F375558

General Info

Members Datasets Scaffolds Average Seq Length
268 165 536 206

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10077758|Ga0207699_100777582
Length 236
Sequence MDSAAIAQWLIVAAIAAASAIVRKAMRGVIQSRPMRGNLFVVVAPSGAGKTSLVAALLKEEPNIRLSISHTTRAPREGEQHGREYHFVDRPAFEKMIAAGDFLEHADVYGNYYGTSRKWIEEQLEGDHDVLLEIDWQGARQVRKLFPAMVGIFILPPSLAELRKRLLSRGKDAPEAIEKRMASARNEISHVLEFEYIIVNERFEAALTDLVSIVRAARVSRAQQSVRLASRLDEFK

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0
Rhizoplane 0.37
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10077758 3300025906 Bacteria 2048
2 Ga0070658_10005022 3300005327 Bacteria 10770
3 Ga0070658_10040649 3300005327 Bacteria 3752
4 Ga0070683_100113912 3300005329 Bacteria 2552
5 Ga0070683_100118782 3300005329 Bacteria 2497
6 Ga0070690_100062282 3300005330 Bacteria 2405
7 Ga0070670_101102161 3300005331 Bacteria 724
8 Ga0068868_100103219 3300005338 Bacteria 2309
9 Ga0068868_100251533 3300005338 Bacteria 1487
10 Ga0070689_100067833 3300005340 Bacteria 2781
11 Ga0070691_10208144 3300005341 Bacteria 1031
12 Ga0070687_100054436 3300005343 Bacteria 2085
13 Ga0070687_100110891 3300005343 Bacteria 1552
14 Ga0070687_100639723 3300005343 Bacteria 736
15 Ga0070692_10077063 3300005345 Bacteria 1788
16 Ga0070669_100775176 3300005353 Bacteria 814
17 Ga0070674_100032752 3300005356 Bacteria 3453
18 Ga0070659_100940519 3300005366 Bacteria 757
19 Ga0070709_10322246 3300005434 Bacteria 1134
20 Ga0070714_100100729 3300005435 Bacteria 2545
21 Ga0070713_100833673 3300005436 Bacteria 885
22 Ga0070705_100078201 3300005440 Bacteria 2023
23 Ga0070694_100089805 3300005444 Bacteria 2153
24 Ga0070694_100667300 3300005444 Bacteria 843
25 Ga0070678_100076840 3300005456 Bacteria 2517
26 Ga0070681_10006286 3300005458 Bacteria 11547
27 Ga0070681_10958680 3300005458 Bacteria 775
28 Ga0068867_100621486 3300005459 Bacteria 945
29 Ga0070699_100153780 3300005518 Bacteria 2035
30 Ga0070679_100269590 3300005530 Bacteria 1657
31 Ga0068853_100044530 3300005539 Bacteria 3799
32 Ga0070686_100602866 3300005544 Bacteria 865
33 Ga0070695_100649181 3300005545 Bacteria 833
34 Ga0070693_100001399 3300005547 Bacteria 10861
35 Ga0070693_100103585 3300005547 Bacteria 1738
36 Ga0070693_100219086 3300005547 Bacteria 1246
37 Ga0070665_100031154 3300005548 Bacteria 5368
38 Ga0070704_100556650 3300005549 Bacteria 1003
39 Ga0068855_100023230 3300005563 Bacteria 7427
40 Ga0068855_100081249 3300005563 Bacteria 3757
41 Ga0068855_100155101 3300005563 Bacteria 2602
42 Ga0068855_100614645 3300005563 Bacteria 1171
43 Ga0068857_100521101 3300005577 Bacteria 1117
44 Ga0068854_100426609 3300005578 Bacteria 1102
45 Ga0068854_100887753 3300005578 Bacteria 783
46 Ga0068856_100141205 3300005614 Bacteria 2416
47 Ga0068856_100240785 3300005614 Bacteria 1824
48 Ga0068856_100826606 3300005614 Bacteria 946
49 Ga0068852_100000254 3300005616 Bacteria 36057
50 Ga0068852_100048359 3300005616 Bacteria 3633
51 Ga0068852_100089946 3300005616 Bacteria 2744
52 Ga0068859_100059937 3300005617 Bacteria 3835
53 Ga0068859_100095613 3300005617 Bacteria 3023
54 Ga0068859_100816473 3300005617 Bacteria 1019
55 Ga0068859_101513925 3300005617 Bacteria 740
56 Ga0068864_100350307 3300005618 Bacteria 1393
57 Ga0068861_100259245 3300005719 Bacteria 1488
58 Ga0068851_10003941 3300005834 Bacteria 6644
59 Ga0068863_100484379 3300005841 Bacteria 1217
60 Ga0068858_100009708 3300005842 Bacteria 9166
61 Ga0068858_100021917 3300005842 Bacteria 5967
62 Ga0068858_100049712 3300005842 Bacteria 3882
63 Ga0075364_10061955 3300006051 Bacteria 2454
64 Ga0070715_10101822 3300006163 Bacteria 1341
65 Ga0070716_100254143 3300006173 Bacteria 1199
66 Ga0070712_100574656 3300006175 Bacteria 952
67 Ga0075369_10013957 3300006186 Bacteria 3200
68 Ga0075366_10032700 3300006195 Bacteria 3062
69 Ga0075366_10157323 3300006195 Bacteria 1376
70 Ga0075366_10157942 3300006195 Bacteria 1374
71 Ga0075366_10181623 3300006195 Bacteria 1278
72 Ga0075366_10298315 3300006195 Bacteria 986
73 Ga0097621_100075691 3300006237 Bacteria 2791
74 Ga0097621_100957058 3300006237 Bacteria 799
75 Ga0068871_100034780 3300006358 Bacteria 4000
76 Ga0068871_100044385 3300006358 Bacteria 3575
77 Ga0068871_100060896 3300006358 Bacteria 3080
78 Ga0075428_100022989 3300006844 Bacteria 6900
79 Ga0075433_10141126 3300006852 Bacteria 2141
80 Ga0075434_100123376 3300006871 Bacteria 2606
81 Ga0075434_101281156 3300006871 Bacteria 744
82 Ga0068865_100019625 3300006881 Bacteria 4376
83 Ga0068865_100132446 3300006881 Bacteria 1869
84 Ga0075436_100003705 3300006914 Bacteria 10474
85 Ga0097620_100059937 3300006931 Bacteria 3835
86 Ga0097620_100095621 3300006931 Bacteria 3023
87 Ga0097620_100816518 3300006931 Bacteria 1019
88 Ga0097620_101513909 3300006931 Bacteria 740
89 Ga0075435_100236542 3300007076 Bacteria 1552
90 Ga0075435_100438451 3300007076 Bacteria 1126
91 Ga0099794_10341294 3300007265 Bacteria 778
92 Ga0105240_10002504 3300009093 Bacteria 29518
93 Ga0105240_10060727 3300009093 Bacteria 4712
94 Ga0105240_10100408 3300009093 Bacteria 3521
95 Ga0105240_11453627 3300009093 Bacteria 720
96 Ga0111539_10001826 3300009094 Bacteria 28335
97 Ga0105245_10553231 3300009098 Bacteria 1173
98 Ga0105245_11143196 3300009098 Bacteria 826
99 Ga0105243_10447661 3300009148 Bacteria 1211
100 Ga0105243_10615234 3300009148 Bacteria 1048
101 Ga0105241_10016356 3300009174 Bacteria 5440
102 Ga0105241_11201451 3300009174 Bacteria 718
103 Ga0105242_10002431 3300009176 Bacteria 14628
104 Ga0105242_10024991 3300009176 Bacteria 4721
105 Ga0105242_10067116 3300009176 Bacteria 2964
106 Ga0105248_10089910 3300009177 Bacteria 3457
107 Ga0105248_10186538 3300009177 Bacteria 2337
108 Ga0105248_10404456 3300009177 Bacteria 1537
109 Ga0105248_10442498 3300009177 Bacteria 1464
110 Ga0105248_11757171 3300009177 Bacteria 703
111 Ga0105238_10003153 3300009551 Bacteria 16457
112 Ga0105238_10006999 3300009551 Bacteria 11277
113 Ga0105238_10534609 3300009551 Bacteria 1176
114 Ga0105238_10993917 3300009551 Bacteria 860
115 Ga0105249_10018356 3300009553 Bacteria 6220
116 Ga0157370_10008824 3300013104 Bacteria 10835
117 Ga0157369_10048504 3300013105 Bacteria 4608
118 Ga0157369_10060325 3300013105 Bacteria 4090
119 Ga0157374_10033582 3300013296 Bacteria 4682
120 Ga0157374_10108097 3300013296 Bacteria 2673
121 Ga0157378_10217643 3300013297 Bacteria 1814
122 Ga0157378_10433478 3300013297 Bacteria 1301
123 Ga0163162_10040360 3300013306 Bacteria 4667
124 Ga0163162_10097020 3300013306 Bacteria 3036
125 Ga0163162_10210244 3300013306 Bacteria 2075
126 Ga0163162_10256686 3300013306 Bacteria 1880
127 Ga0163162_10869946 3300013306 Bacteria 1016
128 Ga0157372_10007681 3300013307 Bacteria 11473
129 Ga0157372_10037707 3300013307 Bacteria 5332
130 Ga0157375_10425053 3300013308 Bacteria 1494
131 Ga0157380_10395468 3300014326 Bacteria 1309
132 Ga0157380_10772096 3300014326 Bacteria 975
133 Ga0157379_10038616 3300014968 Bacteria 4259
134 Ga0157376_10293535 3300014969 Bacteria 1536
135 Ga0157376_10843771 3300014969 Bacteria 931
136 Ga0157376_11293939 3300014969 Bacteria 759
137 Ga0213872_10003475 3300021361 Bacteria 8735
138 Ga0213872_10032883 3300021361 Bacteria 2377
139 Ga0207656_10006269 3300025321 Bacteria 4261
140 Ga0207705_10121584 3300025909 Bacteria 1938
141 Ga0207707_10049819 3300025912 Bacteria 3649
142 Ga0207695_10001050 3300025913 Bacteria 48496
143 Ga0207695_10124369 3300025913 Bacteria 2543
144 Ga0207695_10130740 3300025913 Bacteria 2468
145 Ga0207695_10276563 3300025913 Bacteria 1573
146 Ga0207660_10065229 3300025917 Bacteria 2631
147 Ga0207662_10121566 3300025918 Bacteria 1638
148 Ga0207657_10433720 3300025919 Bacteria 1032
149 Ga0207649_10148661 3300025920 Bacteria 1611
150 Ga0207649_10790006 3300025920 Bacteria 740
151 Ga0207652_10158554 3300025921 Bacteria 2028
152 Ga0207694_10017268 3300025924 Bacteria 5454
153 Ga0207694_10018890 3300025924 Bacteria 5211
154 Ga0207650_10174622 3300025925 Bacteria 1710
155 Ga0207687_10229588 3300025927 Bacteria 1466
156 Ga0207700_10029600 3300025928 Bacteria 3866
157 Ga0207664_10179638 3300025929 Bacteria 1816
158 Ga0207664_10710414 3300025929 Bacteria 904
159 Ga0207686_10019518 3300025934 Bacteria 3858
160 Ga0207686_10071175 3300025934 Bacteria 2237
161 Ga0207686_10559590 3300025934 Bacteria 895
162 Ga0207670_10185359 3300025936 Bacteria 1570
163 Ga0207670_10432387 3300025936 Bacteria 1058
164 Ga0207669_10476663 3300025937 Bacteria 994
165 Ga0207704_10115031 3300025938 Bacteria 1827
166 Ga0207665_10296719 3300025939 Bacteria 1207
167 Ga0207665_10682613 3300025939 Bacteria 807
168 Ga0207711_10320095 3300025941 Bacteria 1433
169 Ga0207711_10330113 3300025941 Bacteria 1410
170 Ga0207667_10001019 3300025949 Bacteria 35713
171 Ga0207667_10004089 3300025949 Bacteria 17920
172 Ga0207667_10146769 3300025949 Bacteria 2428
173 Ga0207667_10148424 3300025949 Bacteria 2413
174 Ga0207651_10485186 3300025960 Bacteria 1066
175 Ga0207640_10082397 3300025981 Bacteria 2203
176 Ga0207640_10287468 3300025981 Bacteria 1295
177 Ga0207677_10438802 3300026023 Bacteria 1116
178 Ga0207703_10037702 3300026035 Bacteria 3852
179 Ga0207639_10029147 3300026041 Bacteria 4038
180 Ga0207639_10054031 3300026041 Bacteria 3068
181 Ga0207639_10309213 3300026041 Bacteria 1399
182 Ga0207708_10174453 3300026075 Bacteria 1704
183 Ga0207708_10258822 3300026075 Bacteria 1404
184 Ga0207702_10063288 3300026078 Bacteria 3163
185 Ga0207648_10250422 3300026089 Bacteria 1579
186 Ga0207648_10372040 3300026089 Bacteria 1291
187 Ga0207676_10114460 3300026095 Bacteria 2263
188 Ga0207676_10436178 3300026095 Bacteria 1232
189 Ga0207675_100253068 3300026118 Bacteria 1705
190 Ga0207675_100709160 3300026118 Bacteria 1015
191 Ga0207675_100972285 3300026118 Bacteria 867
192 Ga0207698_10068836 3300026142 Bacteria 2797
193 Ga0207698_10070593 3300026142 Bacteria 2768
194 Ga0207698_10198187 3300026142 Bacteria 1795
195 Ga0209966_1019830 3300027695 Bacteria 1298
196 Ga0209974_10091995 3300027876 Bacteria 1053
197 Ga0207428_10035428 3300027907 Bacteria 4079
198 Ga0268266_10061495 3300028379 Bacteria 3239
199 Ga0268266_10203399 3300028379 Bacteria 1813
200 Ga0268266_10881591 3300028379 Bacteria 865
201 Ga0307408_100065400 3300031548 Bacteria 2667
202 Ga0307408_100135681 3300031548 Bacteria 1925
203 Ga0307408_100228658 3300031548 Bacteria 1522
204 Ga0307408_100679892 3300031548 Bacteria 923
205 Ga0307405_10040686 3300031731 Bacteria 2817
206 Ga0307405_10781254 3300031731 Bacteria 798
207 Ga0307413_10433096 3300031824 Bacteria 1039
208 Ga0307413_10651735 3300031824 Bacteria 869
209 Ga0307416_100138328 3300032002 Bacteria 2208
210 Ga0307416_100395179 3300032002 Bacteria 1418
211 Ga0307414_10025687 3300032004 Bacteria 3778
212 Ga0307411_10438196 3300032005 Bacteria 1090
213 Ga0373932_0013278 3300035112 Bacteria 2045
214 Ga0373931_0092006 3300035691 Bacteria 1691
215 Ga0373931_0289209 3300035691 Bacteria 1009
216 Ga0373935_0153457 3300035692 Bacteria 1565
217 Ga0373927_0124282 3300035695 Bacteria 1684
218 Ga0373933_0060972 3300035724 Bacteria 2275
219 Ga0373947_0122672 3300035725 Bacteria 1652
220 Ga0373925_0009256 3300037068 Bacteria 7171
221 Ga0373925_0286463 3300037068 Bacteria 1328
222 Ga0395899_0103459 3300037312 Bacteria 2054
223 Ga0395900_0020474 3300037418 Bacteria 6753
224 Ga0395905_0005551 3300037471 Bacteria 12861
225 Ga0395901_0016610 3300038443 Bacteria 7501
226 Ga0436365_1790082 3300039437 Bacteria 2827
227 Ga0436365_1857817 3300039437 Bacteria 1457
228 Ga0436361_0046034 3300039447 Bacteria 13131
229 Ga0436361_0670155 3300039447 Bacteria 2088
230 Ga0436361_0763525 3300039447 Bacteria 48860
231 Ga0453683_0530080 3300044673 Bacteria 765
232 Ga0453684_0535670 3300044712 Bacteria 1292
233 Ga0466958_0010072 3300045836 Bacteria 5284
234 Ga0495592_0016577 3300046454 Bacteria 5593
235 Ga0495603_0106958 3300046455 Bacteria 1633
236 Ga0495653_0051081 3300046463 Bacteria 3176
237 Ga0495608_0112454 3300046511 Bacteria 1750
238 Ga0495628_0283276 3300046516 Bacteria 1230
239 Ga0495621_0003883 3300046539 Bacteria 4150
240 Ga0495621_0008118 3300046539 Bacteria 3134
241 Ga0495645_0007835 3300046543 Bacteria 7434
242 Ga0495667_0009419 3300046559 Bacteria 6616
243 Ga0495599_0014782 3300046678 Bacteria 4833
244 Ga0495646_0182562 3300046680 Bacteria 1151
245 Ga0495647_0141642 3300046681 Bacteria 1026
246 Ga0496104_0012785 3300048907 Bacteria 7562
247 Ga0501047_0084279 3300049581 Bacteria 3055
248 Ga0501070_0004850 3300049586 Bacteria 11492
249 Ga0501072_0576286 3300049588 Bacteria 888
250 Ga0501074_0607614 3300049590 Bacteria 773
251 Ga0501080_0267104 3300049742 Bacteria 1558
252 Ga0501080_1104890 3300049742 Bacteria 684
253 Ga0501044_0098544 3300049823 Bacteria 2943
254 nmdc:mga00v17_68124_c1 3300050491 Bacteria 2200
255 nmdc:mga0k408_411836_c1 3300050493 Bacteria 804
256 nmdc:mga0k408_45369_c1 3300050493 Bacteria 2536
257 nmdc:mga08y16_5125_c1 3300050511 Bacteria 13695
258 nmdc:mga0n895_56934_c1 3300050512 Bacteria 3853
259 nmdc:mga0rr50_397104_c1 3300050513 Bacteria 1164
260 nmdc:mga0rr50_757368_c1 3300050513 Bacteria 829
261 nmdc:mga08x19_46758_c1 3300050514 Bacteria 2769
262 nmdc:mga0sz30_5278_c1 3300050516 Bacteria 4731
263 Ga0495619_0014168 3300053085 Bacteria 5035
264 Ga0500651_0283937 3300053093 Bacteria 954
265 Ga0500641_0033240 3300053096 Bacteria 2046
266 Ga0501082_0731109 3300060353 Bacteria 866
267 Ga0466962_0042871 3300061719 Bacteria 2166
268 2998348282 2998344455 Bacteria 4222996
269 Ga0207699_10077758
270 Ga0070658_10005022
271 Ga0070658_10040649
272 Ga0070683_100113912
273 Ga0070683_100118782
274 Ga0070690_100062282
275 Ga0070670_101102161
276 Ga0068868_100103219
277 Ga0068868_100251533
278 Ga0070689_100067833
279 Ga0070691_10208144
280 Ga0070687_100054436
281 Ga0070687_100110891
282 Ga0070687_100639723
283 Ga0070692_10077063
284 Ga0070669_100775176
285 Ga0070674_100032752
286 Ga0070659_100940519
287 Ga0070709_10322246
288 Ga0070714_100100729
289 Ga0070713_100833673
290 Ga0070705_100078201
291 Ga0070694_100089805
292 Ga0070694_100667300
293 Ga0070678_100076840
294 Ga0070681_10006286
295 Ga0070681_10958680
296 Ga0068867_100621486
297 Ga0070699_100153780
298 Ga0070679_100269590
299 Ga0068853_100044530
300 Ga0070686_100602866
301 Ga0070695_100649181
302 Ga0070693_100001399
303 Ga0070693_100103585
304 Ga0070693_100219086
305 Ga0070665_100031154
306 Ga0070704_100556650
307 Ga0068855_100023230
308 Ga0068855_100081249
309 Ga0068855_100155101
310 Ga0068855_100614645
311 Ga0068857_100521101
312 Ga0068854_100426609
313 Ga0068854_100887753
314 Ga0068856_100141205
315 Ga0068856_100240785
316 Ga0068856_100826606
317 Ga0068852_100000254
318 Ga0068852_100048359
319 Ga0068852_100089946
320 Ga0068859_100059937
321 Ga0068859_100095613
322 Ga0068859_100816473
323 Ga0068859_101513925
324 Ga0068864_100350307
325 Ga0068861_100259245
326 Ga0068851_10003941
327 Ga0068863_100484379
328 Ga0068858_100009708
329 Ga0068858_100021917
330 Ga0068858_100049712
331 Ga0075364_10061955
332 Ga0070715_10101822
333 Ga0070716_100254143
334 Ga0070712_100574656
335 Ga0075369_10013957
336 Ga0075366_10032700
337 Ga0075366_10157323
338 Ga0075366_10157942
339 Ga0075366_10181623
340 Ga0075366_10298315
341 Ga0097621_100075691
342 Ga0097621_100957058
343 Ga0068871_100034780
344 Ga0068871_100044385
345 Ga0068871_100060896
346 Ga0075428_100022989
347 Ga0075433_10141126
348 Ga0075434_100123376
349 Ga0075434_101281156
350 Ga0068865_100019625
351 Ga0068865_100132446
352 Ga0075436_100003705
353 Ga0097620_100059937
354 Ga0097620_100095621
355 Ga0097620_100816518
356 Ga0097620_101513909
357 Ga0075435_100236542
358 Ga0075435_100438451
359 Ga0099794_10341294
360 Ga0105240_10002504
361 Ga0105240_10060727
362 Ga0105240_10100408
363 Ga0105240_11453627
364 Ga0111539_10001826
365 Ga0105245_10553231
366 Ga0105245_11143196
367 Ga0105243_10447661
368 Ga0105243_10615234
369 Ga0105241_10016356
370 Ga0105241_11201451
371 Ga0105242_10002431
372 Ga0105242_10024991
373 Ga0105242_10067116
374 Ga0105248_10089910
375 Ga0105248_10186538
376 Ga0105248_10404456
377 Ga0105248_10442498
378 Ga0105248_11757171
379 Ga0105238_10003153
380 Ga0105238_10006999
381 Ga0105238_10534609
382 Ga0105238_10993917
383 Ga0105249_10018356
384 Ga0157370_10008824
385 Ga0157369_10048504
386 Ga0157369_10060325
387 Ga0157374_10033582
388 Ga0157374_10108097
389 Ga0157378_10217643
390 Ga0157378_10433478
391 Ga0163162_10040360
392 Ga0163162_10097020
393 Ga0163162_10210244
394 Ga0163162_10256686
395 Ga0163162_10869946
396 Ga0157372_10007681
397 Ga0157372_10037707
398 Ga0157375_10425053
399 Ga0157380_10395468
400 Ga0157380_10772096
401 Ga0157379_10038616
402 Ga0157376_10293535
403 Ga0157376_10843771
404 Ga0157376_11293939
405 Ga0213872_10003475
406 Ga0213872_10032883
407 Ga0207656_10006269
408 Ga0207705_10121584
409 Ga0207707_10049819
410 Ga0207695_10001050
411 Ga0207695_10124369
412 Ga0207695_10130740
413 Ga0207695_10276563
414 Ga0207660_10065229
415 Ga0207662_10121566
416 Ga0207657_10433720
417 Ga0207649_10148661
418 Ga0207649_10790006
419 Ga0207652_10158554
420 Ga0207694_10017268
421 Ga0207694_10018890
422 Ga0207650_10174622
423 Ga0207687_10229588
424 Ga0207700_10029600
425 Ga0207664_10179638
426 Ga0207664_10710414
427 Ga0207686_10019518
428 Ga0207686_10071175
429 Ga0207686_10559590
430 Ga0207670_10185359
431 Ga0207670_10432387
432 Ga0207669_10476663
433 Ga0207704_10115031
434 Ga0207665_10296719
435 Ga0207665_10682613
436 Ga0207711_10320095
437 Ga0207711_10330113
438 Ga0207667_10001019
439 Ga0207667_10004089
440 Ga0207667_10146769
441 Ga0207667_10148424
442 Ga0207651_10485186
443 Ga0207640_10082397
444 Ga0207640_10287468
445 Ga0207677_10438802
446 Ga0207703_10037702
447 Ga0207639_10029147
448 Ga0207639_10054031
449 Ga0207639_10309213
450 Ga0207708_10174453
451 Ga0207708_10258822
452 Ga0207702_10063288
453 Ga0207648_10250422
454 Ga0207648_10372040
455 Ga0207676_10114460
456 Ga0207676_10436178
457 Ga0207675_100253068
458 Ga0207675_100709160
459 Ga0207675_100972285
460 Ga0207698_10068836
461 Ga0207698_10070593
462 Ga0207698_10198187
463 Ga0209966_1019830
464 Ga0209974_10091995
465 Ga0207428_10035428
466 Ga0268266_10061495
467 Ga0268266_10203399
468 Ga0268266_10881591
469 Ga0307408_100065400
470 Ga0307408_100135681
471 Ga0307408_100228658
472 Ga0307408_100679892
473 Ga0307405_10040686
474 Ga0307405_10781254
475 Ga0307413_10433096
476 Ga0307413_10651735
477 Ga0307416_100138328
478 Ga0307416_100395179
479 Ga0307414_10025687
480 Ga0307411_10438196
481 Ga0373932_0013278
482 Ga0373931_0092006
483 Ga0373931_0289209
484 Ga0373935_0153457
485 Ga0373927_0124282
486 Ga0373933_0060972
487 Ga0373947_0122672
488 Ga0373925_0009256
489 Ga0373925_0286463
490 Ga0395899_0103459
491 Ga0395900_0020474
492 Ga0395905_0005551
493 Ga0395901_0016610
494 Ga0436365_1790082
495 Ga0436365_1857817
496 Ga0436361_0046034
497 Ga0436361_0670155
498 Ga0436361_0763525
499 Ga0453683_0530080
500 Ga0453684_0535670
501 Ga0466958_0010072
502 Ga0495592_0016577
503 Ga0495603_0106958
504 Ga0495653_0051081
505 Ga0495608_0112454
506 Ga0495628_0283276
507 Ga0495621_0003883
508 Ga0495621_0008118
509 Ga0495645_0007835
510 Ga0495667_0009419
511 Ga0495599_0014782
512 Ga0495646_0182562
513 Ga0495647_0141642
514 Ga0496104_0012785
515 Ga0501047_0084279
516 Ga0501070_0004850
517 Ga0501072_0576286
518 Ga0501074_0607614
519 Ga0501080_0267104
520 Ga0501080_1104890
521 Ga0501044_0098544
522 nmdc:mga00v17_68124_c1
523 nmdc:mga0k408_411836_c1
524 nmdc:mga0k408_45369_c1
525 nmdc:mga08y16_5125_c1
526 nmdc:mga0n895_56934_c1
527 nmdc:mga0rr50_397104_c1
528 nmdc:mga0rr50_757368_c1
529 nmdc:mga08x19_46758_c1
530 nmdc:mga0sz30_5278_c1
531 Ga0495619_0014168
532 Ga0500651_0283937
533 Ga0500641_0033240
534 Ga0501082_0731109
535 Ga0466962_0042871
536 2998348282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

36

217

0.97

PF01926

MMR_HSR1

50S ribosome-binding GTPase

40

230

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9562 33 83
2f3t-assembly1.cif.gz_B crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.9252 1 201
2anc-assembly1.cif.gz_F crystal structure of unliganded form of oligomeric e.coli guanylate kinase 0.9144 1 201
2f3t-assembly1.cif.gz_B crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.9122 1 201
2anc-assembly1.cif.gz_F crystal structure of unliganded form of oligomeric e.coli guanylate kinase 0.8974 1 201
ID Description Score Start End Superfamily
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9945 34 83 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9798 34 80 3.30.63.10
af_Q5TCQ9_142_196_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9738 33 83 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9566 34 83 3.30.63.10
3tauB02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9476 34 92 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A5R1YG79-F1-model_v4 Guanylate kinase (EC 2.7.4.8) 0.9703 103 201 GO:0004385
GO:0005829
AF-A0A432HKH5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9594 2 185 GO:0004385
GO:0005524
GO:0005829
AF-A0A7Y3GJY2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9572 1 185 GO:0004385
GO:0005524
GO:0005829
AF-A0A378JR90-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9559 2 185 GO:0004385
GO:0005524
GO:0005829
AF-A0A3N5ZKM0-F1-model_v4 Guanylate kinase 0.953 82 201 GO:0004385
GO:0005829

Map