F375645

General Info

Members Datasets Scaffolds Average Seq Length
268 170 536 149

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0202893|Ga0373927_0202893_565_1071
Length 168
Sequence MAVRLDNGDDDGAELHEINVTPFIDVILVLLIIFMVAAPLSTVDVAVDLPVSTARPQPRPDKPLFLTIKADLTVALGNDPTALGPGQLVSAIDVATDRDRQKRIFLRADKSVPYGTLMAVMNVLRAGGYLKVALVGLEDASPQPDAVPPDAAAANPATPTTPPQGARP

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
90 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
91 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
92 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
93 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
94 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 0
Rhizoplane 6.72
Rhizosphere 83.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0202893 3300035695 Bacteria 1302
2 ARSoilYngRDRAFT_c00231 3300000042 Bacteria 8934
3 JGI25404J52841_10024967 3300003659 Bacteria 1286
4 JGI25405J52794_10006052 3300003911 Bacteria 2203
5 Ga0070676_10483969 3300005328 Bacteria 876
6 Ga0070690_100407408 3300005330 Bacteria 1000
7 Ga0068869_100554604 3300005334 Bacteria 966
8 Ga0070680_100007256 3300005336 Bacteria 8445
9 Ga0070660_100052709 3300005339 Bacteria 3137
10 Ga0070689_100531683 3300005340 Bacteria 1011
11 Ga0070691_10003428 3300005341 Bacteria 7126
12 Ga0070668_101417917 3300005347 Bacteria 634
13 Ga0070688_100333185 3300005365 Bacteria 1106
14 Ga0070688_100655934 3300005365 Bacteria 809
15 Ga0070709_11077984 3300005434 Bacteria 642
16 Ga0070714_100213486 3300005435 Bacteria 1770
17 Ga0070700_100011593 3300005441 Bacteria 4886
18 Ga0070700_100085087 3300005441 Bacteria 2051
19 Ga0070694_100062629 3300005444 Bacteria 2542
20 Ga0070663_100721192 3300005455 Bacteria 849
21 Ga0070663_100867134 3300005455 Bacteria 778
22 Ga0070663_100963731 3300005455 Bacteria 740
23 Ga0070681_11045891 3300005458 Bacteria 737
24 Ga0068867_100391437 3300005459 Bacteria 1170
25 Ga0070685_10535323 3300005466 Bacteria 834
26 Ga0070679_100011673 3300005530 Bacteria 8375
27 Ga0070697_100209991 3300005536 Bacteria 1657
28 Ga0070695_100119126 3300005545 Bacteria 1803
29 Ga0070696_100220203 3300005546 Bacteria 1424
30 Ga0068855_100103108 3300005563 Bacteria 3283
31 Ga0068856_101059353 3300005614 Bacteria 829
32 Ga0068852_100017769 3300005616 Bacteria 5588
33 Ga0068859_101178289 3300005617 Bacteria 844
34 Ga0068861_100205078 3300005719 Bacteria 1657
35 Ga0068861_101431276 3300005719 Bacteria 676
36 Ga0068860_100405609 3300005843 Bacteria 1349
37 Ga0068860_100828667 3300005843 Bacteria 939
38 Ga0068862_100112433 3300005844 Bacteria 2392
39 Ga0081455_10000429 3300005937 Bacteria 55107
40 Ga0081455_10001313 3300005937 Bacteria 30820
41 Ga0081455_10023500 3300005937 Bacteria 5733
42 Ga0081540_1000257 3300005983 Bacteria 55989
43 Ga0075365_10002158 3300006038 Bacteria 9459
44 Ga0075365_10448046 3300006038 Bacteria 911
45 Ga0075368_10051757 3300006042 Bacteria 1633
46 Ga0075368_10076481 3300006042 Bacteria 1358
47 Ga0075364_10001074 3300006051 Bacteria 14559
48 Ga0070715_10140555 3300006163 Bacteria 1172
49 Ga0070712_100865589 3300006175 Bacteria 778
50 Ga0075367_10010619 3300006178 Bacteria 4843
51 Ga0075367_10012106 3300006178 Bacteria 4588
52 Ga0075367_10020725 3300006178 Bacteria 3666
53 Ga0075428_100028233 3300006844 Bacteria 6206
54 Ga0075428_100196510 3300006844 Bacteria 2181
55 Ga0075428_100223070 3300006844 Bacteria 2035
56 Ga0075428_100541928 3300006844 Bacteria 1244
57 Ga0075428_100551022 3300006844 Bacteria 1233
58 Ga0075431_100106356 3300006847 Bacteria 2895
59 Ga0075431_101188441 3300006847 Bacteria 726
60 Ga0075433_10092885 3300006852 Bacteria 2669
61 Ga0075433_10220561 3300006852 Bacteria 1684
62 Ga0075434_100000717 3300006871 Bacteria 25919
63 Ga0075434_100025815 3300006871 Bacteria 5751
64 Ga0075429_101860998 3300006880 Bacteria 522
65 Ga0075435_100008616 3300007076 Bacteria 7329
66 Ga0099795_10024234 3300007788 Bacteria 2022
67 Ga0111539_10090339 3300009094 Bacteria 3599
68 Ga0111539_10110996 3300009094 Bacteria 3218
69 Ga0111539_10396364 3300009094 Bacteria 1608
70 Ga0111539_10821885 3300009094 Bacteria 1081
71 Ga0111539_11101051 3300009094 Bacteria 923
72 Ga0111539_11332927 3300009094 Bacteria 833
73 Ga0105245_10779133 3300009098 Bacteria 993
74 Ga0114129_10016267 3300009147 Bacteria 10587
75 Ga0114129_10040563 3300009147 Bacteria 6562
76 Ga0114129_10128681 3300009147 Bacteria 3480
77 Ga0114129_11705935 3300009147 Bacteria 768
78 Ga0105242_10374022 3300009176 Bacteria 1322
79 Ga0105238_10088148 3300009551 Bacteria 3089
80 Ga0099796_10007124 3300010159 Bacteria 2909
81 Ga0163163_10104310 3300014325 Bacteria 2860
82 Ga0163163_10831403 3300014325 Bacteria 987
83 Ga0157380_10028309 3300014326 Bacteria 4271
84 Ga0157380_10414880 3300014326 Bacteria 1282
85 Ga0157380_11189949 3300014326 Bacteria 805
86 Ga0157379_10557015 3300014968 Bacteria 1067
87 Ga0157376_11202691 3300014969 Bacteria 786
88 Ga0163161_10019779 3300017792 Bacteria 4724
89 Ga0213874_10047513 3300021377 Bacteria 1306
90 Ga0213875_10000364 3300021388 Bacteria 42225
91 Ga0207685_10125310 3300025905 Bacteria 1133
92 Ga0207645_10185118 3300025907 Bacteria 1367
93 Ga0207707_10375750 3300025912 Bacteria 1222
94 Ga0207660_10004230 3300025917 Bacteria 9352
95 Ga0207660_11001587 3300025917 Bacteria 681
96 Ga0207657_10143010 3300025919 Bacteria 1953
97 Ga0207681_11071965 3300025923 Bacteria 676
98 Ga0207664_10470502 3300025929 Bacteria 1123
99 Ga0207686_11013544 3300025934 Bacteria 674
100 Ga0207670_10595888 3300025936 Bacteria 907
101 Ga0207668_10055672 3300025972 Bacteria 2751
102 Ga0207668_10108059 3300025972 Bacteria 2082
103 Ga0207708_10044744 3300026075 Bacteria 3373
104 Ga0207675_100031570 3300026118 Bacteria 4934
105 Ga0207675_100038394 3300026118 Bacteria 4469
106 Ga0207675_101151086 3300026118 Bacteria 796
107 Ga0207683_11686355 3300026121 Bacteria 583
108 Ga0207698_10138714 3300026142 Bacteria 2091
109 Ga0209813_10008157 3300027866 Bacteria 2637
110 Ga0207428_10022957 3300027907 Bacteria 5254
111 Ga0207428_10039164 3300027907 Bacteria 3848
112 Ga0207428_10225575 3300027907 Bacteria 1403
113 Ga0268264_10861047 3300028381 Bacteria 908
114 Ga0265334_10332898 3300028573 Bacteria 519
115 Ga0307515_10146824 3300028794 Bacteria 2492
116 Ga0265338_10286957 3300028800 Bacteria 1200
117 Ga0265762_1048339 3300030760 Bacteria 848
118 Ga0265330_10296289 3300031235 Bacteria 681
119 Ga0265325_10024622 3300031241 Bacteria 3273
120 Ga0265340_10072836 3300031247 Bacteria 1626
121 Ga0265339_10011089 3300031249 Bacteria 5565
122 Ga0307513_10512150 3300031456 Bacteria 916
123 Ga0265314_10718798 3300031711 Bacteria 504
124 Ga0265342_10077547 3300031712 Bacteria 1924
125 Ga0373958_0003225 3300034819 Bacteria 2340
126 Ga0373951_0021534 3300035091 Bacteria 1481
127 Ga0373932_0185455 3300035112 Bacteria 732
128 Ga0373939_0002470 3300035114 Bacteria 4361
129 Ga0373939_0071927 3300035114 Bacteria 1128
130 Ga0373942_0013437 3300035207 Bacteria 1969
131 Ga0373961_0020521 3300035241 Bacteria 1749
132 Ga0373931_0019674 3300035691 Bacteria 3372
133 Ga0373927_0535527 3300035695 Bacteria 774
134 Ga0373947_0074810 3300035725 Bacteria 2085
135 Ga0395899_0060386 3300037312 Bacteria 2793
136 Ga0395900_0602595 3300037418 Bacteria 1039
137 Ga0436364_1059071 3300037853 Bacteria 22107
138 Ga0395901_0041804 3300038443 Bacteria 4751
139 Ga0395901_0156772 3300038443 Bacteria 2391
140 Ga0436363_1147126 3300039450 Bacteria 2154
141 Ga0451853_1807947 3300041512 Bacteria 949
142 Ga0466963_0709875 3300044694 Bacteria 709
143 Ga0466959_0419332 3300045049 Bacteria 909
144 Ga0451576_0004873 3300045051 Bacteria 17158
145 Ga0451576_0601695 3300045051 Bacteria 1155
146 Ga0466958_0238671 3300045836 Bacteria 1161
147 Ga0466967_0026546 3300045976 Bacteria 4799
148 Ga0466967_0124461 3300045976 Bacteria 2387
149 Ga0495603_0281551 3300046455 Bacteria 956
150 Ga0495582_0167107 3300046473 Bacteria 1252
151 Ga0495584_0247175 3300046491 Bacteria 907
152 Ga0495668_0214406 3300046616 Bacteria 1054
153 Ga0496102_0280258 3300048905 Bacteria 1571
154 Ga0496104_0000664 3300048907 Bacteria 29461
155 Ga0496104_0025313 3300048907 Bacteria 5470
156 Ga0496105_0008866 3300048908 Bacteria 7837
157 Ga0496105_0952339 3300048908 Bacteria 644
158 Ga0496106_0146062 3300048909 Bacteria 1863
159 Ga0496107_0027522 3300048910 Bacteria 4037
160 Ga0496108_0047219 3300048911 Bacteria 3599
161 Ga0496108_0213250 3300048911 Bacteria 1676
162 Ga0496109_0140619 3300048912 Bacteria 2257
163 Ga0496109_0300907 3300048912 Bacteria 1512
164 Ga0496110_0025424 3300048913 Bacteria 5060
165 Ga0496110_0261490 3300048913 Bacteria 1575
166 Ga0496112_0026336 3300048915 Bacteria 5593
167 Ga0496112_0157219 3300048915 Bacteria 2240
168 Ga0496114_0592165 3300048917 Bacteria 978
169 Ga0496114_1123952 3300048917 Bacteria 671
170 Ga0496115_0011837 3300048918 Bacteria 6553
171 Ga0501031_0075912 3300049568 Bacteria 2188
172 Ga0501032_0004037 3300049569 Bacteria 11131
173 Ga0501033_0536911 3300049570 Bacteria 806
174 Ga0501034_0110168 3300049571 Bacteria 2744
175 Ga0501034_0420072 3300049571 Bacteria 1258
176 Ga0501034_1548422 3300049571 Bacteria 536
177 Ga0501036_0350074 3300049572 Bacteria 1233
178 Ga0501036_0415268 3300049572 Bacteria 1122
179 Ga0501036_0690783 3300049572 Bacteria 843
180 Ga0501037_0070430 3300049573 Bacteria 2544
181 Ga0501038_0439550 3300049574 Bacteria 1004
182 Ga0501039_0033018 3300049575 Bacteria 3993
183 Ga0501039_0095612 3300049575 Bacteria 2316
184 Ga0501040_0186017 3300049576 Bacteria 1473
185 Ga0501041_0144149 3300049577 Bacteria 1486
186 Ga0501041_0377695 3300049577 Bacteria 897
187 Ga0501042_0316320 3300049578 Bacteria 1128
188 Ga0501042_0535340 3300049578 Bacteria 851
189 Ga0501043_0289739 3300049579 Bacteria 1253
190 Ga0501043_0374103 3300049579 Bacteria 1079
191 Ga0501046_0014006 3300049580 Bacteria 6773
192 Ga0501046_0455081 3300049580 Bacteria 920
193 Ga0501047_0441217 3300049581 Bacteria 1132
194 Ga0501047_0566322 3300049581 Bacteria 959
195 Ga0501048_0058296 3300049582 Bacteria 2737
196 Ga0501048_0292965 3300049582 Bacteria 1157
197 Ga0501069_0028787 3300049585 Bacteria 3047
198 Ga0501069_0739772 3300049585 Bacteria 594
199 Ga0501069_0783335 3300049585 Bacteria 577
200 Ga0501070_0101510 3300049586 Bacteria 2379
201 Ga0501070_1127723 3300049586 Bacteria 604
202 Ga0501071_0031385 3300049587 Bacteria 3766
203 Ga0501071_0180291 3300049587 Bacteria 1582
204 Ga0501071_0234196 3300049587 Bacteria 1384
205 Ga0501072_0091252 3300049588 Bacteria 2419
206 Ga0501072_0240891 3300049588 Bacteria 1441
207 Ga0501072_0406769 3300049588 Bacteria 1079
208 Ga0501073_0028795 3300049589 Bacteria 3968
209 Ga0501074_0517152 3300049590 Bacteria 845
210 Ga0501075_0316851 3300049591 Bacteria 1189
211 Ga0501076_0081187 3300049592 Bacteria 2603
212 Ga0501076_0257201 3300049592 Bacteria 1429
213 Ga0501077_0067457 3300049593 Bacteria 2268
214 Ga0501077_0395697 3300049593 Bacteria 883
215 Ga0501079_0375178 3300049741 Bacteria 1115
216 Ga0501079_0731223 3300049741 Bacteria 779
217 Ga0501080_0005214 3300049742 Bacteria 11581
218 Ga0501080_0429427 3300049742 Bacteria 1186
219 Ga0501080_1389647 3300049742 Bacteria 599
220 Ga0501081_0015333 3300049743 Bacteria 5056
221 Ga0501081_0138352 3300049743 Bacteria 1744
222 Ga0501083_0734911 3300049744 Bacteria 642
223 Ga0501035_0243082 3300049822 Bacteria 1530
224 Ga0501035_0320632 3300049822 Bacteria 1302
225 Ga0501035_0477047 3300049822 Bacteria 1029
226 Ga0501035_0924358 3300049822 Bacteria 690
227 Ga0501035_1036706 3300049822 Bacteria 643
228 Ga0501044_0001147 3300049823 Bacteria 31381
229 Ga0501044_0201104 3300049823 Bacteria 1950
230 Ga0501045_0030072 3300049824 Bacteria 3929
231 Ga0501045_0593548 3300049824 Bacteria 820
232 nmdc:mga03n38_3200_c1 3300050490 Bacteria 5216
233 nmdc:mga03n38_58045_c1 3300050490 Bacteria 1752
234 nmdc:mga00v17_29213_c1 3300050491 Bacteria 3235
235 nmdc:mga0yw44_57136_c1 3300050492 Bacteria 2380
236 nmdc:mga0yw44_88507_c1 3300050492 Bacteria 1952
237 nmdc:mga06z11_17253_c1 3300050494 Bacteria 3272
238 nmdc:mga06z11_22036_c1 3300050494 Bacteria 2695
239 nmdc:mga06z11_5261_c1 3300050494 Bacteria 5177
240 nmdc:mga04h51_4861_c1 3300050495 Bacteria 3379
241 nmdc:mga05p37_209650_c1 3300050507 Bacteria 2356
242 nmdc:mga05p37_399953_c1 3300050507 Bacteria 1604
243 nmdc:mga09592_1212179_c1 3300050508 Bacteria 623
244 nmdc:mga0qj67_678576_c1 3300050509 Bacteria 821
245 nmdc:mga06r32_1256340_c1 3300050510 Bacteria 685
246 nmdc:mga06r32_74587_c1 3300050510 Bacteria 3289
247 nmdc:mga08y16_1109712_c1 3300050511 Bacteria 766
248 nmdc:mga08y16_311267_c1 3300050511 Bacteria 1622
249 nmdc:mga08y16_357223_c1 3300050511 Bacteria 1500
250 nmdc:mga08y16_430816_c1 3300050511 Bacteria 1347
251 nmdc:mga08y16_69085_c1 3300050511 Bacteria 3683
252 nmdc:mga08y16_75099_c1 3300050511 Bacteria 3524
253 nmdc:mga0n895_109890_c1 3300050512 Bacteria 2772
254 nmdc:mga0n895_32420_c1 3300050512 Bacteria 5016
255 nmdc:mga0n895_744627_c1 3300050512 Bacteria 973
256 nmdc:mga0rr50_156782_c1 3300050513 Bacteria 1845
257 nmdc:mga0a205_390611_c2 3300050515 Bacteria 762
258 nmdc:mga0a205_8008_c1 3300050515 Bacteria 9604
259 Ga0500622_0032180 3300053156 Bacteria 2750
260 Ga0501082_0128226 3300060353 Bacteria 2201
261 Ga0501082_0199646 3300060353 Bacteria 1740
262 Ga0501082_0209859 3300060353 Bacteria 1694
263 Ga0501082_0380958 3300060353 Bacteria 1231
264 Ga0501082_0895029 3300060353 Bacteria 776
265 Ga0501082_0919523 3300060353 Bacteria 765
266 Ga0466962_0162134 3300061719 Bacteria 1087
267 Ga0530510_0132046 3300061734 Bacteria 1837
268 Ga0530510_0291408 3300061734 Bacteria 1220
269 Ga0373927_0202893
270 ARSoilYngRDRAFT_c00231
271 JGI25404J52841_10024967
272 JGI25405J52794_10006052
273 Ga0070676_10483969
274 Ga0070690_100407408
275 Ga0068869_100554604
276 Ga0070680_100007256
277 Ga0070660_100052709
278 Ga0070689_100531683
279 Ga0070691_10003428
280 Ga0070668_101417917
281 Ga0070688_100333185
282 Ga0070688_100655934
283 Ga0070709_11077984
284 Ga0070714_100213486
285 Ga0070700_100011593
286 Ga0070700_100085087
287 Ga0070694_100062629
288 Ga0070663_100721192
289 Ga0070663_100867134
290 Ga0070663_100963731
291 Ga0070681_11045891
292 Ga0068867_100391437
293 Ga0070685_10535323
294 Ga0070679_100011673
295 Ga0070697_100209991
296 Ga0070695_100119126
297 Ga0070696_100220203
298 Ga0068855_100103108
299 Ga0068856_101059353
300 Ga0068852_100017769
301 Ga0068859_101178289
302 Ga0068861_100205078
303 Ga0068861_101431276
304 Ga0068860_100405609
305 Ga0068860_100828667
306 Ga0068862_100112433
307 Ga0081455_10000429
308 Ga0081455_10001313
309 Ga0081455_10023500
310 Ga0081540_1000257
311 Ga0075365_10002158
312 Ga0075365_10448046
313 Ga0075368_10051757
314 Ga0075368_10076481
315 Ga0075364_10001074
316 Ga0070715_10140555
317 Ga0070712_100865589
318 Ga0075367_10010619
319 Ga0075367_10012106
320 Ga0075367_10020725
321 Ga0075428_100028233
322 Ga0075428_100196510
323 Ga0075428_100223070
324 Ga0075428_100541928
325 Ga0075428_100551022
326 Ga0075431_100106356
327 Ga0075431_101188441
328 Ga0075433_10092885
329 Ga0075433_10220561
330 Ga0075434_100000717
331 Ga0075434_100025815
332 Ga0075429_101860998
333 Ga0075435_100008616
334 Ga0099795_10024234
335 Ga0111539_10090339
336 Ga0111539_10110996
337 Ga0111539_10396364
338 Ga0111539_10821885
339 Ga0111539_11101051
340 Ga0111539_11332927
341 Ga0105245_10779133
342 Ga0114129_10016267
343 Ga0114129_10040563
344 Ga0114129_10128681
345 Ga0114129_11705935
346 Ga0105242_10374022
347 Ga0105238_10088148
348 Ga0099796_10007124
349 Ga0163163_10104310
350 Ga0163163_10831403
351 Ga0157380_10028309
352 Ga0157380_10414880
353 Ga0157380_11189949
354 Ga0157379_10557015
355 Ga0157376_11202691
356 Ga0163161_10019779
357 Ga0213874_10047513
358 Ga0213875_10000364
359 Ga0207685_10125310
360 Ga0207645_10185118
361 Ga0207707_10375750
362 Ga0207660_10004230
363 Ga0207660_11001587
364 Ga0207657_10143010
365 Ga0207681_11071965
366 Ga0207664_10470502
367 Ga0207686_11013544
368 Ga0207670_10595888
369 Ga0207668_10055672
370 Ga0207668_10108059
371 Ga0207708_10044744
372 Ga0207675_100031570
373 Ga0207675_100038394
374 Ga0207675_101151086
375 Ga0207683_11686355
376 Ga0207698_10138714
377 Ga0209813_10008157
378 Ga0207428_10022957
379 Ga0207428_10039164
380 Ga0207428_10225575
381 Ga0268264_10861047
382 Ga0265334_10332898
383 Ga0307515_10146824
384 Ga0265338_10286957
385 Ga0265762_1048339
386 Ga0265330_10296289
387 Ga0265325_10024622
388 Ga0265340_10072836
389 Ga0265339_10011089
390 Ga0307513_10512150
391 Ga0265314_10718798
392 Ga0265342_10077547
393 Ga0373958_0003225
394 Ga0373951_0021534
395 Ga0373932_0185455
396 Ga0373939_0002470
397 Ga0373939_0071927
398 Ga0373942_0013437
399 Ga0373961_0020521
400 Ga0373931_0019674
401 Ga0373927_0535527
402 Ga0373947_0074810
403 Ga0395899_0060386
404 Ga0395900_0602595
405 Ga0436364_1059071
406 Ga0395901_0041804
407 Ga0395901_0156772
408 Ga0436363_1147126
409 Ga0451853_1807947
410 Ga0466963_0709875
411 Ga0466959_0419332
412 Ga0451576_0004873
413 Ga0451576_0601695
414 Ga0466958_0238671
415 Ga0466967_0026546
416 Ga0466967_0124461
417 Ga0495603_0281551
418 Ga0495582_0167107
419 Ga0495584_0247175
420 Ga0495668_0214406
421 Ga0496102_0280258
422 Ga0496104_0000664
423 Ga0496104_0025313
424 Ga0496105_0008866
425 Ga0496105_0952339
426 Ga0496106_0146062
427 Ga0496107_0027522
428 Ga0496108_0047219
429 Ga0496108_0213250
430 Ga0496109_0140619
431 Ga0496109_0300907
432 Ga0496110_0025424
433 Ga0496110_0261490
434 Ga0496112_0026336
435 Ga0496112_0157219
436 Ga0496114_0592165
437 Ga0496114_1123952
438 Ga0496115_0011837
439 Ga0501031_0075912
440 Ga0501032_0004037
441 Ga0501033_0536911
442 Ga0501034_0110168
443 Ga0501034_0420072
444 Ga0501034_1548422
445 Ga0501036_0350074
446 Ga0501036_0415268
447 Ga0501036_0690783
448 Ga0501037_0070430
449 Ga0501038_0439550
450 Ga0501039_0033018
451 Ga0501039_0095612
452 Ga0501040_0186017
453 Ga0501041_0144149
454 Ga0501041_0377695
455 Ga0501042_0316320
456 Ga0501042_0535340
457 Ga0501043_0289739
458 Ga0501043_0374103
459 Ga0501046_0014006
460 Ga0501046_0455081
461 Ga0501047_0441217
462 Ga0501047_0566322
463 Ga0501048_0058296
464 Ga0501048_0292965
465 Ga0501069_0028787
466 Ga0501069_0739772
467 Ga0501069_0783335
468 Ga0501070_0101510
469 Ga0501070_1127723
470 Ga0501071_0031385
471 Ga0501071_0180291
472 Ga0501071_0234196
473 Ga0501072_0091252
474 Ga0501072_0240891
475 Ga0501072_0406769
476 Ga0501073_0028795
477 Ga0501074_0517152
478 Ga0501075_0316851
479 Ga0501076_0081187
480 Ga0501076_0257201
481 Ga0501077_0067457
482 Ga0501077_0395697
483 Ga0501079_0375178
484 Ga0501079_0731223
485 Ga0501080_0005214
486 Ga0501080_0429427
487 Ga0501080_1389647
488 Ga0501081_0015333
489 Ga0501081_0138352
490 Ga0501083_0734911
491 Ga0501035_0243082
492 Ga0501035_0320632
493 Ga0501035_0477047
494 Ga0501035_0924358
495 Ga0501035_1036706
496 Ga0501044_0001147
497 Ga0501044_0201104
498 Ga0501045_0030072
499 Ga0501045_0593548
500 nmdc:mga03n38_3200_c1
501 nmdc:mga03n38_58045_c1
502 nmdc:mga00v17_29213_c1
503 nmdc:mga0yw44_57136_c1
504 nmdc:mga0yw44_88507_c1
505 nmdc:mga06z11_17253_c1
506 nmdc:mga06z11_22036_c1
507 nmdc:mga06z11_5261_c1
508 nmdc:mga04h51_4861_c1
509 nmdc:mga05p37_209650_c1
510 nmdc:mga05p37_399953_c1
511 nmdc:mga09592_1212179_c1
512 nmdc:mga0qj67_678576_c1
513 nmdc:mga06r32_1256340_c1
514 nmdc:mga06r32_74587_c1
515 nmdc:mga08y16_1109712_c1
516 nmdc:mga08y16_311267_c1
517 nmdc:mga08y16_357223_c1
518 nmdc:mga08y16_430816_c1
519 nmdc:mga08y16_69085_c1
520 nmdc:mga08y16_75099_c1
521 nmdc:mga0n895_109890_c1
522 nmdc:mga0n895_32420_c1
523 nmdc:mga0n895_744627_c1
524 nmdc:mga0rr50_156782_c1
525 nmdc:mga0a205_390611_c2
526 nmdc:mga0a205_8008_c1
527 Ga0500622_0032180
528 Ga0501082_0128226
529 Ga0501082_0199646
530 Ga0501082_0209859
531 Ga0501082_0380958
532 Ga0501082_0895029
533 Ga0501082_0919523
534 Ga0466962_0162134
535 Ga0530510_0132046
536 Ga0530510_0291408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

12

138

0.96

Map