F375328

General Info

Members Datasets Scaffolds Average Seq Length
268 207 536 310

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100052118|Ga0070708_1000521182
Length 333
Sequence MEYSNTPLFSMSILVLAEHDNVALKPATQHTISAGTKISEKGGNPEVHVLVVGEDVQGVAQASARVAGVNKVFLADAPHLGAQTAEAVAAQVLQHIQMGDYSHVLAPATTFGKNLLPRVAARLDVQQISGIIDVLTVDTFIRPIYAGNALATVQSAADAIKVLTVLSTGFDAAAVAQGNAPIESVKEIVNDPSGTRLLGRQLSSGEKLELTAARVVVSGGRGLQKAENFKLLEALAAKLNAAVGASRAAVDAGFVPNDYQVGQTGKIVAPDLYIAVGISGAIQHLAGMRDSKVIVAINKDPDAPIFQVADYGLVGDALEILPQLTARLSADLC

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
58 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
194 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
195 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
196 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
197 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
198 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
199 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
200 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
201 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
202 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
203 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
204 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
205 2941471342 Luteibacter sp. 621 Isolate Unclassified
206 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
207 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.54
Metatranscriptomes 1.49
Isolates 5.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0.75
Rhizoplane 7.46
Rhizosphere 75.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100052118 3300005445 Bacteria 3627
2 JGI24738J21930_10023435 3300002075 Bacteria 1272
3 rootH2_10083710 3300003320 Bacteria 10192
4 rootH1_10258515 3300003323 Bacteria 2073
5 Ga0007409J51694_1036138 3300003575 Bacteria 4304
6 Ga0007416J51690_1033158 3300003577 Bacteria 4556
7 Ga0055532_1000892 3300003758 Bacteria 9892
8 Ga0070683_100068691 3300005329 Bacteria 3302
9 Ga0070670_100152433 3300005331 Bacteria 2001
10 Ga0070680_100005807 3300005336 Bacteria 9366
11 Ga0070680_100150612 3300005336 Bacteria 1953
12 Ga0070660_100327842 3300005339 Bacteria 1258
13 Ga0070661_100006302 3300005344 Bacteria 8182
14 Ga0070661_100053473 3300005344 Bacteria 2956
15 Ga0070669_100267162 3300005353 Bacteria 1367
16 Ga0070675_100028350 3300005354 Bacteria 4507
17 Ga0070671_100007991 3300005355 Bacteria 8466
18 Ga0070671_100170443 3300005355 Bacteria 1841
19 Ga0070673_100024384 3300005364 Bacteria 4435
20 Ga0070659_100007079 3300005366 Bacteria 8130
21 Ga0070659_100304372 3300005366 Bacteria 1330
22 Ga0070667_100384058 3300005367 Bacteria 1276
23 Ga0070709_10272537 3300005434 Bacteria 1227
24 Ga0070714_100035864 3300005435 Bacteria 4157
25 Ga0070711_100015311 3300005439 Bacteria 4854
26 Ga0070711_100238338 3300005439 Bacteria 1421
27 Ga0070662_100000512 3300005457 Bacteria 23310
28 Ga0070662_100206909 3300005457 Bacteria 1560
29 Ga0070681_10060119 3300005458 Bacteria 3778
30 Ga0070698_100003313 3300005471 Bacteria 17719
31 Ga0070699_100024597 3300005518 Bacteria 5191
32 Ga0070697_100496744 3300005536 Bacteria 1066
33 Ga0068853_100055328 3300005539 Bacteria 3420
34 Ga0070672_100017642 3300005543 Bacteria 5142
35 Ga0070672_100028014 3300005543 Bacteria 4210
36 Ga0068855_100000453 3300005563 Bacteria 50677
37 Ga0070664_100133031 3300005564 Bacteria 2185
38 Ga0068857_100023506 3300005577 Bacteria 5426
39 Ga0068857_100120823 3300005577 Bacteria 2358
40 Ga0068856_100001447 3300005614 Bacteria 24887
41 Ga0068851_10137775 3300005834 Bacteria 1325
42 Ga0081539_10025023 3300005985 Bacteria 3857
43 Ga0070717_10285854 3300006028 Bacteria 1463
44 Ga0097621_100143258 3300006237 Bacteria 2044
45 Ga0075430_100022633 3300006846 Bacteria 5347
46 Ga0075431_100001586 3300006847 Bacteria 21155
47 Ga0075431_100054765 3300006847 Bacteria 4113
48 Ga0075431_100270747 3300006847 Bacteria 1721
49 Ga0075429_100017886 3300006880 Bacteria 6128
50 Ga0075435_100143120 3300007076 Bacteria 2007
51 Ga0105251_10026077 3300009011 Bacteria 2980
52 Ga0105240_10119382 3300009093 Bacteria 3176
53 Ga0105241_10030695 3300009174 Bacteria 4019
54 Ga0105248_10001399 3300009177 Bacteria 26936
55 Ga0105237_10017259 3300009545 Bacteria 7484
56 Ga0157373_10002315 3300013100 Bacteria 14434
57 Ga0157371_10002105 3300013102 Bacteria 19423
58 Ga0157370_10000308 3300013104 Bacteria 61300
59 Ga0157370_10000495 3300013104 Bacteria 48993
60 Ga0157370_10007149 3300013104 Bacteria 12179
61 Ga0157369_10000464 3300013105 Bacteria 53767
62 Ga0157369_10157204 3300013105 Bacteria 2401
63 Ga0157369_10167853 3300013105 Bacteria 2313
64 Ga0163162_10103284 3300013306 Bacteria 2944
65 Ga0163162_10512937 3300013306 Bacteria 1329
66 Ga0157372_10012702 3300013307 Bacteria 8970
67 Ga0157372_10231432 3300013307 Bacteria 2143
68 Ga0157375_10247855 3300013308 Bacteria 1942
69 Ga0157376_10173236 3300014969 Bacteria 1967
70 Ga0182006_1003010 3300015261 Bacteria 8864
71 Ga0182005_1000064 3300015265 Bacteria 95976
72 Ga0213876_10010100 3300021384 Bacteria 5073
73 Ga0209435_102337 3300025206 Bacteria 2232
74 Ga0209147_100242 3300025229 Bacteria 53145
75 Ga0209148_1002731 3300025254 Bacteria 5613
76 Ga0209129_1002448 3300025258 Bacteria 9106
77 Ga0209758_1034921 3300025297 Bacteria 1990
78 Ga0207697_10035547 3300025315 Bacteria 2039
79 Ga0207680_10012992 3300025903 Bacteria 4259
80 Ga0207647_10000010 3300025904 Bacteria 174219
81 Ga0207699_10025473 3300025906 Bacteria 3248
82 Ga0207684_10111542 3300025910 Bacteria 2341
83 Ga0207684_10346838 3300025910 Bacteria 1278
84 Ga0207654_10035673 3300025911 Bacteria 2773
85 Ga0207671_10062696 3300025914 Bacteria 2761
86 Ga0207693_10071583 3300025915 Bacteria 2714
87 Ga0207657_10000409 3300025919 Bacteria 45340
88 Ga0207649_10364106 3300025920 Bacteria 1074
89 Ga0207681_10062214 3300025923 Bacteria 2569
90 Ga0207650_10124706 3300025925 Bacteria 2009
91 Ga0207659_10023091 3300025926 Bacteria 4148
92 Ga0207700_10266937 3300025928 Bacteria 1467
93 Ga0207664_10009338 3300025929 Bacteria 6876
94 Ga0207664_10051155 3300025929 Bacteria 3260
95 Ga0207644_10082441 3300025931 Bacteria 2379
96 Ga0207644_10149958 3300025931 Bacteria 1803
97 Ga0207690_10011214 3300025932 Bacteria 5351
98 Ga0207706_10000232 3300025933 Bacteria 60892
99 Ga0207706_10084840 3300025933 Bacteria 2785
100 Ga0207691_10053117 3300025940 Bacteria 3700
101 Ga0207711_10021773 3300025941 Bacteria 5354
102 Ga0207661_10107282 3300025944 Bacteria 2356
103 Ga0207679_10002888 3300025945 Bacteria 10658
104 Ga0207679_10017701 3300025945 Bacteria 4758
105 Ga0207667_10035108 3300025949 Bacteria 5380
106 Ga0207651_10081783 3300025960 Bacteria 2329
107 Ga0207651_10095402 3300025960 Bacteria 2190
108 Ga0207639_10029068 3300026041 Bacteria 4043
109 Ga0207702_10016629 3300026078 Bacteria 6087
110 Ga0207702_10509809 3300026078 Bacteria 1173
111 Ga0207648_10308128 3300026089 Bacteria 1421
112 Ga0207648_10482910 3300026089 Bacteria 1132
113 Ga0207674_10480271 3300026116 Bacteria 1201
114 Ga0207683_10131429 3300026121 Bacteria 2252
115 Ga0207698_10016553 3300026142 Bacteria 4975
116 Ga0210002_1005264 3300027617 Bacteria 1942
117 Ga0209983_1008752 3300027665 Bacteria 2066
118 Ga0209971_1014187 3300027682 Bacteria 1888
119 Ga0209974_10004711 3300027876 Bacteria 4846
120 Ga0265326_10019418 3300028558 Bacteria 1953
121 Ga0265334_10000088 3300028573 Bacteria 65739
122 Ga0265334_10021377 3300028573 Bacteria 2642
123 Ga0265323_10004666 3300028653 Bacteria 5881
124 Ga0265324_10012600 3300029957 Bacteria 3184
125 Ga0265325_10122153 3300031241 Bacteria 1254
126 Ga0265316_10110174 3300031344 Bacteria 2085
127 Ga0307513_10139992 3300031456 Bacteria 2348
128 Ga0307509_10000079 3300031507 Bacteria 135772
129 Ga0307509_10001090 3300031507 Bacteria 46488
130 Ga0307408_100029509 3300031548 Bacteria 3801
131 Ga0265313_10008436 3300031595 Bacteria 6842
132 Ga0265313_10037168 3300031595 Bacteria 2437
133 Ga0307508_10000306 3300031616 Bacteria 59403
134 Ga0307405_10002589 3300031731 Bacteria 8020
135 Ga0307413_10028792 3300031824 Bacteria 3100
136 Ga0307410_10017443 3300031852 Bacteria 4312
137 Ga0307406_10049422 3300031901 Bacteria 2661
138 Ga0307407_10289926 3300031903 Bacteria 1137
139 Ga0307412_10050730 3300031911 Bacteria 2740
140 Ga0307409_100008602 3300031995 Bacteria 6209
141 Ga0307409_100581114 3300031995 Bacteria 1104
142 Ga0307416_100085395 3300032002 Bacteria 2686
143 Ga0307411_10003144 3300032005 Bacteria 7573
144 Ga0316583_10009819 3300032133 Bacteria 3448
145 Ga0307510_10285819 3300033180 Bacteria 1117
146 Ga0373944_0061637 3300035089 Bacteria 1204
147 Ga0373927_0000002 3300035695 Bacteria 966219
148 Ga0373937_0101272 3300036401 Bacteria 2673
149 Ga0373925_0102897 3300037068 Bacteria 2198
150 Ga0395900_0180865 3300037418 Bacteria 2143
151 Ga0395905_0224395 3300037471 Bacteria 1758
152 Ga0436364_0098673 3300037853 Bacteria 6312
153 Ga0436365_0874983 3300039437 Bacteria 53988
154 Ga0436360_1178753 3300039438 Bacteria 8244
155 Ga0436361_0651539 3300039447 Bacteria 2316
156 Ga0436361_0727003 3300039447 Bacteria 1168
157 Ga0436363_0854040 3300039450 Bacteria 16936
158 Ga0439436_0000045 3300041404 Bacteria 37076
159 Ga0439447_033740 3300041407 Bacteria 1275
160 Ga0451837_0377822 3300041494 Bacteria 1334
161 Ga0451853_1660041 3300041512 Bacteria 2891
162 Ga0451577_0016740 3300042876 Bacteria 6781
163 Ga0451577_0019064 3300042876 Bacteria 6314
164 Ga0451577_0281787 3300042876 Bacteria 1506
165 Ga0466969_0094171 3300044656 Bacteria 1416
166 Ga0453684_0003290 3300044712 Bacteria 36831
167 Ga0451576_0001042 3300045051 Bacteria 51034
168 Ga0495629_0003891 3300046459 Bacteria 11242
169 Ga0495629_0161336 3300046459 Bacteria 1557
170 Ga0495653_0020962 3300046463 Bacteria 5296
171 Ga0495653_0097986 3300046463 Bacteria 2129
172 Ga0495580_0000024 3300046472 Bacteria 87183
173 Ga0495580_0003416 3300046472 Bacteria 13535
174 Ga0495580_0007478 3300046472 Bacteria 8778
175 Ga0495580_0029477 3300046472 Bacteria 3982
176 Ga0495582_0025557 3300046473 Bacteria 3235
177 Ga0495605_0005889 3300046474 Bacteria 7084
178 Ga0495605_0010166 3300046474 Bacteria 5269
179 Ga0495583_0009435 3300046506 Bacteria 5827
180 Ga0495583_0060586 3300046506 Bacteria 1692
181 Ga0495606_0131157 3300046507 Bacteria 1490
182 Ga0495610_0001679 3300046512 Bacteria 19452
183 Ga0495616_0010818 3300046513 Bacteria 5259
184 Ga0495628_0004869 3300046516 Bacteria 11820
185 Ga0495630_0036590 3300046517 Bacteria 3670
186 Ga0495630_0488257 3300046517 Bacteria 944
187 Ga0495648_0005758 3300046524 Bacteria 10223
188 Ga0495648_0030142 3300046524 Bacteria 3592
189 Ga0495666_0063900 3300046526 Bacteria 1757
190 Ga0495652_0208876 3300046529 Bacteria 1476
191 Ga0495665_0017770 3300046531 Bacteria 3822
192 Ga0495646_0058453 3300046680 Bacteria 2305
193 Ga0495624_0000067 3300046690 Bacteria 66836
194 Ga0495624_0003707 3300046690 Bacteria 11296
195 Ga0495671_0111515 3300046692 Bacteria 1336
196 Ga0495649_0071626 3300046694 Bacteria 1858
197 Ga0495589_0038918 3300046794 Bacteria 2378
198 Ga0495604_0036020 3300047317 Bacteria 3904
199 Ga0495674_0000035 3300047319 Bacteria 104643
200 Ga0495674_0010282 3300047319 Bacteria 8860
201 Ga0495672_0128656 3300047320 Bacteria 1335
202 Ga0495676_0027671 3300047321 Bacteria 4858
203 Ga0495683_0082775 3300047323 Bacteria 1563
204 Ga0495687_039991 3300047443 Bacteria 2070
205 Ga0495673_0008568 3300047469 Bacteria 5731
206 Ga0495593_0010943 3300047673 Bacteria 5224
207 Ga0495602_0010213 3300048088 Bacteria 9745
208 Ga0495602_0052828 3300048088 Bacteria 3605
209 Ga0496100_0039440 3300048903 Bacteria 2999
210 Ga0496101_0030406 3300048904 Bacteria 3786
211 Ga0496101_0035571 3300048904 Bacteria 3523
212 Ga0496101_0162366 3300048904 Bacteria 1714
213 Ga0496102_0003784 3300048905 Bacteria 12794
214 Ga0496102_0022384 3300048905 Bacteria 5599
215 Ga0496103_0009798 3300048906 Bacteria 5674
216 Ga0496104_0007802 3300048907 Bacteria 9487
217 Ga0496106_0005904 3300048909 Bacteria 9050
218 Ga0496106_0025719 3300048909 Bacteria 4382
219 Ga0496106_0136362 3300048909 Bacteria 1928
220 Ga0496107_0062964 3300048910 Bacteria 2688
221 Ga0496107_0281115 3300048910 Bacteria 1239
222 Ga0496109_0319212 3300048912 Bacteria 1466
223 Ga0496112_0153880 3300048915 Bacteria 2267
224 Ga0496112_0262010 3300048915 Bacteria 1678
225 Ga0496113_0000433 3300048916 Bacteria 20324
226 Ga0496113_0020450 3300048916 Bacteria 4653
227 Ga0496114_0036117 3300048917 Bacteria 4085
228 Ga0496115_0266588 3300048918 Bacteria 1408
229 Ga0496117_0012019 3300048920 Bacteria 7688
230 Ga0496117_0026540 3300048920 Bacteria 4531
231 Ga0496118_0002723 3300048921 Bacteria 23294
232 Ga0496121_0000071 3300048924 Bacteria 247039
233 Ga0496121_0002280 3300048924 Bacteria 29844
234 Ga0496121_0004741 3300048924 Bacteria 17950
235 Ga0496123_0033144 3300048926 Bacteria 3723
236 Ga0496124_0009714 3300048927 Bacteria 9848
237 Ga0496124_0021772 3300048927 Bacteria 5898
238 Ga0496125_0000545 3300048928 Bacteria 64939
239 Ga0496125_0007889 3300048928 Bacteria 11242
240 Ga0496126_0039442 3300048929 Bacteria 4382
241 Ga0496126_0046408 3300048929 Bacteria 3985
242 Ga0496126_0383184 3300048929 Bacteria 1144
243 Ga0501042_0200839 3300049578 Bacteria 1438
244 nmdc:mga09592_22108_c1 3300050508 Bacteria 5247
245 nmdc:mga0qj67_11715_c1 3300050509 Bacteria 6580
246 nmdc:mga0qj67_21702_c1 3300050509 Bacteria 4927
247 nmdc:mga06r32_7280_c1 3300050510 Bacteria 9966
248 nmdc:mga06r32_7930_c1 3300050510 Bacteria 9548
249 Ga0500618_026391 3300053125 Bacteria 1387
250 Ga0500568_0003163 3300053139 Bacteria 9375
251 Ga0587072_002463 3300059643 Bacteria 2477
252 Ga0587071_019526 3300060344 Bacteria 1227
253 2510246167 2510065045 Bacteria 7761063
254 2526212933 2526164512 Bacteria 4025691
255 2595447270 2593339238 Bacteria 4182970
256 2644030197 2643221603 Bacteria 6147767
257 2719637546 2718217991 Bacteria 7829542
258 2753568240 2751185846 Bacteria 7242164
259 2819565657 2818991440 Bacteria 4774720
260 2842920342 2842918807 Bacteria 4289178
261 2846033703 2846033681 Bacteria 4377894
262 2891636318 2891633521 Bacteria 4602265
263 2891637549 2891633521 Bacteria 4602265
264 2902688598 2902682994 Bacteria 8951596
265 2904465968 2904463128 Bacteria 4775606
266 2941473156 2941471342 Bacteria 5018624
267 2953995634 2953994433 Bacteria 4303959
268 8047678476 8047673197 Bacteria 7395230
269 Ga0070708_100052118
270 JGI24738J21930_10023435
271 rootH2_10083710
272 rootH1_10258515
273 Ga0007409J51694_1036138
274 Ga0007416J51690_1033158
275 Ga0055532_1000892
276 Ga0070683_100068691
277 Ga0070670_100152433
278 Ga0070680_100005807
279 Ga0070680_100150612
280 Ga0070660_100327842
281 Ga0070661_100006302
282 Ga0070661_100053473
283 Ga0070669_100267162
284 Ga0070675_100028350
285 Ga0070671_100007991
286 Ga0070671_100170443
287 Ga0070673_100024384
288 Ga0070659_100007079
289 Ga0070659_100304372
290 Ga0070667_100384058
291 Ga0070709_10272537
292 Ga0070714_100035864
293 Ga0070711_100015311
294 Ga0070711_100238338
295 Ga0070662_100000512
296 Ga0070662_100206909
297 Ga0070681_10060119
298 Ga0070698_100003313
299 Ga0070699_100024597
300 Ga0070697_100496744
301 Ga0068853_100055328
302 Ga0070672_100017642
303 Ga0070672_100028014
304 Ga0068855_100000453
305 Ga0070664_100133031
306 Ga0068857_100023506
307 Ga0068857_100120823
308 Ga0068856_100001447
309 Ga0068851_10137775
310 Ga0081539_10025023
311 Ga0070717_10285854
312 Ga0097621_100143258
313 Ga0075430_100022633
314 Ga0075431_100001586
315 Ga0075431_100054765
316 Ga0075431_100270747
317 Ga0075429_100017886
318 Ga0075435_100143120
319 Ga0105251_10026077
320 Ga0105240_10119382
321 Ga0105241_10030695
322 Ga0105248_10001399
323 Ga0105237_10017259
324 Ga0157373_10002315
325 Ga0157371_10002105
326 Ga0157370_10000308
327 Ga0157370_10000495
328 Ga0157370_10007149
329 Ga0157369_10000464
330 Ga0157369_10157204
331 Ga0157369_10167853
332 Ga0163162_10103284
333 Ga0163162_10512937
334 Ga0157372_10012702
335 Ga0157372_10231432
336 Ga0157375_10247855
337 Ga0157376_10173236
338 Ga0182006_1003010
339 Ga0182005_1000064
340 Ga0213876_10010100
341 Ga0209435_102337
342 Ga0209147_100242
343 Ga0209148_1002731
344 Ga0209129_1002448
345 Ga0209758_1034921
346 Ga0207697_10035547
347 Ga0207680_10012992
348 Ga0207647_10000010
349 Ga0207699_10025473
350 Ga0207684_10111542
351 Ga0207684_10346838
352 Ga0207654_10035673
353 Ga0207671_10062696
354 Ga0207693_10071583
355 Ga0207657_10000409
356 Ga0207649_10364106
357 Ga0207681_10062214
358 Ga0207650_10124706
359 Ga0207659_10023091
360 Ga0207700_10266937
361 Ga0207664_10009338
362 Ga0207664_10051155
363 Ga0207644_10082441
364 Ga0207644_10149958
365 Ga0207690_10011214
366 Ga0207706_10000232
367 Ga0207706_10084840
368 Ga0207691_10053117
369 Ga0207711_10021773
370 Ga0207661_10107282
371 Ga0207679_10002888
372 Ga0207679_10017701
373 Ga0207667_10035108
374 Ga0207651_10081783
375 Ga0207651_10095402
376 Ga0207639_10029068
377 Ga0207702_10016629
378 Ga0207702_10509809
379 Ga0207648_10308128
380 Ga0207648_10482910
381 Ga0207674_10480271
382 Ga0207683_10131429
383 Ga0207698_10016553
384 Ga0210002_1005264
385 Ga0209983_1008752
386 Ga0209971_1014187
387 Ga0209974_10004711
388 Ga0265326_10019418
389 Ga0265334_10000088
390 Ga0265334_10021377
391 Ga0265323_10004666
392 Ga0265324_10012600
393 Ga0265325_10122153
394 Ga0265316_10110174
395 Ga0307513_10139992
396 Ga0307509_10000079
397 Ga0307509_10001090
398 Ga0307408_100029509
399 Ga0265313_10008436
400 Ga0265313_10037168
401 Ga0307508_10000306
402 Ga0307405_10002589
403 Ga0307413_10028792
404 Ga0307410_10017443
405 Ga0307406_10049422
406 Ga0307407_10289926
407 Ga0307412_10050730
408 Ga0307409_100008602
409 Ga0307409_100581114
410 Ga0307416_100085395
411 Ga0307411_10003144
412 Ga0316583_10009819
413 Ga0307510_10285819
414 Ga0373944_0061637
415 Ga0373927_0000002
416 Ga0373937_0101272
417 Ga0373925_0102897
418 Ga0395900_0180865
419 Ga0395905_0224395
420 Ga0436364_0098673
421 Ga0436365_0874983
422 Ga0436360_1178753
423 Ga0436361_0651539
424 Ga0436361_0727003
425 Ga0436363_0854040
426 Ga0439436_0000045
427 Ga0439447_033740
428 Ga0451837_0377822
429 Ga0451853_1660041
430 Ga0451577_0016740
431 Ga0451577_0019064
432 Ga0451577_0281787
433 Ga0466969_0094171
434 Ga0453684_0003290
435 Ga0451576_0001042
436 Ga0495629_0003891
437 Ga0495629_0161336
438 Ga0495653_0020962
439 Ga0495653_0097986
440 Ga0495580_0000024
441 Ga0495580_0003416
442 Ga0495580_0007478
443 Ga0495580_0029477
444 Ga0495582_0025557
445 Ga0495605_0005889
446 Ga0495605_0010166
447 Ga0495583_0009435
448 Ga0495583_0060586
449 Ga0495606_0131157
450 Ga0495610_0001679
451 Ga0495616_0010818
452 Ga0495628_0004869
453 Ga0495630_0036590
454 Ga0495630_0488257
455 Ga0495648_0005758
456 Ga0495648_0030142
457 Ga0495666_0063900
458 Ga0495652_0208876
459 Ga0495665_0017770
460 Ga0495646_0058453
461 Ga0495624_0000067
462 Ga0495624_0003707
463 Ga0495671_0111515
464 Ga0495649_0071626
465 Ga0495589_0038918
466 Ga0495604_0036020
467 Ga0495674_0000035
468 Ga0495674_0010282
469 Ga0495672_0128656
470 Ga0495676_0027671
471 Ga0495683_0082775
472 Ga0495687_039991
473 Ga0495673_0008568
474 Ga0495593_0010943
475 Ga0495602_0010213
476 Ga0495602_0052828
477 Ga0496100_0039440
478 Ga0496101_0030406
479 Ga0496101_0035571
480 Ga0496101_0162366
481 Ga0496102_0003784
482 Ga0496102_0022384
483 Ga0496103_0009798
484 Ga0496104_0007802
485 Ga0496106_0005904
486 Ga0496106_0025719
487 Ga0496106_0136362
488 Ga0496107_0062964
489 Ga0496107_0281115
490 Ga0496109_0319212
491 Ga0496112_0153880
492 Ga0496112_0262010
493 Ga0496113_0000433
494 Ga0496113_0020450
495 Ga0496114_0036117
496 Ga0496115_0266588
497 Ga0496117_0012019
498 Ga0496117_0026540
499 Ga0496118_0002723
500 Ga0496121_0000071
501 Ga0496121_0002280
502 Ga0496121_0004741
503 Ga0496123_0033144
504 Ga0496124_0009714
505 Ga0496124_0021772
506 Ga0496125_0000545
507 Ga0496125_0007889
508 Ga0496126_0039442
509 Ga0496126_0046408
510 Ga0496126_0383184
511 Ga0501042_0200839
512 nmdc:mga09592_22108_c1
513 nmdc:mga0qj67_11715_c1
514 nmdc:mga0qj67_21702_c1
515 nmdc:mga06r32_7280_c1
516 nmdc:mga06r32_7930_c1
517 Ga0500618_026391
518 Ga0500568_0003163
519 Ga0587072_002463
520 Ga0587071_019526
521 2510246167
522 2526212933
523 2595447270
524 2644030197
525 2719637546
526 2753568240
527 2819565657
528 2842920342
529 2846033703
530 2891636318
531 2891637549
532 2902688598
533 2904465968
534 2941473156
535 2953995634
536 8047678476

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

209

289

0.98

PF01012

ETF

Electron transfer flavoprotein domain

13

189

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.9788 1 184
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.9736 1 184
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8984 1 184
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8717 1 184
1efv-assembly1.cif.gz_A three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution 0.8609 1 311
ID Description Score Start End Superfamily
1efvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.979 1 185 3.40.50.620
1efvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9739 1 185 3.40.50.620
af_Q4DG52_12_193_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9681 2 185 3.40.50.620
af_Q4DG52_12_193_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.963 2 185 3.40.50.620
af_A0A1D8PQF9_17_202_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9519 1 184 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A016W0Z4-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.9887 2 150 GO:0005759
GO:0009055
GO:0033539
GO:0050660
AF-A0A7S2V5F1-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.9873 2 138 GO:0005759
GO:0009055
GO:0033539
GO:0050660
AF-W2TP12-F1-model_v4 Electron transfer flavoprotein 0.987 2 142 GO:0005759
GO:0009055
GO:0033539
GO:0050660
AF-A0A520C9N6-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9869 1 185 GO:0009055
GO:0033539
GO:0050660
AF-N6XTR0-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9869 1 169 GO:0009055
GO:0033539
GO:0050660

Map