F375085

General Info

Members Datasets Scaffolds Average Seq Length
267 213 534 122

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0075523|Ga0501042_0075523_1870_2256
Length 128
Sequence MATPRPRPKVMSLTDAAAARIKALLADKPNAVALRLGVKKGGCAGMEYTMTWAETQDRFDEVIEDKGVKVLIDPMAVMYLLGTEMDYRVDKLAAQFVFNNPNQQSACGCGESVAITPVSKESLEALKT

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
98 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
99 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
118 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
121 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
203 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
204 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
205 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
206 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
207 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
208 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
209 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
210 2902330777 Methylobacterium sp. 2A Isolate Unclassified
211 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
212 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
213 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.51
Metatranscriptomes 3
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.48
Nodule 0.37
Rhizoplane 4.49
Rhizosphere 74.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0075523 3300049578 Bacteria 2412
2 JGI25153J46596_10005628 3300003215 Bacteria 6549
3 Ga0070658_10246526 3300005327 Bacteria 1515
4 Ga0068869_100632576 3300005334 Bacteria 907
5 Ga0068869_100926418 3300005334 Bacteria 755
6 Ga0068869_100945411 3300005334 Bacteria 748
7 Ga0070680_100117297 3300005336 Bacteria 2220
8 Ga0070680_100757923 3300005336 Bacteria 836
9 Ga0070682_100093569 3300005337 Bacteria 1971
10 Ga0070668_101897376 3300005347 Bacteria 549
11 Ga0070669_100416451 3300005353 Bacteria 1102
12 Ga0070671_100498150 3300005355 Bacteria 1048
13 Ga0070700_100693768 3300005441 Bacteria 809
14 Ga0070681_10035392 3300005458 Bacteria 5016
15 Ga0070681_11307920 3300005458 Bacteria 648
16 Ga0070679_100018201 3300005530 Bacteria 6812
17 Ga0068853_100358370 3300005539 Bacteria 1358
18 Ga0070686_100022056 3300005544 Bacteria 3790
19 Ga0070695_101077542 3300005545 Bacteria 657
20 Ga0070696_100081640 3300005546 Bacteria 2291
21 Ga0070704_100190732 3300005549 Bacteria 1647
22 Ga0070664_100116944 3300005564 Bacteria 2332
23 Ga0068854_100640050 3300005578 Bacteria 912
24 Ga0068866_10515398 3300005718 Bacteria 794
25 Ga0068861_101396382 3300005719 Bacteria 684
26 Ga0068863_100322777 3300005841 Bacteria 1500
27 Ga0068863_100771855 3300005841 Bacteria 958
28 Ga0068858_101245235 3300005842 Bacteria 732
29 Ga0068860_100376605 3300005843 Bacteria 1401
30 Ga0068860_100616349 3300005843 Bacteria 1091
31 Ga0081538_10223088 3300005981 Bacteria 745
32 Ga0081538_10349264 3300005981 Bacteria 536
33 Ga0075368_10064565 3300006042 Bacteria 1470
34 Ga0075363_100033466 3300006048 Bacteria 2676
35 Ga0070716_100415034 3300006173 Bacteria 972
36 Ga0075362_10106233 3300006177 Bacteria 1318
37 Ga0075367_10179308 3300006178 Bacteria 1320
38 Ga0075367_10273708 3300006178 Bacteria 1061
39 Ga0075367_10344124 3300006178 Bacteria 941
40 Ga0075367_10386056 3300006178 Bacteria 885
41 Ga0075367_10869119 3300006178 Bacteria 575
42 Ga0075369_10607771 3300006186 Bacteria 524
43 Ga0075366_10035266 3300006195 Bacteria 2949
44 Ga0075366_10970703 3300006195 Bacteria 530
45 Ga0075370_10071728 3300006353 Bacteria 1982
46 Ga0068871_102310900 3300006358 Bacteria 513
47 Ga0075429_100165035 3300006880 Bacteria 1940
48 Ga0105240_10187266 3300009093 Bacteria 2437
49 Ga0105245_12915518 3300009098 Bacteria 530
50 Ga0105247_11563343 3300009101 Bacteria 540
51 Ga0114129_10088627 3300009147 Bacteria 4289
52 Ga0105243_11861927 3300009148 Bacteria 634
53 Ga0105241_11793754 3300009174 Bacteria 599
54 Ga0105242_10108527 3300009176 Bacteria 2362
55 Ga0105248_12750764 3300009177 Bacteria 561
56 Ga0105238_10300649 3300009551 Bacteria 1588
57 Ga0105246_11535533 3300011119 Bacteria 627
58 Ga0157371_10410691 3300013102 Bacteria 991
59 Ga0157369_10951926 3300013105 Bacteria 880
60 Ga0157374_10910114 3300013296 Bacteria 897
61 Ga0157372_11684369 3300013307 Bacteria 730
62 Ga0163163_12000656 3300014325 Bacteria 639
63 Ga0157380_10151750 3300014326 Bacteria 2004
64 Ga0157380_11269100 3300014326 Bacteria 783
65 Ga0157380_11292967 3300014326 Bacteria 776
66 Ga0182008_10054945 3300014497 Bacteria 1969
67 Ga0157379_10237908 3300014968 Bacteria 1651
68 Ga0157376_11441802 3300014969 Bacteria 721
69 Ga0197907_10210511 3300020069 Bacteria 906
70 Ga0206352_11121659 3300020078 Bacteria 552
71 Ga0206350_10989937 3300020080 Bacteria 1603
72 Ga0206353_10564732 3300020082 Bacteria 651
73 Ga0154015_1524117 3300020610 Bacteria 654
74 Ga0224712_10332465 3300022467 Bacteria 715
75 Ga0224712_10562512 3300022467 Bacteria 555
76 Ga0209758_1001779 3300025297 Bacteria 23875
77 Ga0207685_10371111 3300025905 Bacteria 726
78 Ga0207643_10404882 3300025908 Bacteria 863
79 Ga0207705_10579963 3300025909 Bacteria 872
80 Ga0207654_11310044 3300025911 Bacteria 528
81 Ga0207707_10018555 3300025912 Bacteria 6063
82 Ga0207707_10191380 3300025912 Bacteria 1785
83 Ga0207695_10462733 3300025913 Bacteria 1151
84 Ga0207663_11628384 3300025916 Bacteria 520
85 Ga0207660_11343875 3300025917 Bacteria 580
86 Ga0207662_10053393 3300025918 Bacteria 2408
87 Ga0207652_10109913 3300025921 Bacteria 2444
88 Ga0207687_10159331 3300025927 Bacteria 1730
89 Ga0207686_10015381 3300025934 Bacteria 4278
90 Ga0207709_11380863 3300025935 Bacteria 583
91 Ga0207670_11528278 3300025936 Bacteria 568
92 Ga0207689_10220779 3300025942 Bacteria 1566
93 Ga0207689_10775917 3300025942 Bacteria 809
94 Ga0207668_10344731 3300025972 Bacteria 1244
95 Ga0207668_10554199 3300025972 Bacteria 996
96 Ga0207703_10258908 3300026035 Bacteria 1572
97 Ga0207708_10771930 3300026075 Bacteria 826
98 Ga0207641_10229913 3300026088 Bacteria 1723
99 Ga0209813_10037375 3300027866 Bacteria 1463
100 Ga0268266_11701529 3300028379 Bacteria 606
101 Ga0268264_10727594 3300028381 Bacteria 987
102 Ga0265763_1053776 3300030763 Bacteria 513
103 Ga0265325_10020113 3300031241 Bacteria 3684
104 Ga0265339_10090960 3300031249 Bacteria 1600
105 Ga0265331_10453844 3300031250 Bacteria 576
106 Ga0307513_10220563 3300031456 Bacteria 1718
107 Ga0307513_10646143 3300031456 Bacteria 765
108 Ga0307508_10412893 3300031616 Bacteria 941
109 Ga0307410_10026249 3300031852 Bacteria 3665
110 Ga0307406_10686278 3300031901 Bacteria 854
111 Ga0307407_10620777 3300031903 Bacteria 807
112 Ga0307409_100006906 3300031995 Bacteria 6731
113 Ga0307411_10373369 3300032005 Bacteria 1170
114 Ga0307411_11033571 3300032005 Bacteria 737
115 Ga0307415_101334456 3300032126 Bacteria 681
116 Ga0307510_10076669 3300033180 Bacteria 3286
117 Ga0373930_0010972 3300034816 Bacteria 1629
118 Ga0373938_0020953 3300034957 Bacteria 1321
119 Ga0373940_0231961 3300035088 Bacteria 617
120 Ga0373944_0202828 3300035089 Bacteria 719
121 Ga0373952_0157756 3300035092 Bacteria 641
122 Ga0373939_0065148 3300035114 Bacteria 1171
123 Ga0373960_0006446 3300035121 Bacteria 2754
124 Ga0373946_0461198 3300035171 Bacteria 648
125 Ga0373961_0371947 3300035241 Bacteria 543
126 Ga0316574_0115174 3300035398 Bacteria 1724
127 Ga0373935_1102044 3300035692 Bacteria 591
128 Ga0373927_0600770 3300035695 Bacteria 727
129 Ga0373933_1031726 3300035724 Bacteria 542
130 Ga0373937_0066918 3300036401 Bacteria 3310
131 Ga0373937_0721955 3300036401 Bacteria 943
132 Ga0395900_0819823 3300037418 Bacteria 857
133 Ga0395898_0032453 3300037466 Bacteria 5212
134 Ga0395901_0510727 3300038443 Bacteria 1222
135 Ga0436360_0062458 3300039438 Bacteria 1612
136 Ga0436360_0272181 3300039438 Bacteria 1283
137 Ga0436360_0702660 3300039438 Bacteria 5269
138 Ga0436360_1102555 3300039438 Bacteria 621
139 Ga0436363_0481178 3300039450 Bacteria 1224
140 Ga0436362_0093249 3300039453 Bacteria 1220
141 Ga0436362_0954458 3300039453 Bacteria 663
142 Ga0439453_0011336 3300041408 Bacteria 1485
143 Ga0439461_0096544 3300041410 Bacteria 715
144 Ga0451793_1433183 3300041452 Bacteria 510
145 Ga0451793_1570672 3300041452 Bacteria 832
146 Ga0451845_0864134 3300041501 Bacteria 526
147 Ga0451847_0413834 3300041503 Bacteria 810
148 Ga0439441_105528 3300042001 Bacteria 635
149 Ga0450923_051108 3300042125 Bacteria 888
150 Ga0439459_0042121 3300042438 Bacteria 974
151 Ga0450918_052274 3300042531 Bacteria 746
152 Ga0466963_0251883 3300044694 Bacteria 1239
153 Ga0466958_0358600 3300045836 Bacteria 939
154 Ga0466958_0874942 3300045836 Bacteria 586
155 Ga0495592_0862058 3300046454 Bacteria 534
156 Ga0495662_0325462 3300046476 Bacteria 756
157 Ga0495664_0873676 3300046477 Bacteria 526
158 Ga0495608_0477982 3300046511 Bacteria 756
159 Ga0495643_0433097 3300046522 Bacteria 575
160 Ga0495652_0686911 3300046529 Bacteria 690
161 Ga0495640_0570225 3300046533 Bacteria 685
162 Ga0495587_0138307 3300046536 Bacteria 1391
163 Ga0495645_0288794 3300046543 Bacteria 1076
164 Ga0495635_0936207 3300046663 Bacteria 553
165 Ga0495623_0368401 3300046679 Bacteria 779
166 Ga0495646_0383771 3300046680 Bacteria 732
167 Ga0495658_0786898 3300046683 Bacteria 609
168 Ga0495674_0165876 3300047319 Bacteria 1846
169 Ga0495684_0569333 3300047471 Bacteria 769
170 Ga0495602_0476159 3300048088 Bacteria 877
171 Ga0496100_1054773 3300048903 Bacteria 640
172 Ga0496102_0094367 3300048905 Bacteria 2772
173 Ga0496104_0032628 3300048907 Bacteria 4847
174 Ga0496109_0046697 3300048912 Bacteria 3934
175 Ga0496110_0022894 3300048913 Bacteria 5309
176 Ga0496111_0170056 3300048914 Bacteria 1619
177 Ga0496112_0101464 3300048915 Bacteria 2847
178 Ga0496113_0287324 3300048916 Bacteria 1315
179 Ga0496114_0010841 3300048917 Bacteria 7258
180 Ga0496114_1494667 3300048917 Bacteria 563
181 Ga0496119_0010207 3300048922 Bacteria 7925
182 Ga0496121_0379385 3300048924 Bacteria 933
183 Ga0496122_0002869 3300048925 Bacteria 23591
184 Ga0496123_0002165 3300048926 Bacteria 25070
185 Ga0496126_1222364 3300048929 Bacteria 551
186 Ga0501031_0090473 3300049568 Bacteria 1996
187 Ga0501032_0163697 3300049569 Bacteria 1460
188 Ga0501032_0186184 3300049569 Bacteria 1358
189 Ga0501033_0092867 3300049570 Bacteria 2207
190 Ga0501034_0022451 3300049571 Bacteria 6431
191 Ga0501034_0081229 3300049571 Bacteria 3244
192 Ga0501034_0381338 3300049571 Bacteria 1335
193 Ga0501036_0010401 3300049572 Bacteria 7682
194 Ga0501037_0029064 3300049573 Bacteria 4083
195 Ga0501037_0121698 3300049573 Bacteria 1876
196 Ga0501038_0070031 3300049574 Bacteria 2978
197 Ga0501038_0970779 3300049574 Bacteria 625
198 Ga0501039_0381751 3300049575 Bacteria 1107
199 Ga0501043_0031672 3300049579 Bacteria 4157
200 Ga0501043_0058703 3300049579 Bacteria 3020
201 Ga0501047_0059026 3300049581 Bacteria 3705
202 Ga0501047_0102245 3300049581 Bacteria 2745
203 Ga0501048_0345602 3300049582 Bacteria 1061
204 Ga0501048_0413451 3300049582 Bacteria 965
205 Ga0501068_0049729 3300049584 Bacteria 2533
206 Ga0501070_0060801 3300049586 Bacteria 3131
207 Ga0501070_0084822 3300049586 Bacteria 2622
208 Ga0501071_0933174 3300049587 Bacteria 670
209 Ga0501072_0140433 3300049588 Bacteria 1926
210 Ga0501073_0042340 3300049589 Bacteria 3214
211 Ga0501073_0103157 3300049589 Bacteria 1980
212 Ga0501077_0736084 3300049593 Bacteria 634
213 Ga0501079_0894561 3300049741 Bacteria 699
214 Ga0501080_0139635 3300049742 Bacteria 2241
215 Ga0501080_0398614 3300049742 Bacteria 1238
216 Ga0501081_0422943 3300049743 Bacteria 988
217 Ga0501044_0004447 3300049823 Bacteria 15680
218 Ga0501044_0079796 3300049823 Bacteria 3315
219 Ga0501044_0275546 3300049823 Bacteria 1617
220 nmdc:mga00v17_166132_c1 3300050491 Bacteria 1422
221 nmdc:mga0k408_1244_c1 3300050493 Bacteria 13918
222 nmdc:mga0k408_13616_c1 3300050493 Bacteria 4465
223 nmdc:mga0k408_238204_c1 3300050493 Bacteria 1086
224 nmdc:mga06z11_296517_c1 3300050494 Bacteria 960
225 nmdc:mga06z11_380428_c1 3300050494 Bacteria 848
226 nmdc:mga07m45_421707_c1 3300050496 Bacteria 774
227 nmdc:mga07m45_542843_c1 3300050496 Bacteria 672
228 nmdc:mga05p37_376369_c1 3300050507 Bacteria 1665
229 nmdc:mga0qj67_1057352_c1 3300050509 Bacteria 635
230 nmdc:mga0sz30_311584_c1 3300050516 Bacteria 702
231 Ga0495601_0454387 3300053077 Bacteria 828
232 Ga0495612_0158571 3300053078 Bacteria 987
233 Ga0495595_0230887 3300053084 Bacteria 924
234 Ga0495595_0433300 3300053084 Bacteria 668
235 Ga0495595_0681541 3300053084 Bacteria 527
236 Ga0495619_0091251 3300053085 Bacteria 2062
237 Ga0495619_0673888 3300053085 Bacteria 704
238 Ga0495619_0961809 3300053085 Bacteria 572
239 Ga0500641_0118880 3300053096 Bacteria 1138
240 Ga0500556_0000071 3300053104 Bacteria 100768
241 Ga0500595_007723 3300053119 Bacteria 4447
242 Ga0500642_0055622 3300053130 Bacteria 1760
243 Ga0500652_093569 3300053131 Bacteria 1255
244 Ga0500652_204448 3300053131 Bacteria 800
245 Ga0500658_0450066 3300053134 Bacteria 586
246 Ga0500568_0036963 3300053139 Bacteria 1984
247 Ga0500616_0029675 3300053153 Bacteria 3008
248 Ga0500645_023354 3300053730 Bacteria 1896
249 Ga0500645_212229 3300053730 Bacteria 520
250 Ga0500609_024488 3300053731 Bacteria 827
251 Ga0501082_0128135 3300060353 Bacteria 2202
252 Ga0501082_1308513 3300060353 Bacteria 633
253 Ga0501082_1461223 3300060353 Bacteria 597
254 Ga0466962_0196874 3300061719 Bacteria 984
255 Ga0466962_0391100 3300061719 Bacteria 695
256 2513592363 2513237087 Bacteria 5817514
257 2596376573 2595698237 Bacteria 6712432
258 2738747599 2738541281 Bacteria 5112672
259 2739356835 2738543032 Bacteria 5115625
260 2829748727 2829745981 Bacteria 5406054
261 2842702799 2842698319 Bacteria 5190321
262 2861694333 2861691609 Bacteria 5628931
263 2889306823 2889306138 Bacteria 6358934
264 2902334372 2902330777 Bacteria 6395352
265 2902411510 2902405164 Bacteria 6784948
266 2928128701 2928125067 Bacteria 5937560
267 3003671130 3003665799 Bacteria 7279786
268 Ga0501042_0075523
269 JGI25153J46596_10005628
270 Ga0070658_10246526
271 Ga0068869_100632576
272 Ga0068869_100926418
273 Ga0068869_100945411
274 Ga0070680_100117297
275 Ga0070680_100757923
276 Ga0070682_100093569
277 Ga0070668_101897376
278 Ga0070669_100416451
279 Ga0070671_100498150
280 Ga0070700_100693768
281 Ga0070681_10035392
282 Ga0070681_11307920
283 Ga0070679_100018201
284 Ga0068853_100358370
285 Ga0070686_100022056
286 Ga0070695_101077542
287 Ga0070696_100081640
288 Ga0070704_100190732
289 Ga0070664_100116944
290 Ga0068854_100640050
291 Ga0068866_10515398
292 Ga0068861_101396382
293 Ga0068863_100322777
294 Ga0068863_100771855
295 Ga0068858_101245235
296 Ga0068860_100376605
297 Ga0068860_100616349
298 Ga0081538_10223088
299 Ga0081538_10349264
300 Ga0075368_10064565
301 Ga0075363_100033466
302 Ga0070716_100415034
303 Ga0075362_10106233
304 Ga0075367_10179308
305 Ga0075367_10273708
306 Ga0075367_10344124
307 Ga0075367_10386056
308 Ga0075367_10869119
309 Ga0075369_10607771
310 Ga0075366_10035266
311 Ga0075366_10970703
312 Ga0075370_10071728
313 Ga0068871_102310900
314 Ga0075429_100165035
315 Ga0105240_10187266
316 Ga0105245_12915518
317 Ga0105247_11563343
318 Ga0114129_10088627
319 Ga0105243_11861927
320 Ga0105241_11793754
321 Ga0105242_10108527
322 Ga0105248_12750764
323 Ga0105238_10300649
324 Ga0105246_11535533
325 Ga0157371_10410691
326 Ga0157369_10951926
327 Ga0157374_10910114
328 Ga0157372_11684369
329 Ga0163163_12000656
330 Ga0157380_10151750
331 Ga0157380_11269100
332 Ga0157380_11292967
333 Ga0182008_10054945
334 Ga0157379_10237908
335 Ga0157376_11441802
336 Ga0197907_10210511
337 Ga0206352_11121659
338 Ga0206350_10989937
339 Ga0206353_10564732
340 Ga0154015_1524117
341 Ga0224712_10332465
342 Ga0224712_10562512
343 Ga0209758_1001779
344 Ga0207685_10371111
345 Ga0207643_10404882
346 Ga0207705_10579963
347 Ga0207654_11310044
348 Ga0207707_10018555
349 Ga0207707_10191380
350 Ga0207695_10462733
351 Ga0207663_11628384
352 Ga0207660_11343875
353 Ga0207662_10053393
354 Ga0207652_10109913
355 Ga0207687_10159331
356 Ga0207686_10015381
357 Ga0207709_11380863
358 Ga0207670_11528278
359 Ga0207689_10220779
360 Ga0207689_10775917
361 Ga0207668_10344731
362 Ga0207668_10554199
363 Ga0207703_10258908
364 Ga0207708_10771930
365 Ga0207641_10229913
366 Ga0209813_10037375
367 Ga0268266_11701529
368 Ga0268264_10727594
369 Ga0265763_1053776
370 Ga0265325_10020113
371 Ga0265339_10090960
372 Ga0265331_10453844
373 Ga0307513_10220563
374 Ga0307513_10646143
375 Ga0307508_10412893
376 Ga0307410_10026249
377 Ga0307406_10686278
378 Ga0307407_10620777
379 Ga0307409_100006906
380 Ga0307411_10373369
381 Ga0307411_11033571
382 Ga0307415_101334456
383 Ga0307510_10076669
384 Ga0373930_0010972
385 Ga0373938_0020953
386 Ga0373940_0231961
387 Ga0373944_0202828
388 Ga0373952_0157756
389 Ga0373939_0065148
390 Ga0373960_0006446
391 Ga0373946_0461198
392 Ga0373961_0371947
393 Ga0316574_0115174
394 Ga0373935_1102044
395 Ga0373927_0600770
396 Ga0373933_1031726
397 Ga0373937_0066918
398 Ga0373937_0721955
399 Ga0395900_0819823
400 Ga0395898_0032453
401 Ga0395901_0510727
402 Ga0436360_0062458
403 Ga0436360_0272181
404 Ga0436360_0702660
405 Ga0436360_1102555
406 Ga0436363_0481178
407 Ga0436362_0093249
408 Ga0436362_0954458
409 Ga0439453_0011336
410 Ga0439461_0096544
411 Ga0451793_1433183
412 Ga0451793_1570672
413 Ga0451845_0864134
414 Ga0451847_0413834
415 Ga0439441_105528
416 Ga0450923_051108
417 Ga0439459_0042121
418 Ga0450918_052274
419 Ga0466963_0251883
420 Ga0466958_0358600
421 Ga0466958_0874942
422 Ga0495592_0862058
423 Ga0495662_0325462
424 Ga0495664_0873676
425 Ga0495608_0477982
426 Ga0495643_0433097
427 Ga0495652_0686911
428 Ga0495640_0570225
429 Ga0495587_0138307
430 Ga0495645_0288794
431 Ga0495635_0936207
432 Ga0495623_0368401
433 Ga0495646_0383771
434 Ga0495658_0786898
435 Ga0495674_0165876
436 Ga0495684_0569333
437 Ga0495602_0476159
438 Ga0496100_1054773
439 Ga0496102_0094367
440 Ga0496104_0032628
441 Ga0496109_0046697
442 Ga0496110_0022894
443 Ga0496111_0170056
444 Ga0496112_0101464
445 Ga0496113_0287324
446 Ga0496114_0010841
447 Ga0496114_1494667
448 Ga0496119_0010207
449 Ga0496121_0379385
450 Ga0496122_0002869
451 Ga0496123_0002165
452 Ga0496126_1222364
453 Ga0501031_0090473
454 Ga0501032_0163697
455 Ga0501032_0186184
456 Ga0501033_0092867
457 Ga0501034_0022451
458 Ga0501034_0081229
459 Ga0501034_0381338
460 Ga0501036_0010401
461 Ga0501037_0029064
462 Ga0501037_0121698
463 Ga0501038_0070031
464 Ga0501038_0970779
465 Ga0501039_0381751
466 Ga0501043_0031672
467 Ga0501043_0058703
468 Ga0501047_0059026
469 Ga0501047_0102245
470 Ga0501048_0345602
471 Ga0501048_0413451
472 Ga0501068_0049729
473 Ga0501070_0060801
474 Ga0501070_0084822
475 Ga0501071_0933174
476 Ga0501072_0140433
477 Ga0501073_0042340
478 Ga0501073_0103157
479 Ga0501077_0736084
480 Ga0501079_0894561
481 Ga0501080_0139635
482 Ga0501080_0398614
483 Ga0501081_0422943
484 Ga0501044_0004447
485 Ga0501044_0079796
486 Ga0501044_0275546
487 nmdc:mga00v17_166132_c1
488 nmdc:mga0k408_1244_c1
489 nmdc:mga0k408_13616_c1
490 nmdc:mga0k408_238204_c1
491 nmdc:mga06z11_296517_c1
492 nmdc:mga06z11_380428_c1
493 nmdc:mga07m45_421707_c1
494 nmdc:mga07m45_542843_c1
495 nmdc:mga05p37_376369_c1
496 nmdc:mga0qj67_1057352_c1
497 nmdc:mga0sz30_311584_c1
498 Ga0495601_0454387
499 Ga0495612_0158571
500 Ga0495595_0230887
501 Ga0495595_0433300
502 Ga0495595_0681541
503 Ga0495619_0091251
504 Ga0495619_0673888
505 Ga0495619_0961809
506 Ga0500641_0118880
507 Ga0500556_0000071
508 Ga0500595_007723
509 Ga0500642_0055622
510 Ga0500652_093569
511 Ga0500652_204448
512 Ga0500658_0450066
513 Ga0500568_0036963
514 Ga0500616_0029675
515 Ga0500645_023354
516 Ga0500645_212229
517 Ga0500609_024488
518 Ga0501082_0128135
519 Ga0501082_1308513
520 Ga0501082_1461223
521 Ga0466962_0196874
522 Ga0466962_0391100
523 2513592363
524 2596376573
525 2738747599
526 2739356835
527 2829748727
528 2842702799
529 2861694333
530 2889306823
531 2902334372
532 2902411510
533 2928128701
534 3003671130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

10

111

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.9114 11 103
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8779 9 106
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8696 9 106
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8564 11 105
1x0g-assembly1.cif.gz_C crystal structure of isca with the [2fe-2s] cluster 0.8266 11 111
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9114 11 103 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8835 11 103 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8818 11 111 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8742 11 94 2.60.300.12
af_P77667_17_122_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8603 11 111 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A1G1M7N8-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.9354 11 105 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A531KMU7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9283 11 106 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A7X9HXH7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.921 11 102 GO:0005506
GO:0016020
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A531KMU7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9103 11 106 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A6N8UQF9-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.9099 8 105 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Map