F375328
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 207 | 536 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100052118|Ga0070708_1000521182 |
| Length | 333 |
| Sequence | MEYSNTPLFSMSILVLAEHDNVALKPATQHTISAGTKISEKGGNPEVHVLVVGEDVQGVAQASARVAGVNKVFLADAPHLGAQTAEAVAAQVLQHIQMGDYSHVLAPATTFGKNLLPRVAARLDVQQISGIIDVLTVDTFIRPIYAGNALATVQSAADAIKVLTVLSTGFDAAAVAQGNAPIESVKEIVNDPSGTRLLGRQLSSGEKLELTAARVVVSGGRGLQKAENFKLLEALAAKLNAAVGASRAAVDAGFVPNDYQVGQTGKIVAPDLYIAVGISGAIQHLAGMRDSKVIVAINKDPDAPIFQVADYGLVGDALEILPQLTARLSADLC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 111 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 117 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 118 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 129 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 130 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 131 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 132 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 133 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 134 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 172 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 173 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 182 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 191 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 194 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 195 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 196 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 197 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 198 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 199 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 200 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 201 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 202 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 203 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 204 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 205 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 206 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 207 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.54 |
| Metatranscriptomes | 1.49 |
| Isolates | 5.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.61 |
| Nodule | 0.75 |
| Rhizoplane | 7.46 |
| Rhizosphere | 75.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100052118 | 3300005445 | Bacteria | 3627 |
| 2 | JGI24738J21930_10023435 | 3300002075 | Bacteria | 1272 |
| 3 | rootH2_10083710 | 3300003320 | Bacteria | 10192 |
| 4 | rootH1_10258515 | 3300003323 | Bacteria | 2073 |
| 5 | Ga0007409J51694_1036138 | 3300003575 | Bacteria | 4304 |
| 6 | Ga0007416J51690_1033158 | 3300003577 | Bacteria | 4556 |
| 7 | Ga0055532_1000892 | 3300003758 | Bacteria | 9892 |
| 8 | Ga0070683_100068691 | 3300005329 | Bacteria | 3302 |
| 9 | Ga0070670_100152433 | 3300005331 | Bacteria | 2001 |
| 10 | Ga0070680_100005807 | 3300005336 | Bacteria | 9366 |
| 11 | Ga0070680_100150612 | 3300005336 | Bacteria | 1953 |
| 12 | Ga0070660_100327842 | 3300005339 | Bacteria | 1258 |
| 13 | Ga0070661_100006302 | 3300005344 | Bacteria | 8182 |
| 14 | Ga0070661_100053473 | 3300005344 | Bacteria | 2956 |
| 15 | Ga0070669_100267162 | 3300005353 | Bacteria | 1367 |
| 16 | Ga0070675_100028350 | 3300005354 | Bacteria | 4507 |
| 17 | Ga0070671_100007991 | 3300005355 | Bacteria | 8466 |
| 18 | Ga0070671_100170443 | 3300005355 | Bacteria | 1841 |
| 19 | Ga0070673_100024384 | 3300005364 | Bacteria | 4435 |
| 20 | Ga0070659_100007079 | 3300005366 | Bacteria | 8130 |
| 21 | Ga0070659_100304372 | 3300005366 | Bacteria | 1330 |
| 22 | Ga0070667_100384058 | 3300005367 | Bacteria | 1276 |
| 23 | Ga0070709_10272537 | 3300005434 | Bacteria | 1227 |
| 24 | Ga0070714_100035864 | 3300005435 | Bacteria | 4157 |
| 25 | Ga0070711_100015311 | 3300005439 | Bacteria | 4854 |
| 26 | Ga0070711_100238338 | 3300005439 | Bacteria | 1421 |
| 27 | Ga0070662_100000512 | 3300005457 | Bacteria | 23310 |
| 28 | Ga0070662_100206909 | 3300005457 | Bacteria | 1560 |
| 29 | Ga0070681_10060119 | 3300005458 | Bacteria | 3778 |
| 30 | Ga0070698_100003313 | 3300005471 | Bacteria | 17719 |
| 31 | Ga0070699_100024597 | 3300005518 | Bacteria | 5191 |
| 32 | Ga0070697_100496744 | 3300005536 | Bacteria | 1066 |
| 33 | Ga0068853_100055328 | 3300005539 | Bacteria | 3420 |
| 34 | Ga0070672_100017642 | 3300005543 | Bacteria | 5142 |
| 35 | Ga0070672_100028014 | 3300005543 | Bacteria | 4210 |
| 36 | Ga0068855_100000453 | 3300005563 | Bacteria | 50677 |
| 37 | Ga0070664_100133031 | 3300005564 | Bacteria | 2185 |
| 38 | Ga0068857_100023506 | 3300005577 | Bacteria | 5426 |
| 39 | Ga0068857_100120823 | 3300005577 | Bacteria | 2358 |
| 40 | Ga0068856_100001447 | 3300005614 | Bacteria | 24887 |
| 41 | Ga0068851_10137775 | 3300005834 | Bacteria | 1325 |
| 42 | Ga0081539_10025023 | 3300005985 | Bacteria | 3857 |
| 43 | Ga0070717_10285854 | 3300006028 | Bacteria | 1463 |
| 44 | Ga0097621_100143258 | 3300006237 | Bacteria | 2044 |
| 45 | Ga0075430_100022633 | 3300006846 | Bacteria | 5347 |
| 46 | Ga0075431_100001586 | 3300006847 | Bacteria | 21155 |
| 47 | Ga0075431_100054765 | 3300006847 | Bacteria | 4113 |
| 48 | Ga0075431_100270747 | 3300006847 | Bacteria | 1721 |
| 49 | Ga0075429_100017886 | 3300006880 | Bacteria | 6128 |
| 50 | Ga0075435_100143120 | 3300007076 | Bacteria | 2007 |
| 51 | Ga0105251_10026077 | 3300009011 | Bacteria | 2980 |
| 52 | Ga0105240_10119382 | 3300009093 | Bacteria | 3176 |
| 53 | Ga0105241_10030695 | 3300009174 | Bacteria | 4019 |
| 54 | Ga0105248_10001399 | 3300009177 | Bacteria | 26936 |
| 55 | Ga0105237_10017259 | 3300009545 | Bacteria | 7484 |
| 56 | Ga0157373_10002315 | 3300013100 | Bacteria | 14434 |
| 57 | Ga0157371_10002105 | 3300013102 | Bacteria | 19423 |
| 58 | Ga0157370_10000308 | 3300013104 | Bacteria | 61300 |
| 59 | Ga0157370_10000495 | 3300013104 | Bacteria | 48993 |
| 60 | Ga0157370_10007149 | 3300013104 | Bacteria | 12179 |
| 61 | Ga0157369_10000464 | 3300013105 | Bacteria | 53767 |
| 62 | Ga0157369_10157204 | 3300013105 | Bacteria | 2401 |
| 63 | Ga0157369_10167853 | 3300013105 | Bacteria | 2313 |
| 64 | Ga0163162_10103284 | 3300013306 | Bacteria | 2944 |
| 65 | Ga0163162_10512937 | 3300013306 | Bacteria | 1329 |
| 66 | Ga0157372_10012702 | 3300013307 | Bacteria | 8970 |
| 67 | Ga0157372_10231432 | 3300013307 | Bacteria | 2143 |
| 68 | Ga0157375_10247855 | 3300013308 | Bacteria | 1942 |
| 69 | Ga0157376_10173236 | 3300014969 | Bacteria | 1967 |
| 70 | Ga0182006_1003010 | 3300015261 | Bacteria | 8864 |
| 71 | Ga0182005_1000064 | 3300015265 | Bacteria | 95976 |
| 72 | Ga0213876_10010100 | 3300021384 | Bacteria | 5073 |
| 73 | Ga0209435_102337 | 3300025206 | Bacteria | 2232 |
| 74 | Ga0209147_100242 | 3300025229 | Bacteria | 53145 |
| 75 | Ga0209148_1002731 | 3300025254 | Bacteria | 5613 |
| 76 | Ga0209129_1002448 | 3300025258 | Bacteria | 9106 |
| 77 | Ga0209758_1034921 | 3300025297 | Bacteria | 1990 |
| 78 | Ga0207697_10035547 | 3300025315 | Bacteria | 2039 |
| 79 | Ga0207680_10012992 | 3300025903 | Bacteria | 4259 |
| 80 | Ga0207647_10000010 | 3300025904 | Bacteria | 174219 |
| 81 | Ga0207699_10025473 | 3300025906 | Bacteria | 3248 |
| 82 | Ga0207684_10111542 | 3300025910 | Bacteria | 2341 |
| 83 | Ga0207684_10346838 | 3300025910 | Bacteria | 1278 |
| 84 | Ga0207654_10035673 | 3300025911 | Bacteria | 2773 |
| 85 | Ga0207671_10062696 | 3300025914 | Bacteria | 2761 |
| 86 | Ga0207693_10071583 | 3300025915 | Bacteria | 2714 |
| 87 | Ga0207657_10000409 | 3300025919 | Bacteria | 45340 |
| 88 | Ga0207649_10364106 | 3300025920 | Bacteria | 1074 |
| 89 | Ga0207681_10062214 | 3300025923 | Bacteria | 2569 |
| 90 | Ga0207650_10124706 | 3300025925 | Bacteria | 2009 |
| 91 | Ga0207659_10023091 | 3300025926 | Bacteria | 4148 |
| 92 | Ga0207700_10266937 | 3300025928 | Bacteria | 1467 |
| 93 | Ga0207664_10009338 | 3300025929 | Bacteria | 6876 |
| 94 | Ga0207664_10051155 | 3300025929 | Bacteria | 3260 |
| 95 | Ga0207644_10082441 | 3300025931 | Bacteria | 2379 |
| 96 | Ga0207644_10149958 | 3300025931 | Bacteria | 1803 |
| 97 | Ga0207690_10011214 | 3300025932 | Bacteria | 5351 |
| 98 | Ga0207706_10000232 | 3300025933 | Bacteria | 60892 |
| 99 | Ga0207706_10084840 | 3300025933 | Bacteria | 2785 |
| 100 | Ga0207691_10053117 | 3300025940 | Bacteria | 3700 |
| 101 | Ga0207711_10021773 | 3300025941 | Bacteria | 5354 |
| 102 | Ga0207661_10107282 | 3300025944 | Bacteria | 2356 |
| 103 | Ga0207679_10002888 | 3300025945 | Bacteria | 10658 |
| 104 | Ga0207679_10017701 | 3300025945 | Bacteria | 4758 |
| 105 | Ga0207667_10035108 | 3300025949 | Bacteria | 5380 |
| 106 | Ga0207651_10081783 | 3300025960 | Bacteria | 2329 |
| 107 | Ga0207651_10095402 | 3300025960 | Bacteria | 2190 |
| 108 | Ga0207639_10029068 | 3300026041 | Bacteria | 4043 |
| 109 | Ga0207702_10016629 | 3300026078 | Bacteria | 6087 |
| 110 | Ga0207702_10509809 | 3300026078 | Bacteria | 1173 |
| 111 | Ga0207648_10308128 | 3300026089 | Bacteria | 1421 |
| 112 | Ga0207648_10482910 | 3300026089 | Bacteria | 1132 |
| 113 | Ga0207674_10480271 | 3300026116 | Bacteria | 1201 |
| 114 | Ga0207683_10131429 | 3300026121 | Bacteria | 2252 |
| 115 | Ga0207698_10016553 | 3300026142 | Bacteria | 4975 |
| 116 | Ga0210002_1005264 | 3300027617 | Bacteria | 1942 |
| 117 | Ga0209983_1008752 | 3300027665 | Bacteria | 2066 |
| 118 | Ga0209971_1014187 | 3300027682 | Bacteria | 1888 |
| 119 | Ga0209974_10004711 | 3300027876 | Bacteria | 4846 |
| 120 | Ga0265326_10019418 | 3300028558 | Bacteria | 1953 |
| 121 | Ga0265334_10000088 | 3300028573 | Bacteria | 65739 |
| 122 | Ga0265334_10021377 | 3300028573 | Bacteria | 2642 |
| 123 | Ga0265323_10004666 | 3300028653 | Bacteria | 5881 |
| 124 | Ga0265324_10012600 | 3300029957 | Bacteria | 3184 |
| 125 | Ga0265325_10122153 | 3300031241 | Bacteria | 1254 |
| 126 | Ga0265316_10110174 | 3300031344 | Bacteria | 2085 |
| 127 | Ga0307513_10139992 | 3300031456 | Bacteria | 2348 |
| 128 | Ga0307509_10000079 | 3300031507 | Bacteria | 135772 |
| 129 | Ga0307509_10001090 | 3300031507 | Bacteria | 46488 |
| 130 | Ga0307408_100029509 | 3300031548 | Bacteria | 3801 |
| 131 | Ga0265313_10008436 | 3300031595 | Bacteria | 6842 |
| 132 | Ga0265313_10037168 | 3300031595 | Bacteria | 2437 |
| 133 | Ga0307508_10000306 | 3300031616 | Bacteria | 59403 |
| 134 | Ga0307405_10002589 | 3300031731 | Bacteria | 8020 |
| 135 | Ga0307413_10028792 | 3300031824 | Bacteria | 3100 |
| 136 | Ga0307410_10017443 | 3300031852 | Bacteria | 4312 |
| 137 | Ga0307406_10049422 | 3300031901 | Bacteria | 2661 |
| 138 | Ga0307407_10289926 | 3300031903 | Bacteria | 1137 |
| 139 | Ga0307412_10050730 | 3300031911 | Bacteria | 2740 |
| 140 | Ga0307409_100008602 | 3300031995 | Bacteria | 6209 |
| 141 | Ga0307409_100581114 | 3300031995 | Bacteria | 1104 |
| 142 | Ga0307416_100085395 | 3300032002 | Bacteria | 2686 |
| 143 | Ga0307411_10003144 | 3300032005 | Bacteria | 7573 |
| 144 | Ga0316583_10009819 | 3300032133 | Bacteria | 3448 |
| 145 | Ga0307510_10285819 | 3300033180 | Bacteria | 1117 |
| 146 | Ga0373944_0061637 | 3300035089 | Bacteria | 1204 |
| 147 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 148 | Ga0373937_0101272 | 3300036401 | Bacteria | 2673 |
| 149 | Ga0373925_0102897 | 3300037068 | Bacteria | 2198 |
| 150 | Ga0395900_0180865 | 3300037418 | Bacteria | 2143 |
| 151 | Ga0395905_0224395 | 3300037471 | Bacteria | 1758 |
| 152 | Ga0436364_0098673 | 3300037853 | Bacteria | 6312 |
| 153 | Ga0436365_0874983 | 3300039437 | Bacteria | 53988 |
| 154 | Ga0436360_1178753 | 3300039438 | Bacteria | 8244 |
| 155 | Ga0436361_0651539 | 3300039447 | Bacteria | 2316 |
| 156 | Ga0436361_0727003 | 3300039447 | Bacteria | 1168 |
| 157 | Ga0436363_0854040 | 3300039450 | Bacteria | 16936 |
| 158 | Ga0439436_0000045 | 3300041404 | Bacteria | 37076 |
| 159 | Ga0439447_033740 | 3300041407 | Bacteria | 1275 |
| 160 | Ga0451837_0377822 | 3300041494 | Bacteria | 1334 |
| 161 | Ga0451853_1660041 | 3300041512 | Bacteria | 2891 |
| 162 | Ga0451577_0016740 | 3300042876 | Bacteria | 6781 |
| 163 | Ga0451577_0019064 | 3300042876 | Bacteria | 6314 |
| 164 | Ga0451577_0281787 | 3300042876 | Bacteria | 1506 |
| 165 | Ga0466969_0094171 | 3300044656 | Bacteria | 1416 |
| 166 | Ga0453684_0003290 | 3300044712 | Bacteria | 36831 |
| 167 | Ga0451576_0001042 | 3300045051 | Bacteria | 51034 |
| 168 | Ga0495629_0003891 | 3300046459 | Bacteria | 11242 |
| 169 | Ga0495629_0161336 | 3300046459 | Bacteria | 1557 |
| 170 | Ga0495653_0020962 | 3300046463 | Bacteria | 5296 |
| 171 | Ga0495653_0097986 | 3300046463 | Bacteria | 2129 |
| 172 | Ga0495580_0000024 | 3300046472 | Bacteria | 87183 |
| 173 | Ga0495580_0003416 | 3300046472 | Bacteria | 13535 |
| 174 | Ga0495580_0007478 | 3300046472 | Bacteria | 8778 |
| 175 | Ga0495580_0029477 | 3300046472 | Bacteria | 3982 |
| 176 | Ga0495582_0025557 | 3300046473 | Bacteria | 3235 |
| 177 | Ga0495605_0005889 | 3300046474 | Bacteria | 7084 |
| 178 | Ga0495605_0010166 | 3300046474 | Bacteria | 5269 |
| 179 | Ga0495583_0009435 | 3300046506 | Bacteria | 5827 |
| 180 | Ga0495583_0060586 | 3300046506 | Bacteria | 1692 |
| 181 | Ga0495606_0131157 | 3300046507 | Bacteria | 1490 |
| 182 | Ga0495610_0001679 | 3300046512 | Bacteria | 19452 |
| 183 | Ga0495616_0010818 | 3300046513 | Bacteria | 5259 |
| 184 | Ga0495628_0004869 | 3300046516 | Bacteria | 11820 |
| 185 | Ga0495630_0036590 | 3300046517 | Bacteria | 3670 |
| 186 | Ga0495630_0488257 | 3300046517 | Bacteria | 944 |
| 187 | Ga0495648_0005758 | 3300046524 | Bacteria | 10223 |
| 188 | Ga0495648_0030142 | 3300046524 | Bacteria | 3592 |
| 189 | Ga0495666_0063900 | 3300046526 | Bacteria | 1757 |
| 190 | Ga0495652_0208876 | 3300046529 | Bacteria | 1476 |
| 191 | Ga0495665_0017770 | 3300046531 | Bacteria | 3822 |
| 192 | Ga0495646_0058453 | 3300046680 | Bacteria | 2305 |
| 193 | Ga0495624_0000067 | 3300046690 | Bacteria | 66836 |
| 194 | Ga0495624_0003707 | 3300046690 | Bacteria | 11296 |
| 195 | Ga0495671_0111515 | 3300046692 | Bacteria | 1336 |
| 196 | Ga0495649_0071626 | 3300046694 | Bacteria | 1858 |
| 197 | Ga0495589_0038918 | 3300046794 | Bacteria | 2378 |
| 198 | Ga0495604_0036020 | 3300047317 | Bacteria | 3904 |
| 199 | Ga0495674_0000035 | 3300047319 | Bacteria | 104643 |
| 200 | Ga0495674_0010282 | 3300047319 | Bacteria | 8860 |
| 201 | Ga0495672_0128656 | 3300047320 | Bacteria | 1335 |
| 202 | Ga0495676_0027671 | 3300047321 | Bacteria | 4858 |
| 203 | Ga0495683_0082775 | 3300047323 | Bacteria | 1563 |
| 204 | Ga0495687_039991 | 3300047443 | Bacteria | 2070 |
| 205 | Ga0495673_0008568 | 3300047469 | Bacteria | 5731 |
| 206 | Ga0495593_0010943 | 3300047673 | Bacteria | 5224 |
| 207 | Ga0495602_0010213 | 3300048088 | Bacteria | 9745 |
| 208 | Ga0495602_0052828 | 3300048088 | Bacteria | 3605 |
| 209 | Ga0496100_0039440 | 3300048903 | Bacteria | 2999 |
| 210 | Ga0496101_0030406 | 3300048904 | Bacteria | 3786 |
| 211 | Ga0496101_0035571 | 3300048904 | Bacteria | 3523 |
| 212 | Ga0496101_0162366 | 3300048904 | Bacteria | 1714 |
| 213 | Ga0496102_0003784 | 3300048905 | Bacteria | 12794 |
| 214 | Ga0496102_0022384 | 3300048905 | Bacteria | 5599 |
| 215 | Ga0496103_0009798 | 3300048906 | Bacteria | 5674 |
| 216 | Ga0496104_0007802 | 3300048907 | Bacteria | 9487 |
| 217 | Ga0496106_0005904 | 3300048909 | Bacteria | 9050 |
| 218 | Ga0496106_0025719 | 3300048909 | Bacteria | 4382 |
| 219 | Ga0496106_0136362 | 3300048909 | Bacteria | 1928 |
| 220 | Ga0496107_0062964 | 3300048910 | Bacteria | 2688 |
| 221 | Ga0496107_0281115 | 3300048910 | Bacteria | 1239 |
| 222 | Ga0496109_0319212 | 3300048912 | Bacteria | 1466 |
| 223 | Ga0496112_0153880 | 3300048915 | Bacteria | 2267 |
| 224 | Ga0496112_0262010 | 3300048915 | Bacteria | 1678 |
| 225 | Ga0496113_0000433 | 3300048916 | Bacteria | 20324 |
| 226 | Ga0496113_0020450 | 3300048916 | Bacteria | 4653 |
| 227 | Ga0496114_0036117 | 3300048917 | Bacteria | 4085 |
| 228 | Ga0496115_0266588 | 3300048918 | Bacteria | 1408 |
| 229 | Ga0496117_0012019 | 3300048920 | Bacteria | 7688 |
| 230 | Ga0496117_0026540 | 3300048920 | Bacteria | 4531 |
| 231 | Ga0496118_0002723 | 3300048921 | Bacteria | 23294 |
| 232 | Ga0496121_0000071 | 3300048924 | Bacteria | 247039 |
| 233 | Ga0496121_0002280 | 3300048924 | Bacteria | 29844 |
| 234 | Ga0496121_0004741 | 3300048924 | Bacteria | 17950 |
| 235 | Ga0496123_0033144 | 3300048926 | Bacteria | 3723 |
| 236 | Ga0496124_0009714 | 3300048927 | Bacteria | 9848 |
| 237 | Ga0496124_0021772 | 3300048927 | Bacteria | 5898 |
| 238 | Ga0496125_0000545 | 3300048928 | Bacteria | 64939 |
| 239 | Ga0496125_0007889 | 3300048928 | Bacteria | 11242 |
| 240 | Ga0496126_0039442 | 3300048929 | Bacteria | 4382 |
| 241 | Ga0496126_0046408 | 3300048929 | Bacteria | 3985 |
| 242 | Ga0496126_0383184 | 3300048929 | Bacteria | 1144 |
| 243 | Ga0501042_0200839 | 3300049578 | Bacteria | 1438 |
| 244 | nmdc:mga09592_22108_c1 | 3300050508 | Bacteria | 5247 |
| 245 | nmdc:mga0qj67_11715_c1 | 3300050509 | Bacteria | 6580 |
| 246 | nmdc:mga0qj67_21702_c1 | 3300050509 | Bacteria | 4927 |
| 247 | nmdc:mga06r32_7280_c1 | 3300050510 | Bacteria | 9966 |
| 248 | nmdc:mga06r32_7930_c1 | 3300050510 | Bacteria | 9548 |
| 249 | Ga0500618_026391 | 3300053125 | Bacteria | 1387 |
| 250 | Ga0500568_0003163 | 3300053139 | Bacteria | 9375 |
| 251 | Ga0587072_002463 | 3300059643 | Bacteria | 2477 |
| 252 | Ga0587071_019526 | 3300060344 | Bacteria | 1227 |
| 253 | 2510246167 | 2510065045 | Bacteria | 7761063 |
| 254 | 2526212933 | 2526164512 | Bacteria | 4025691 |
| 255 | 2595447270 | 2593339238 | Bacteria | 4182970 |
| 256 | 2644030197 | 2643221603 | Bacteria | 6147767 |
| 257 | 2719637546 | 2718217991 | Bacteria | 7829542 |
| 258 | 2753568240 | 2751185846 | Bacteria | 7242164 |
| 259 | 2819565657 | 2818991440 | Bacteria | 4774720 |
| 260 | 2842920342 | 2842918807 | Bacteria | 4289178 |
| 261 | 2846033703 | 2846033681 | Bacteria | 4377894 |
| 262 | 2891636318 | 2891633521 | Bacteria | 4602265 |
| 263 | 2891637549 | 2891633521 | Bacteria | 4602265 |
| 264 | 2902688598 | 2902682994 | Bacteria | 8951596 |
| 265 | 2904465968 | 2904463128 | Bacteria | 4775606 |
| 266 | 2941473156 | 2941471342 | Bacteria | 5018624 |
| 267 | 2953995634 | 2953994433 | Bacteria | 4303959 |
| 268 | 8047678476 | 8047673197 | Bacteria | 7395230 |
| 269 | Ga0070708_100052118 | |||
| 270 | JGI24738J21930_10023435 | |||
| 271 | rootH2_10083710 | |||
| 272 | rootH1_10258515 | |||
| 273 | Ga0007409J51694_1036138 | |||
| 274 | Ga0007416J51690_1033158 | |||
| 275 | Ga0055532_1000892 | |||
| 276 | Ga0070683_100068691 | |||
| 277 | Ga0070670_100152433 | |||
| 278 | Ga0070680_100005807 | |||
| 279 | Ga0070680_100150612 | |||
| 280 | Ga0070660_100327842 | |||
| 281 | Ga0070661_100006302 | |||
| 282 | Ga0070661_100053473 | |||
| 283 | Ga0070669_100267162 | |||
| 284 | Ga0070675_100028350 | |||
| 285 | Ga0070671_100007991 | |||
| 286 | Ga0070671_100170443 | |||
| 287 | Ga0070673_100024384 | |||
| 288 | Ga0070659_100007079 | |||
| 289 | Ga0070659_100304372 | |||
| 290 | Ga0070667_100384058 | |||
| 291 | Ga0070709_10272537 | |||
| 292 | Ga0070714_100035864 | |||
| 293 | Ga0070711_100015311 | |||
| 294 | Ga0070711_100238338 | |||
| 295 | Ga0070662_100000512 | |||
| 296 | Ga0070662_100206909 | |||
| 297 | Ga0070681_10060119 | |||
| 298 | Ga0070698_100003313 | |||
| 299 | Ga0070699_100024597 | |||
| 300 | Ga0070697_100496744 | |||
| 301 | Ga0068853_100055328 | |||
| 302 | Ga0070672_100017642 | |||
| 303 | Ga0070672_100028014 | |||
| 304 | Ga0068855_100000453 | |||
| 305 | Ga0070664_100133031 | |||
| 306 | Ga0068857_100023506 | |||
| 307 | Ga0068857_100120823 | |||
| 308 | Ga0068856_100001447 | |||
| 309 | Ga0068851_10137775 | |||
| 310 | Ga0081539_10025023 | |||
| 311 | Ga0070717_10285854 | |||
| 312 | Ga0097621_100143258 | |||
| 313 | Ga0075430_100022633 | |||
| 314 | Ga0075431_100001586 | |||
| 315 | Ga0075431_100054765 | |||
| 316 | Ga0075431_100270747 | |||
| 317 | Ga0075429_100017886 | |||
| 318 | Ga0075435_100143120 | |||
| 319 | Ga0105251_10026077 | |||
| 320 | Ga0105240_10119382 | |||
| 321 | Ga0105241_10030695 | |||
| 322 | Ga0105248_10001399 | |||
| 323 | Ga0105237_10017259 | |||
| 324 | Ga0157373_10002315 | |||
| 325 | Ga0157371_10002105 | |||
| 326 | Ga0157370_10000308 | |||
| 327 | Ga0157370_10000495 | |||
| 328 | Ga0157370_10007149 | |||
| 329 | Ga0157369_10000464 | |||
| 330 | Ga0157369_10157204 | |||
| 331 | Ga0157369_10167853 | |||
| 332 | Ga0163162_10103284 | |||
| 333 | Ga0163162_10512937 | |||
| 334 | Ga0157372_10012702 | |||
| 335 | Ga0157372_10231432 | |||
| 336 | Ga0157375_10247855 | |||
| 337 | Ga0157376_10173236 | |||
| 338 | Ga0182006_1003010 | |||
| 339 | Ga0182005_1000064 | |||
| 340 | Ga0213876_10010100 | |||
| 341 | Ga0209435_102337 | |||
| 342 | Ga0209147_100242 | |||
| 343 | Ga0209148_1002731 | |||
| 344 | Ga0209129_1002448 | |||
| 345 | Ga0209758_1034921 | |||
| 346 | Ga0207697_10035547 | |||
| 347 | Ga0207680_10012992 | |||
| 348 | Ga0207647_10000010 | |||
| 349 | Ga0207699_10025473 | |||
| 350 | Ga0207684_10111542 | |||
| 351 | Ga0207684_10346838 | |||
| 352 | Ga0207654_10035673 | |||
| 353 | Ga0207671_10062696 | |||
| 354 | Ga0207693_10071583 | |||
| 355 | Ga0207657_10000409 | |||
| 356 | Ga0207649_10364106 | |||
| 357 | Ga0207681_10062214 | |||
| 358 | Ga0207650_10124706 | |||
| 359 | Ga0207659_10023091 | |||
| 360 | Ga0207700_10266937 | |||
| 361 | Ga0207664_10009338 | |||
| 362 | Ga0207664_10051155 | |||
| 363 | Ga0207644_10082441 | |||
| 364 | Ga0207644_10149958 | |||
| 365 | Ga0207690_10011214 | |||
| 366 | Ga0207706_10000232 | |||
| 367 | Ga0207706_10084840 | |||
| 368 | Ga0207691_10053117 | |||
| 369 | Ga0207711_10021773 | |||
| 370 | Ga0207661_10107282 | |||
| 371 | Ga0207679_10002888 | |||
| 372 | Ga0207679_10017701 | |||
| 373 | Ga0207667_10035108 | |||
| 374 | Ga0207651_10081783 | |||
| 375 | Ga0207651_10095402 | |||
| 376 | Ga0207639_10029068 | |||
| 377 | Ga0207702_10016629 | |||
| 378 | Ga0207702_10509809 | |||
| 379 | Ga0207648_10308128 | |||
| 380 | Ga0207648_10482910 | |||
| 381 | Ga0207674_10480271 | |||
| 382 | Ga0207683_10131429 | |||
| 383 | Ga0207698_10016553 | |||
| 384 | Ga0210002_1005264 | |||
| 385 | Ga0209983_1008752 | |||
| 386 | Ga0209971_1014187 | |||
| 387 | Ga0209974_10004711 | |||
| 388 | Ga0265326_10019418 | |||
| 389 | Ga0265334_10000088 | |||
| 390 | Ga0265334_10021377 | |||
| 391 | Ga0265323_10004666 | |||
| 392 | Ga0265324_10012600 | |||
| 393 | Ga0265325_10122153 | |||
| 394 | Ga0265316_10110174 | |||
| 395 | Ga0307513_10139992 | |||
| 396 | Ga0307509_10000079 | |||
| 397 | Ga0307509_10001090 | |||
| 398 | Ga0307408_100029509 | |||
| 399 | Ga0265313_10008436 | |||
| 400 | Ga0265313_10037168 | |||
| 401 | Ga0307508_10000306 | |||
| 402 | Ga0307405_10002589 | |||
| 403 | Ga0307413_10028792 | |||
| 404 | Ga0307410_10017443 | |||
| 405 | Ga0307406_10049422 | |||
| 406 | Ga0307407_10289926 | |||
| 407 | Ga0307412_10050730 | |||
| 408 | Ga0307409_100008602 | |||
| 409 | Ga0307409_100581114 | |||
| 410 | Ga0307416_100085395 | |||
| 411 | Ga0307411_10003144 | |||
| 412 | Ga0316583_10009819 | |||
| 413 | Ga0307510_10285819 | |||
| 414 | Ga0373944_0061637 | |||
| 415 | Ga0373927_0000002 | |||
| 416 | Ga0373937_0101272 | |||
| 417 | Ga0373925_0102897 | |||
| 418 | Ga0395900_0180865 | |||
| 419 | Ga0395905_0224395 | |||
| 420 | Ga0436364_0098673 | |||
| 421 | Ga0436365_0874983 | |||
| 422 | Ga0436360_1178753 | |||
| 423 | Ga0436361_0651539 | |||
| 424 | Ga0436361_0727003 | |||
| 425 | Ga0436363_0854040 | |||
| 426 | Ga0439436_0000045 | |||
| 427 | Ga0439447_033740 | |||
| 428 | Ga0451837_0377822 | |||
| 429 | Ga0451853_1660041 | |||
| 430 | Ga0451577_0016740 | |||
| 431 | Ga0451577_0019064 | |||
| 432 | Ga0451577_0281787 | |||
| 433 | Ga0466969_0094171 | |||
| 434 | Ga0453684_0003290 | |||
| 435 | Ga0451576_0001042 | |||
| 436 | Ga0495629_0003891 | |||
| 437 | Ga0495629_0161336 | |||
| 438 | Ga0495653_0020962 | |||
| 439 | Ga0495653_0097986 | |||
| 440 | Ga0495580_0000024 | |||
| 441 | Ga0495580_0003416 | |||
| 442 | Ga0495580_0007478 | |||
| 443 | Ga0495580_0029477 | |||
| 444 | Ga0495582_0025557 | |||
| 445 | Ga0495605_0005889 | |||
| 446 | Ga0495605_0010166 | |||
| 447 | Ga0495583_0009435 | |||
| 448 | Ga0495583_0060586 | |||
| 449 | Ga0495606_0131157 | |||
| 450 | Ga0495610_0001679 | |||
| 451 | Ga0495616_0010818 | |||
| 452 | Ga0495628_0004869 | |||
| 453 | Ga0495630_0036590 | |||
| 454 | Ga0495630_0488257 | |||
| 455 | Ga0495648_0005758 | |||
| 456 | Ga0495648_0030142 | |||
| 457 | Ga0495666_0063900 | |||
| 458 | Ga0495652_0208876 | |||
| 459 | Ga0495665_0017770 | |||
| 460 | Ga0495646_0058453 | |||
| 461 | Ga0495624_0000067 | |||
| 462 | Ga0495624_0003707 | |||
| 463 | Ga0495671_0111515 | |||
| 464 | Ga0495649_0071626 | |||
| 465 | Ga0495589_0038918 | |||
| 466 | Ga0495604_0036020 | |||
| 467 | Ga0495674_0000035 | |||
| 468 | Ga0495674_0010282 | |||
| 469 | Ga0495672_0128656 | |||
| 470 | Ga0495676_0027671 | |||
| 471 | Ga0495683_0082775 | |||
| 472 | Ga0495687_039991 | |||
| 473 | Ga0495673_0008568 | |||
| 474 | Ga0495593_0010943 | |||
| 475 | Ga0495602_0010213 | |||
| 476 | Ga0495602_0052828 | |||
| 477 | Ga0496100_0039440 | |||
| 478 | Ga0496101_0030406 | |||
| 479 | Ga0496101_0035571 | |||
| 480 | Ga0496101_0162366 | |||
| 481 | Ga0496102_0003784 | |||
| 482 | Ga0496102_0022384 | |||
| 483 | Ga0496103_0009798 | |||
| 484 | Ga0496104_0007802 | |||
| 485 | Ga0496106_0005904 | |||
| 486 | Ga0496106_0025719 | |||
| 487 | Ga0496106_0136362 | |||
| 488 | Ga0496107_0062964 | |||
| 489 | Ga0496107_0281115 | |||
| 490 | Ga0496109_0319212 | |||
| 491 | Ga0496112_0153880 | |||
| 492 | Ga0496112_0262010 | |||
| 493 | Ga0496113_0000433 | |||
| 494 | Ga0496113_0020450 | |||
| 495 | Ga0496114_0036117 | |||
| 496 | Ga0496115_0266588 | |||
| 497 | Ga0496117_0012019 | |||
| 498 | Ga0496117_0026540 | |||
| 499 | Ga0496118_0002723 | |||
| 500 | Ga0496121_0000071 | |||
| 501 | Ga0496121_0002280 | |||
| 502 | Ga0496121_0004741 | |||
| 503 | Ga0496123_0033144 | |||
| 504 | Ga0496124_0009714 | |||
| 505 | Ga0496124_0021772 | |||
| 506 | Ga0496125_0000545 | |||
| 507 | Ga0496125_0007889 | |||
| 508 | Ga0496126_0039442 | |||
| 509 | Ga0496126_0046408 | |||
| 510 | Ga0496126_0383184 | |||
| 511 | Ga0501042_0200839 | |||
| 512 | nmdc:mga09592_22108_c1 | |||
| 513 | nmdc:mga0qj67_11715_c1 | |||
| 514 | nmdc:mga0qj67_21702_c1 | |||
| 515 | nmdc:mga06r32_7280_c1 | |||
| 516 | nmdc:mga06r32_7930_c1 | |||
| 517 | Ga0500618_026391 | |||
| 518 | Ga0500568_0003163 | |||
| 519 | Ga0587072_002463 | |||
| 520 | Ga0587071_019526 | |||
| 521 | 2510246167 | |||
| 522 | 2526212933 | |||
| 523 | 2595447270 | |||
| 524 | 2644030197 | |||
| 525 | 2719637546 | |||
| 526 | 2753568240 | |||
| 527 | 2819565657 | |||
| 528 | 2842920342 | |||
| 529 | 2846033703 | |||
| 530 | 2891636318 | |||
| 531 | 2891637549 | |||
| 532 | 2902688598 | |||
| 533 | 2904465968 | |||
| 534 | 2941473156 | |||
| 535 | 2953995634 | |||
| 536 | 8047678476 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.9788 | 1 | 184 |
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.9736 | 1 | 184 |
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.8984 | 1 | 184 |
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.8717 | 1 | 184 |
| 1efv-assembly1.cif.gz_A | three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution | 0.8609 | 1 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1efvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.979 | 1 | 185 | 3.40.50.620 |
| 1efvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9739 | 1 | 185 | 3.40.50.620 |
| af_Q4DG52_12_193_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9681 | 2 | 185 | 3.40.50.620 |
| af_Q4DG52_12_193_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.963 | 2 | 185 | 3.40.50.620 |
| af_A0A1D8PQF9_17_202_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9519 | 1 | 184 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A016W0Z4-F1-model_v4 | Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein | 0.9887 | 2 | 150 |
GO:0005759
GO:0009055 GO:0033539 GO:0050660 |
| AF-A0A7S2V5F1-F1-model_v4 | Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein | 0.9873 | 2 | 138 |
GO:0005759
GO:0009055 GO:0033539 GO:0050660 |
| AF-W2TP12-F1-model_v4 | Electron transfer flavoprotein | 0.987 | 2 | 142 |
GO:0005759
GO:0009055 GO:0033539 GO:0050660 |
| AF-A0A520C9N6-F1-model_v4 | Electron transfer flavoprotein subunit alpha/FixB family protein | 0.9869 | 1 | 185 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-N6XTR0-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9869 | 1 | 169 |
GO:0009055
GO:0033539 GO:0050660 |