0075364_10019801 | |||
| 299 | Ga0075364_10115550 | |||
| 300 | Ga0070715_10057825 | |||
| 301 | Ga0070716_100010646 | |||
| 302 | Ga0070712_100104564 | |||
| 303 | Ga0075430_100031732 | |||
| 304 | Ga0075431_100003397 | |||
| 305 | Ga0075431_100006711 | |||
| 306 | Ga0075429_100000465 | |||
| 307 | Ga0105240_10060567 | |||
| 308 | Ga0111539_10041264 | |||
| 309 | Ga0111539_10081541 | |||
| 310 | Ga0105245_10124741 | |||
| 311 | Ga0105247_10047880 | |||
| 312 | Ga0114129_10036509 | |||
| 313 | Ga0105243_10044565 | |||
| 314 | Ga0105241_10532246 | |||
| 315 | Ga0105242_10734992 | |||
| 316 | Ga0105248_10410664 | |||
| 317 | Ga0105237_10103218 | |||
| 318 | Ga0105238_10485537 | |||
| 319 | Ga0105239_10252521 | |||
| 320 | Ga0105239_10633814 | |||
| 321 | Ga0157371_10122847 | |||
| 322 | Ga0157370_10069332 | |||
| 323 | Ga0157369_10049346 | |||
| 324 | Ga0157369_10185286 | |||
| 325 | Ga0171462_1004 | |||
| 326 | Ga0157374_10581079 | |||
| 327 | Ga0163162_10039734 | |||
| 328 | Ga0157375_10962300 | |||
| 329 | Ga0163163_10268409 | |||
| 330 | Ga0206353_10118850 | |||
| 331 | Ga0207688_10035686 | |||
| 332 | Ga0207647_10027490 | |||
| 333 | Ga0207647_10149526 | |||
| 334 | Ga0207699_10069448 | |||
| 335 | Ga0207645_10043309 | |||
| 336 | Ga0207643_10092981 | |||
| 337 | Ga0207705_10022256 | |||
| 338 | Ga0207705_10078801 | |||
| 339 | Ga0207707_10401808 | |||
| 340 | Ga0207671_10047565 | |||
| 341 | Ga0207663_10152874 | |||
| 342 | Ga0207660_10218960 | |||
| 343 | Ga0207657_10418285 | |||
| 344 | Ga0207652_10210059 | |||
| 345 | Ga0207709_10040398 | |||
| 346 | Ga0207665_10009507 | |||
| 347 | Ga0207665_10146927 | |||
| 348 | Ga0207667_10027884 | |||
| 349 | Ga0207667_10140069 | |||
| 350 | Ga0207703_10049033 | |||
| 351 | Ga0207708_10024267 | |||
| 352 | Ga0207698_10335971 | |||
| 353 | Ga0207428_10013004 | |||
| 354 | Ga0265340_10000078 | |||
| 355 | Ga0307513_10000476 | |||
| 356 | Ga0307513_10033449 | |||
| 357 | Ga0307408_100025323 | |||
| 358 | Ga0307413_10291220 | |||
| 359 | Ga0307413_10456476 | |||
| 360 | Ga0307410_10077818 | |||
| 361 | Ga0307410_10436429 | |||
| 362 | Ga0307406_10004445 | |||
| 363 | Ga0307406_10416523 | |||
| 364 | Ga0307406_10473035 | |||
| 365 | Ga0307407_10007126 | |||
| 366 | Ga0307407_10103744 | |||
| 367 | Ga0307407_10119260 | |||
| 368 | Ga0307407_10250613 | |||
| 369 | Ga0307407_10282731 | |||
| 370 | Ga0307412_10106246 | |||
| 371 | Ga0307409_100073852 | |||
| 372 | Ga0307409_100305347 | |||
| 373 | Ga0307409_100324433 | |||
| 374 | Ga0307409_100519032 | |||
| 375 | Ga0307416_100129130 | |||
| 376 | Ga0307416_100438920 | |||
| 377 | Ga0307414_10124677 | |||
| 378 | Ga0307414_10275806 | |||
| 379 | Ga0307414_10287726 | |||
| 380 | Ga0307414_10377429 | |||
| 381 | Ga0307415_100267656 | |||
| 382 | Ga0373924_0068570 | |||
| 383 | Ga0373927_0211860 | |||
| 384 | Ga0373933_0015476 | |||
| 385 | Ga0395898_0018032 | |||
| 386 | Ga0395898_0279680 | |||
| 387 | Ga0395898_0337691 | |||
| 388 | Ga0395901_0002360 | |||
| 389 | Ga0395901_0389348 | |||
| 390 | Ga0395901_0449635 | |||
| 391 | Ga0436365_0901555 | |||
| 392 | Ga0451791_1926016 | |||
| 393 | Ga0451795_0844083 | |||
| 394 | Ga0451841_0823690 | |||
| 395 | Ga0451853_0235978 | |||
| 396 | Ga0466969_0080638 | |||
| 397 | Ga0466965_0002892 | |||
| 398 | Ga0466965_0065115 | |||
| 399 | Ga0466965_0150385 | |||
| 400 | Ga0466966_0143422 | |||
| 401 | Ga0466961_0058590 | |||
| 402 | Ga0466961_0178695 | |||
| 403 | Ga0466963_0029596 | |||
| 404 | Ga0466963_0125352 | |||
| 405 | Ga0466963_0214866 | |||
| 406 | Ga0466963_0220587 | |||
| 407 | Ga0466963_0229336 | |||
| 408 | Ga0466963_0374886 | |||
| 409 | Ga0466964_0264165 | |||
| 410 | Ga0466968_0007585 | |||
| 411 | Ga0466970_0000149 | |||
| 412 | Ga0466970_0012905 | |||
| 413 | Ga0466970_0028197 | |||
| 414 | Ga0466957_0076371 | |||
| 415 | Ga0466957_0106427 | |||
| 416 | Ga0466960_0000526 | |||
| 417 | Ga0466960_0010883 | |||
| 418 | Ga0466960_0177387 | |||
| 419 | Ga0466959_0074470 | |||
| 420 | Ga0466959_0096265 | |||
| 421 | Ga0466959_0121542 | |||
| 422 | Ga0466959_0213617 | |||
| 423 | Ga0466959_0388155 | |||
| 424 | Ga0466958_0072752 | |||
| 425 | Ga0466958_0080660 | |||
| 426 | Ga0466967_0000029 | |||
| 427 | Ga0466967_0013581 | |||
| 428 | Ga0466967_0049573 | |||
| 429 | Ga0466967_0051797 | |||
| 430 | Ga0466967_0064837 | |||
| 431 | Ga0466967_0070897 | |||
| 432 | Ga0466967_0112348 | |||
| 433 | Ga0466967_0214160 | |||
| 434 | Ga0466967_0377737 | |||
| 435 | Ga0495638_0264664 | |||
| 436 | Ga0495651_0264640 | |||
| 437 | Ga0495653_0122143 | |||
| 438 | Ga0495618_0074558 | |||
| 439 | Ga0495628_0157313 | |||
| 440 | Ga0495652_0192612 | |||
| 441 | Ga0495587_0013998 | |||
| 442 | Ga0495645_0031450 | |||
| 443 | Ga0495645_0037697 | |||
| 444 | Ga0495667_0086050 | |||
| 445 | Ga0495634_0101971 | |||
| 446 | Ga0495657_0088826 | |||
| 447 | Ga0495613_0312303 | |||
| 448 | Ga0495680_0230905 | |||
| 449 | Ga0495602_0138452 | |||
| 450 | Ga0496101_0023397 | |||
| 451 | Ga0496101_0308632 | |||
| 452 | Ga0496102_0085145 | |||
| 453 | Ga0496102_0422039 | |||
| 454 | Ga0496103_0012127 | |||
| 455 | Ga0496104_0012236 | |||
| 456 | Ga0496104_0024630 | |||
| 457 | Ga0496105_0093768 | |||
| 458 | Ga0496105_0109344 | |||
| 459 | Ga0496105_0255549 | |||
| 460 | Ga0496106_0114083 | |||
| 461 | Ga0496107_0006293 | |||
| 462 | Ga0496110_0108042 | |||
| 463 | Ga0496110_0282656 | |||
| 464 | Ga0496111_0051944 | |||
| 465 | Ga0496112_0610181 | |||
| 466 | Ga0496113_0019095 | |||
| 467 | Ga0496113_0083089 | |||
| 468 | Ga0496114_0048513 | |||
| 469 | Ga0496114_0050340 | |||
| 470 | Ga0496114_0074882 | |||
| 471 | Ga0496114_0185800 | |||
| 472 | Ga0496114_0220966 | |||
| 473 | Ga0496115_0048130 | |||
| 474 | Ga0496117_0111717 | |||
| 475 | Ga0496119_0002757 | |||
| 476 | Ga0496119_0246839 | |||
| 477 | Ga0496120_0096122 | |||
| 478 | Ga0496125_0001688 | |||
| 479 | Ga0496126_0016617 | |||
| 480 | Ga0496126_0125755 | |||
| 481 | Ga0501031_0410770 | |||
| 482 | Ga0501034_0007246 | |||
| 483 | Ga0501034_0266355 | |||
| 484 | Ga0501036_0308695 | |||
| 485 | Ga0501036_0750959 | |||
| 486 | Ga0501038_0035984 | |||
| 487 | Ga0501038_0041696 | |||
| 488 | Ga0501039_0315595 | |||
| 489 | Ga0501039_0452046 | |||
| 490 | Ga0501040_0134403 | |||
| 491 | Ga0501042_0026557 | |||
| 492 | Ga0501070_0293071 | |||
| 493 | Ga0501081_0207555 | |||
| 494 | nmdc:mga00v17_31409_c1 | |||
| 495 | nmdc:mga00v17_6258_c1 | |||
| 496 | nmdc:mga0yw44_792_c1 | |||
| 497 | nmdc:mga05p37_157_c1 | |||
| 498 | nmdc:mga09592_79_c1 | |||
| 499 | nmdc:mga0qj67_11706_c1 | |||
| 500 | nmdc:mga06r32_122_c1 | |||
| 501 | nmdc:mga06r32_6768_c1 | |||
| 502 | nmdc:mga08y16_16969_c1 | |||
| 503 | Ga0495612_0155409 | |||
| 504 | Ga0495595_0061209 | |||
| 505 | Ga0500556_0000380 | |||
| 506 | Ga0500616_0000116 | |||
| 507 | Ga0500616_0001061 | |||
| 508 | Ga0466962_0035369 | |||
| 509 | Ga0466962_0209952 | |||
| 510 | 2643886154 | |||
| 511 | 2643995308 | |||
| 512 | 2644092854 | |||
| 513 | 2644322467 | |||
| 514 | 2644447435 | |||
| 515 | 2731907629 | |||
| 516 | 2774381848 | |||
| 517 | 2774383931 | |||
| 518 | 2774398832 | |||
| 519 | 2808886173 | |||
| 520 | 2809227928 | |||
| 521 | 2821270608 | |||
| 522 | 2833711569 | |||
| 523 | 2852635717 | |||
| 524 | 2852648914 | |||
| 525 | 2852680491 | |||
| 526 | 2866618966 | |||
| 527 | 2904511417 | |||
| 528 | 2908679857 | |||
| 529 | 2919072872 | |||
| 530 | 2919396255 | |||
| 531 | 2946036813 | |||
| 532 | 2974296795 | |||
| 533 | 2974326969 | |||
| 534 | 2977231989 | |||
| 535 | 2977237348 | |||
| 536 | 2977254541 | |||
| 537 | 2977267315 | |||
| 538 | 8045830625 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9566 | 43 | 98 |
| 7wqu-assembly1.cif.gz_B | feoc from klebsiella pneumoniae | 0.9487 | 43 | 98 |
| 4wcg-assembly1.cif.gz_B | the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna | 0.939 | 40 | 97 |
| 2heo-assembly1.cif.gz_D | general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. | 0.9389 | 43 | 98 |
| 4hob-assembly2.cif.gz_C | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9323 | 40 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5QM91_354_443_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9702 | 43 | 87 | 1.10.10.10 |
| af_P64638_1_78_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.962 | 43 | 89 | 1.10.10.10 |
| af_I6Y187_16_79_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9591 | 43 | 89 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9566 | 43 | 98 | 1.10.10.10 |
| 2xrnA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9542 | 40 | 98 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7QR65-F1-model_v4 | IclR family transcriptional regulator | 0.9641 | 165 | 279 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A6C7Z857-F1-model_v4 | deleted | 0.9337 | 122 | 255 |
|
| AF-A0A3D6BJA3-F1-model_v4 | IclR-ED domain-containing protein | 0.9256 | 111 | 278 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A2V9QTZ5-F1-model_v4 | IclR-ED domain-containing protein | 0.919 | 114 | 280 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A4U9WHM4-F1-model_v4 | Pectin degradation repressor protein kdgR | 0.9176 | 124 | 281 |
GO:0003677
GO:0003700 GO:0045892 |