F376404

General Info

Members Datasets Scaffolds Average Seq Length
269 183 538 258

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0233370|Ga0466961_0233370_142_933
Length 263
Sequence MGTVPAAAAALAMLRLLGQQAGPIPAAVLVRELALPRSTVYHLLATMVDEGFVTHLPEDRRYALGIAAYELGTGYSRQAPLQRLARVPLAELVDRTGHTAHLAVQHGREVVYVIEERARGRPPLVTDVGVRLPAQLTASGRALLAALPATQVRALFPDPSTFVLRTEHGPRSLSALRTLLVEVRRRGGIAVEDGEITPGWASIAAAVLDHSGHPVAAVAATFPATETDDAQREQVGGAVTRTAATLTRRIGGNPAQLARMRSS

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
87 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
88 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 2643221575 Microbacterium sp. Root61 Isolate Unclassified
156 2643221597 Microbacterium sp. Root180 Isolate Unclassified
157 2643221615 Nocardioides sp. Root224 Isolate Unclassified
158 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
159 2643221679 Angustibacter sp. Root456 Isolate Unclassified
160 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
161 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
162 2773857759 Microbacterium sp. 1294 Isolate Unclassified
163 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
164 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
165 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
166 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
167 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
168 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
169 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
170 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
171 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
172 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
173 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
174 2919069694 Microbacterium sp. 1154 Isolate Unclassified
175 2919395869 Microbacterium resistens 2980 Isolate Unclassified
176 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
177 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
178 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
179 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
180 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
181 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
182 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
183 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.85
Metatranscriptomes 0.37
Isolates 10.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 9.67
Rhizosphere 73.61
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0233370 3300044693 Bacteria 1132
2 rootH2_10042129 3300003320 Bacteria 4806
3 rootH1_10088026 3300003323 Bacteria 1491
4 rootH1_10265299 3300003323 Bacteria 1413
5 Ga0070658_10204756 3300005327 Bacteria 1666
6 Ga0070658_10559520 3300005327 Bacteria 990
7 Ga0070682_100274125 3300005337 Bacteria 1227
8 Ga0070682_100283886 3300005337 Bacteria 1208
9 Ga0070660_100220443 3300005339 Bacteria 1542
10 Ga0070689_100136967 3300005340 Bacteria 1966
11 Ga0070709_10295104 3300005434 Bacteria 1182
12 Ga0070714_100425780 3300005435 Bacteria 1258
13 Ga0070714_100729627 3300005435 Bacteria 957
14 Ga0070700_100032195 3300005441 Bacteria 3149
15 Ga0070662_100089202 3300005457 Bacteria 2313
16 Ga0070681_10004827 3300005458 Bacteria 12921
17 Ga0070681_10305901 3300005458 Bacteria 1499
18 Ga0070707_100040769 3300005468 Bacteria 4443
19 Ga0070679_100209889 3300005530 Bacteria 1911
20 Ga0070696_100008849 3300005546 Bacteria 6733
21 Ga0070665_100156847 3300005548 Bacteria 2278
22 Ga0068855_100011718 3300005563 Bacteria 10596
23 Ga0068855_100270500 3300005563 Bacteria 1889
24 Ga0068864_100312029 3300005618 Bacteria 1474
25 Ga0068866_10080820 3300005718 Bacteria 1744
26 Ga0081455_10004007 3300005937 Bacteria 16710
27 Ga0081455_10046257 3300005937 Bacteria 3777
28 Ga0075364_10007741 3300006051 Bacteria 6397
29 Ga0075364_10019801 3300006051 Bacteria 4228
30 Ga0075364_10115550 3300006051 Bacteria 1794
31 Ga0070715_10057825 3300006163 Bacteria 1691
32 Ga0070716_100010646 3300006173 Bacteria 4616
33 Ga0070712_100104564 3300006175 Bacteria 2101
34 Ga0075430_100031732 3300006846 Bacteria 4483
35 Ga0075431_100003397 3300006847 Bacteria 15429
36 Ga0075431_100006711 3300006847 Bacteria 11430
37 Ga0075429_100000465 3300006880 Bacteria 30271
38 Ga0105240_10060567 3300009093 Bacteria 4719
39 Ga0111539_10041264 3300009094 Bacteria 5549
40 Ga0111539_10081541 3300009094 Bacteria 3805
41 Ga0105245_10124741 3300009098 Bacteria 2409
42 Ga0105247_10047880 3300009101 Bacteria 2626
43 Ga0114129_10036509 3300009147 Bacteria 6938
44 Ga0105243_10044565 3300009148 Bacteria 3481
45 Ga0105241_10532246 3300009174 Bacteria 1052
46 Ga0105242_10734992 3300009176 Bacteria 970
47 Ga0105248_10410664 3300009177 Bacteria 1524
48 Ga0105237_10103218 3300009545 Bacteria 2843
49 Ga0105238_10485537 3300009551 Bacteria 1235
50 Ga0105239_10252521 3300010375 Bacteria 1981
51 Ga0105239_10633814 3300010375 Bacteria 1220
52 Ga0157371_10122847 3300013102 Bacteria 1846
53 Ga0157370_10069332 3300013104 Bacteria 3331
54 Ga0157369_10049346 3300013105 Bacteria 4564
55 Ga0157369_10185286 3300013105 Bacteria 2189
56 Ga0171462_1004 3300013250 Bacteria 678877
57 Ga0157374_10581079 3300013296 Bacteria 1129
58 Ga0163162_10039734 3300013306 Bacteria 4703
59 Ga0157375_10962300 3300013308 Bacteria 995
60 Ga0163163_10268409 3300014325 Bacteria 1757
61 Ga0206353_10118850 3300020082 Bacteria 4719
62 Ga0207688_10035686 3300025901 Bacteria 2755
63 Ga0207647_10027490 3300025904 Bacteria 3708
64 Ga0207647_10149526 3300025904 Bacteria 1365
65 Ga0207699_10069448 3300025906 Bacteria 2148
66 Ga0207645_10043309 3300025907 Bacteria 2881
67 Ga0207643_10092981 3300025908 Bacteria 1760
68 Ga0207705_10022256 3300025909 Bacteria 4521
69 Ga0207705_10078801 3300025909 Bacteria 2398
70 Ga0207707_10401808 3300025912 Bacteria 1176
71 Ga0207671_10047565 3300025914 Bacteria 3175
72 Ga0207663_10152874 3300025916 Bacteria 1621
73 Ga0207660_10218960 3300025917 Bacteria 1493
74 Ga0207657_10418285 3300025919 Bacteria 1054
75 Ga0207652_10210059 3300025921 Bacteria 1752
76 Ga0207709_10040398 3300025935 Bacteria 2793
77 Ga0207665_10009507 3300025939 Bacteria 6385
78 Ga0207665_10146927 3300025939 Bacteria 1685
79 Ga0207667_10027884 3300025949 Bacteria 6139
80 Ga0207667_10140069 3300025949 Bacteria 2491
81 Ga0207703_10049033 3300026035 Bacteria 3412
82 Ga0207708_10024267 3300026075 Bacteria 4586
83 Ga0207698_10335971 3300026142 Bacteria 1421
84 Ga0207428_10013004 3300027907 Bacteria 7290
85 Ga0265340_10000078 3300031247 Bacteria 46872
86 Ga0307513_10000476 3300031456 Bacteria 57781
87 Ga0307513_10033449 3300031456 Bacteria 5779
88 Ga0307408_100025323 3300031548 Bacteria 4063
89 Ga0307413_10291220 3300031824 Bacteria 1233
90 Ga0307413_10456476 3300031824 Bacteria 1016
91 Ga0307410_10077818 3300031852 Bacteria 2320
92 Ga0307410_10436429 3300031852 Bacteria 1065
93 Ga0307406_10004445 3300031901 Bacteria 7630
94 Ga0307406_10416523 3300031901 Bacteria 1069
95 Ga0307406_10473035 3300031901 Bacteria 1010
96 Ga0307407_10007126 3300031903 Bacteria 5039
97 Ga0307407_10103744 3300031903 Bacteria 1770
98 Ga0307407_10119260 3300031903 Bacteria 1670
99 Ga0307407_10250613 3300031903 Bacteria 1213
100 Ga0307407_10282731 3300031903 Bacteria 1150
101 Ga0307412_10106246 3300031911 Bacteria 1996
102 Ga0307409_100073852 3300031995 Bacteria 2722
103 Ga0307409_100305347 3300031995 Bacteria 1482
104 Ga0307409_100324433 3300031995 Bacteria 1442
105 Ga0307409_100519032 3300031995 Bacteria 1163
106 Ga0307416_100129130 3300032002 Bacteria 2271
107 Ga0307416_100438920 3300032002 Bacteria 1355
108 Ga0307414_10124677 3300032004 Bacteria 1988
109 Ga0307414_10275806 3300032004 Bacteria 1411
110 Ga0307414_10287726 3300032004 Bacteria 1384
111 Ga0307414_10377429 3300032004 Bacteria 1225
112 Ga0307415_100267656 3300032126 Bacteria 1398
113 Ga0373924_0068570 3300035410 Bacteria 1493
114 Ga0373927_0211860 3300035695 Bacteria 1273
115 Ga0373933_0015476 3300035724 Bacteria 4252
116 Ga0395898_0018032 3300037466 Bacteria 7202
117 Ga0395898_0279680 3300037466 Bacteria 1592
118 Ga0395898_0337691 3300037466 Bacteria 1437
119 Ga0395901_0002360 3300038443 Bacteria 19201
120 Ga0395901_0389348 3300038443 Bacteria 1433
121 Ga0395901_0449635 3300038443 Bacteria 1318
122 Ga0436365_0901555 3300039437 Bacteria 1410
123 Ga0451791_1926016 3300041451 Bacteria 1501
124 Ga0451795_0844083 3300041456 Bacteria 1873
125 Ga0451841_0823690 3300041498 Bacteria 1495
126 Ga0451853_0235978 3300041512 Bacteria 1714
127 Ga0466969_0080638 3300044656 Bacteria 1554
128 Ga0466965_0002892 3300044683 Bacteria 7415
129 Ga0466965_0065115 3300044683 Bacteria 1826
130 Ga0466965_0150385 3300044683 Bacteria 1217
131 Ga0466966_0143422 3300044684 Bacteria 1459
132 Ga0466961_0058590 3300044693 Bacteria 2450
133 Ga0466961_0178695 3300044693 Bacteria 1318
134 Ga0466963_0029596 3300044694 Bacteria 3527
135 Ga0466963_0125352 3300044694 Bacteria 1770
136 Ga0466963_0214866 3300044694 Bacteria 1346
137 Ga0466963_0220587 3300044694 Bacteria 1328
138 Ga0466963_0229336 3300044694 Bacteria 1301
139 Ga0466963_0374886 3300044694 Bacteria 1003
140 Ga0466964_0264165 3300044706 Bacteria 854
141 Ga0466968_0007585 3300044735 Bacteria 4130
142 Ga0466970_0000149 3300044765 Bacteria 32553
143 Ga0466970_0012905 3300044765 Bacteria 4278
144 Ga0466970_0028197 3300044765 Bacteria 2949
145 Ga0466957_0076371 3300044842 Bacteria 2080
146 Ga0466957_0106427 3300044842 Bacteria 1774
147 Ga0466960_0000526 3300044901 Bacteria 13127
148 Ga0466960_0010883 3300044901 Bacteria 3789
149 Ga0466960_0177387 3300044901 Bacteria 1153
150 Ga0466959_0074470 3300045049 Bacteria 2455
151 Ga0466959_0096265 3300045049 Bacteria 2122
152 Ga0466959_0121542 3300045049 Bacteria 1856
153 Ga0466959_0213617 3300045049 Bacteria 1340
154 Ga0466959_0388155 3300045049 Bacteria 950
155 Ga0466958_0072752 3300045836 Bacteria 2105
156 Ga0466958_0080660 3300045836 Bacteria 2002
157 Ga0466967_0000029 3300045976 Bacteria 56648
158 Ga0466967_0013581 3300045976 Bacteria 6300
159 Ga0466967_0049573 3300045976 Bacteria 3672
160 Ga0466967_0051797 3300045976 Bacteria 3600
161 Ga0466967_0064837 3300045976 Bacteria 3250
162 Ga0466967_0070897 3300045976 Bacteria 3119
163 Ga0466967_0112348 3300045976 Bacteria 2505
164 Ga0466967_0214160 3300045976 Bacteria 1828
165 Ga0466967_0377737 3300045976 Bacteria 1375
166 Ga0495638_0264664 3300046460 Bacteria 941
167 Ga0495651_0264640 3300046462 Bacteria 1168
168 Ga0495653_0122143 3300046463 Bacteria 1854
169 Ga0495618_0074558 3300046514 Bacteria 2161
170 Ga0495628_0157313 3300046516 Bacteria 1728
171 Ga0495652_0192612 3300046529 Bacteria 1554
172 Ga0495587_0013998 3300046536 Bacteria 5037
173 Ga0495645_0031450 3300046543 Bacteria 3868
174 Ga0495645_0037697 3300046543 Bacteria 3525
175 Ga0495667_0086050 3300046559 Bacteria 2039
176 Ga0495634_0101971 3300046642 Bacteria 1853
177 Ga0495657_0088826 3300046675 Bacteria 1986
178 Ga0495613_0312303 3300046689 Bacteria 1086
179 Ga0495680_0230905 3300047322 Bacteria 1317
180 Ga0495602_0138452 3300048088 Bacteria 1930
181 Ga0496101_0023397 3300048904 Bacteria 4267
182 Ga0496101_0308632 3300048904 Bacteria 1240
183 Ga0496102_0085145 3300048905 Bacteria 2918
184 Ga0496102_0422039 3300048905 Unclassified 1253
185 Ga0496103_0012127 3300048906 Bacteria 5120
186 Ga0496104_0012236 3300048907 Bacteria 7712
187 Ga0496104_0024630 3300048907 Bacteria 5536
188 Ga0496105_0093768 3300048908 Bacteria 2479
189 Ga0496105_0109344 3300048908 Bacteria 2282
190 Ga0496105_0255549 3300048908 Bacteria 1418
191 Ga0496106_0114083 3300048909 Bacteria 2107
192 Ga0496107_0006293 3300048910 Bacteria 8159
193 Ga0496110_0108042 3300048913 Bacteria 2498
194 Ga0496110_0282656 3300048913 Bacteria 1511
195 Ga0496111_0051944 3300048914 Bacteria 2960
196 Ga0496112_0610181 3300048915 Bacteria 1023
197 Ga0496113_0019095 3300048916 Bacteria 4789
198 Ga0496113_0083089 3300048916 Bacteria 2457
199 Ga0496114_0048513 3300048917 Bacteria 3532
200 Ga0496114_0050340 3300048917 Bacteria 3467
201 Ga0496114_0074882 3300048917 Bacteria 2850
202 Ga0496114_0185800 3300048917 Bacteria 1816
203 Ga0496114_0220966 3300048917 Bacteria 1663
204 Ga0496115_0048130 3300048918 Bacteria 3410
205 Ga0496117_0111717 3300048920 Bacteria 1701
206 Ga0496119_0002757 3300048922 Bacteria 18904
207 Ga0496119_0246839 3300048922 Bacteria 902
208 Ga0496120_0096122 3300048923 Bacteria 1574
209 Ga0496125_0001688 3300048928 Bacteria 30874
210 Ga0496126_0016617 3300048929 Bacteria 7355
211 Ga0496126_0125755 3300048929 Bacteria 2219
212 Ga0501031_0410770 3300049568 Bacteria 875
213 Ga0501034_0007246 3300049571 Bacteria 11837
214 Ga0501034_0266355 3300049571 Bacteria 1655
215 Ga0501036_0308695 3300049572 Bacteria 1323
216 Ga0501036_0750959 3300049572 Bacteria 805
217 Ga0501038_0035984 3300049574 Bacteria 4345
218 Ga0501038_0041696 3300049574 Bacteria 4002
219 Ga0501039_0315595 3300049575 Bacteria 1229
220 Ga0501039_0452046 3300049575 Bacteria 1009
221 Ga0501040_0134403 3300049576 Bacteria 1740
222 Ga0501042_0026557 3300049578 Bacteria 4068
223 Ga0501070_0293071 3300049586 Bacteria 1326
224 Ga0501081_0207555 3300049743 Bacteria 1422
225 nmdc:mga00v17_31409_c1 3300050491 Bacteria 3132
226 nmdc:mga00v17_6258_c1 3300050491 Bacteria 6309
227 nmdc:mga0yw44_792_c1 3300050492 Bacteria 11766
228 nmdc:mga05p37_157_c1 3300050507 Bacteria 65045
229 nmdc:mga09592_79_c1 3300050508 Bacteria 56100
230 nmdc:mga0qj67_11706_c1 3300050509 Bacteria 6583
231 nmdc:mga06r32_122_c1 3300050510 Bacteria 55812
232 nmdc:mga06r32_6768_c1 3300050510 Bacteria 10302
233 nmdc:mga08y16_16969_c1 3300050511 Bacteria 7667
234 Ga0495612_0155409 3300053078 Bacteria 997
235 Ga0495595_0061209 3300053084 Bacteria 1763
236 Ga0500556_0000380 3300053104 Bacteria 32387
237 Ga0500616_0000116 3300053153 Bacteria 145790
238 Ga0500616_0001061 3300053153 Bacteria 28911
239 Ga0466962_0035369 3300061719 Bacteria 2391
240 Ga0466962_0209952 3300061719 Bacteria 952
241 2643886154 2643221575 Bacteria 4022601
242 2643995308 2643221597 Bacteria 3347721
243 2644092854 2643221615 Bacteria 5487866
244 2644322467 2643221657 Bacteria 5490246
245 2644447435 2643221679 Bacteria 3839507
246 2731907629 2731639228 Bacteria 4187555
247 2774381848 2773857758 Bacteria 3592392
248 2774383931 2773857759 Bacteria 2963774
249 2774398832 2773857763 Bacteria 4180068
250 2808886173 2808606368 Bacteria 3174172
251 2809227928 2808606447 Bacteria 3572005
252 2821270608 2821268502 Bacteria 3750023
253 2833711569 2833709550 Bacteria 4008291
254 2852635717 2852632344 Bacteria 3463163
255 2852648914 2852646457 Bacteria 3408613
256 2852680491 2852677369 Bacteria 3768884
257 2866618966 2866612099 Bacteria 7543886
258 2904511417 2904509784 Bacteria 3520416
259 2908679857 2908678064 Bacteria 3482747
260 2919072872 2919069694 Bacteria 3622919
261 2919396255 2919395869 Bacteria 3704152
262 2946036813 2946033335 Bacteria 3835514
263 2974296795 2974294766 Bacteria 3767688
264 2974326969 2974324384 Bacteria 3750535
265 2977231989 2977228692 Bacteria 3450105
266 2977237348 2977236895 Bacteria 3569373
267 2977254541 2977251589 Bacteria 2952848
268 2977267315 2977264416 Bacteria 3750737
269 8045830625 8045830549 Bacteria 4444727
270 Ga0466961_0233370
271 rootH2_10042129
272 rootH1_10088026
273 rootH1_10265299
274 Ga0070658_10204756
275 Ga0070658_10559520
276 Ga0070682_100274125
277 Ga0070682_100283886
278 Ga0070660_100220443
279 Ga0070689_100136967
280 Ga0070709_10295104
281 Ga0070714_100425780
282 Ga0070714_100729627
283 Ga0070700_100032195
284 Ga0070662_100089202
285 Ga0070681_10004827
286 Ga0070681_10305901
287 Ga0070707_100040769
288 Ga0070679_100209889
289 Ga0070696_100008849
290 Ga0070665_100156847
291 Ga0068855_100011718
292 Ga0068855_100270500
293 Ga0068864_100312029
294 Ga0068866_10080820
295 Ga0081455_10004007
296 Ga0081455_10046257
297 Ga0075364_10007741
298 Ga0075364_10019801
299 Ga0075364_10115550
300 Ga0070715_10057825
301 Ga0070716_100010646
302 Ga0070712_100104564
303 Ga0075430_100031732
304 Ga0075431_100003397
305 Ga0075431_100006711
306 Ga0075429_100000465
307 Ga0105240_10060567
308 Ga0111539_10041264
309 Ga0111539_10081541
310 Ga0105245_10124741
311 Ga0105247_10047880
312 Ga0114129_10036509
313 Ga0105243_10044565
314 Ga0105241_10532246
315 Ga0105242_10734992
316 Ga0105248_10410664
317 Ga0105237_10103218
318 Ga0105238_10485537
319 Ga0105239_10252521
320 Ga0105239_10633814
321 Ga0157371_10122847
322 Ga0157370_10069332
323 Ga0157369_10049346
324 Ga0157369_10185286
325 Ga0171462_1004
326 Ga0157374_10581079
327 Ga0163162_10039734
328 Ga0157375_10962300
329 Ga0163163_10268409
330 Ga0206353_10118850
331 Ga0207688_10035686
332 Ga0207647_10027490
333 Ga0207647_10149526
334 Ga0207699_10069448
335 Ga0207645_10043309
336 Ga0207643_10092981
337 Ga0207705_10022256
338 Ga0207705_10078801
339 Ga0207707_10401808
340 Ga0207671_10047565
341 Ga0207663_10152874
342 Ga0207660_10218960
343 Ga0207657_10418285
344 Ga0207652_10210059
345 Ga0207709_10040398
346 Ga0207665_10009507
347 Ga0207665_10146927
348 Ga0207667_10027884
349 Ga0207667_10140069
350 Ga0207703_10049033
351 Ga0207708_10024267
352 Ga0207698_10335971
353 Ga0207428_10013004
354 Ga0265340_10000078
355 Ga0307513_10000476
356 Ga0307513_10033449
357 Ga0307408_100025323
358 Ga0307413_10291220
359 Ga0307413_10456476
360 Ga0307410_10077818
361 Ga0307410_10436429
362 Ga0307406_10004445
363 Ga0307406_10416523
364 Ga0307406_10473035
365 Ga0307407_10007126
366 Ga0307407_10103744
367 Ga0307407_10119260
368 Ga0307407_10250613
369 Ga0307407_10282731
370 Ga0307412_10106246
371 Ga0307409_100073852
372 Ga0307409_100305347
373 Ga0307409_100324433
374 Ga0307409_100519032
375 Ga0307416_100129130
376 Ga0307416_100438920
377 Ga0307414_10124677
378 Ga0307414_10275806
379 Ga0307414_10287726
380 Ga0307414_10377429
381 Ga0307415_100267656
382 Ga0373924_0068570
383 Ga0373927_0211860
384 Ga0373933_0015476
385 Ga0395898_0018032
386 Ga0395898_0279680
387 Ga0395898_0337691
388 Ga0395901_0002360
389 Ga0395901_0389348
390 Ga0395901_0449635
391 Ga0436365_0901555
392 Ga0451791_1926016
393 Ga0451795_0844083
394 Ga0451841_0823690
395 Ga0451853_0235978
396 Ga0466969_0080638
397 Ga0466965_0002892
398 Ga0466965_0065115
399 Ga0466965_0150385
400 Ga0466966_0143422
401 Ga0466961_0058590
402 Ga0466961_0178695
403 Ga0466963_0029596
404 Ga0466963_0125352
405 Ga0466963_0214866
406 Ga0466963_0220587
407 Ga0466963_0229336
408 Ga0466963_0374886
409 Ga0466964_0264165
410 Ga0466968_0007585
411 Ga0466970_0000149
412 Ga0466970_0012905
413 Ga0466970_0028197
414 Ga0466957_0076371
415 Ga0466957_0106427
416 Ga0466960_0000526
417 Ga0466960_0010883
418 Ga0466960_0177387
419 Ga0466959_0074470
420 Ga0466959_0096265
421 Ga0466959_0121542
422 Ga0466959_0213617
423 Ga0466959_0388155
424 Ga0466958_0072752
425 Ga0466958_0080660
426 Ga0466967_0000029
427 Ga0466967_0013581
428 Ga0466967_0049573
429 Ga0466967_0051797
430 Ga0466967_0064837
431 Ga0466967_0070897
432 Ga0466967_0112348
433 Ga0466967_0214160
434 Ga0466967_0377737
435 Ga0495638_0264664
436 Ga0495651_0264640
437 Ga0495653_0122143
438 Ga0495618_0074558
439 Ga0495628_0157313
440 Ga0495652_0192612
441 Ga0495587_0013998
442 Ga0495645_0031450
443 Ga0495645_0037697
444 Ga0495667_0086050
445 Ga0495634_0101971
446 Ga0495657_0088826
447 Ga0495613_0312303
448 Ga0495680_0230905
449 Ga0495602_0138452
450 Ga0496101_0023397
451 Ga0496101_0308632
452 Ga0496102_0085145
453 Ga0496102_0422039
454 Ga0496103_0012127
455 Ga0496104_0012236
456 Ga0496104_0024630
457 Ga0496105_0093768
458 Ga0496105_0109344
459 Ga0496105_0255549
460 Ga0496106_0114083
461 Ga0496107_0006293
462 Ga0496110_0108042
463 Ga0496110_0282656
464 Ga0496111_0051944
465 Ga0496112_0610181
466 Ga0496113_0019095
467 Ga0496113_0083089
468 Ga0496114_0048513
469 Ga0496114_0050340
470 Ga0496114_0074882
471 Ga0496114_0185800
472 Ga0496114_0220966
473 Ga0496115_0048130
474 Ga0496117_0111717
475 Ga0496119_0002757
476 Ga0496119_0246839
477 Ga0496120_0096122
478 Ga0496125_0001688
479 Ga0496126_0016617
480 Ga0496126_0125755
481 Ga0501031_0410770
482 Ga0501034_0007246
483 Ga0501034_0266355
484 Ga0501036_0308695
485 Ga0501036_0750959
486 Ga0501038_0035984
487 Ga0501038_0041696
488 Ga0501039_0315595
489 Ga0501039_0452046
490 Ga0501040_0134403
491 Ga0501042_0026557
492 Ga0501070_0293071
493 Ga0501081_0207555
494 nmdc:mga00v17_31409_c1
495 nmdc:mga00v17_6258_c1
496 nmdc:mga0yw44_792_c1
497 nmdc:mga05p37_157_c1
498 nmdc:mga09592_79_c1
499 nmdc:mga0qj67_11706_c1
500 nmdc:mga06r32_122_c1
501 nmdc:mga06r32_6768_c1
502 nmdc:mga08y16_16969_c1
503 Ga0495612_0155409
504 Ga0495595_0061209
505 Ga0500556_0000380
506 Ga0500616_0000116
507 Ga0500616_0001061
508 Ga0466962_0035369
509 Ga0466962_0209952
510 2643886154
511 2643995308
512 2644092854
513 2644322467
514 2644447435
515 2731907629
516 2774381848
517 2774383931
518 2774398832
519 2808886173
520 2809227928
521 2821270608
522 2833711569
523 2852635717
524 2852648914
525 2852680491
526 2866618966
527 2904511417
528 2908679857
529 2919072872
530 2919396255
531 2946036813
532 2974296795
533 2974326969
534 2977231989
535 2977237348
536 2977254541
537 2977267315
538 8045830625

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01614

IclR

Bacterial transcriptional regulator

73

248

0.95

PF09339

HTH_IclR

IclR helix-turn-helix domain

6

57

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9566 43 98
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9487 43 98
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.939 40 97
2heo-assembly1.cif.gz_D general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.9389 43 98
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9323 40 84
ID Description Score Start End Superfamily
af_Q5QM91_354_443_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9702 43 87 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.962 43 89 1.10.10.10
af_I6Y187_16_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 43 89 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9566 43 98 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9542 40 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2R7QR65-F1-model_v4 IclR family transcriptional regulator 0.9641 165 279 GO:0003677
GO:0003700
GO:0045892
AF-A0A6C7Z857-F1-model_v4 deleted 0.9337 122 255
AF-A0A3D6BJA3-F1-model_v4 IclR-ED domain-containing protein 0.9256 111 278 GO:0003677
GO:0003700
GO:0045892
AF-A0A2V9QTZ5-F1-model_v4 IclR-ED domain-containing protein 0.919 114 280 GO:0003677
GO:0003700
GO:0045892
AF-A0A4U9WHM4-F1-model_v4 Pectin degradation repressor protein kdgR 0.9176 124 281 GO:0003677
GO:0003700
GO:0045892

Map