F374854

General Info

Members Datasets Scaffolds Average Seq Length
267 150 534 216

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10905907|Ga0268265_109059071
Length 241
Sequence MCSRLLSDVLVIHWTKHLAQSTKHMKIVSLNVGRPQLVMRDGEPVSTAIFKQPVEGRVMLRTLNLDGDRQADLSVHGGPTKAVYVYPAEHYEFWRREFPEMELPYGMFGENFTATGFSETTLNIGDQFRVGLATVMVTEPRMPCYKLGIRFGRTDIIKRFLVSERSGFYLAVLEEGEVGIGDEFQLLKRNEPSVTVNEIVSLYSRDKNNSELLRRAIAVQELPESWRRYFQERLQTMQSKS

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.25
Rhizosphere 95.51
Stem 0
Stem Tuber 0
Unclassified 27.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10905907 3300028380 Unclassified 866
2 SwRhRL3b_contig_1649321 2162886006 Bacteria 1048
3 LJNas_1000026 3300000546 Bacteria 19576
4 Ga0065704_10008682 3300005289 Bacteria 3020
5 Ga0065704_10188615 3300005289 Bacteria 1200
6 Ga0065712_10154741 3300005290 Unclassified 1343
7 Ga0065715_10252688 3300005293 Bacteria 1162
8 Ga0065707_10001703 3300005295 Bacteria 6572
9 Ga0070670_100000043 3300005331 Bacteria 141622
10 Ga0070670_100483349 3300005331 Unclassified 1100
11 Ga0070680_100017203 3300005336 Bacteria 5697
12 Ga0070682_100000570 3300005337 Bacteria 22750
13 Ga0068868_100231707 3300005338 Bacteria 1549
14 Ga0070689_100705517 3300005340 Unclassified 881
15 Ga0070687_100085247 3300005343 Bacteria 1733
16 Ga0070687_100433921 3300005343 Bacteria 870
17 Ga0070669_100189813 3300005353 Unclassified 1611
18 Ga0070671_100003581 3300005355 Bacteria 12149
19 Ga0070674_100163453 3300005356 Bacteria 1691
20 Ga0070673_100017845 3300005364 Bacteria 5057
21 Ga0070673_100041702 3300005364 Bacteria 3533
22 Ga0070688_100733036 3300005365 Unclassified 768
23 Ga0070701_10048831 3300005438 Unclassified 2185
24 Ga0070701_10141853 3300005438 Bacteria 1375
25 Ga0070705_100455558 3300005440 Bacteria 961
26 Ga0070700_100033394 3300005441 Bacteria 3099
27 Ga0070700_100197456 3300005441 Archaea 1411
28 Ga0070694_100062687 3300005444 Bacteria 2541
29 Ga0070694_100095664 3300005444 Bacteria 2092
30 Ga0070694_100129673 3300005444 Bacteria 1820
31 Ga0070708_100127164 3300005445 Bacteria 2356
32 Ga0070678_100279315 3300005456 Bacteria 1412
33 Ga0070681_10003300 3300005458 Bacteria 15066
34 Ga0068867_100092543 3300005459 Bacteria 2296
35 Ga0068867_100148344 3300005459 Unclassified 1840
36 Ga0070685_10158195 3300005466 Bacteria 1442
37 Ga0070706_100008961 3300005467 Bacteria 9318
38 Ga0070706_100350700 3300005467 Unclassified 1375
39 Ga0070707_100019137 3300005468 Bacteria 6448
40 Ga0070707_100477867 3300005468 Bacteria 1208
41 Ga0070698_100002686 3300005471 Bacteria 19596
42 Ga0070698_100197903 3300005471 Bacteria 1945
43 Ga0070698_100574851 3300005471 Unclassified 1067
44 Ga0070699_100449352 3300005518 Unclassified 1168
45 Ga0070679_100000052 3300005530 Bacteria 85455
46 Ga0070697_100125857 3300005536 Unclassified 2146
47 Ga0070697_100728126 3300005536 Unclassified 876
48 Ga0068853_100062155 3300005539 Bacteria 3230
49 Ga0070672_100101640 3300005543 Bacteria 2332
50 Ga0070672_100233952 3300005543 Unclassified 1544
51 Ga0070686_100110827 3300005544 Bacteria 1869
52 Ga0070686_100671917 3300005544 Unclassified 823
53 Ga0070695_100155782 3300005545 Bacteria 1598
54 Ga0070695_100363404 3300005545 Bacteria 1088
55 Ga0070695_100540468 3300005545 Bacteria 907
56 Ga0070695_100822410 3300005545 Bacteria 746
57 Ga0070696_100141181 3300005546 Bacteria 1761
58 Ga0070696_100726477 3300005546 Unclassified 812
59 Ga0070665_100131993 3300005548 Unclassified 2500
60 Ga0070665_101209017 3300005548 Bacteria 766
61 Ga0070704_100014233 3300005549 Bacteria 4965
62 Ga0070704_100071506 3300005549 Bacteria 2521
63 Ga0068854_100279336 3300005578 Unclassified 1344
64 Ga0068856_100026049 3300005614 Bacteria 5703
65 Ga0070702_100048347 3300005615 Bacteria 2421
66 Ga0068852_100275629 3300005616 Unclassified 1620
67 Ga0068859_100108339 3300005617 Bacteria 2839
68 Ga0068859_100173365 3300005617 Bacteria 2239
69 Ga0068859_100236235 3300005617 Unclassified 1916
70 Ga0068859_100379779 3300005617 Unclassified 1508
71 Ga0068864_100001404 3300005618 Bacteria 19927
72 Ga0068866_10022472 3300005718 Bacteria 2920
73 Ga0068870_10117987 3300005840 Unclassified 1524
74 Ga0068870_10129197 3300005840 Bacteria 1466
75 Ga0068863_100112448 3300005841 Bacteria 2593
76 Ga0068863_100218631 3300005841 Bacteria 1835
77 Ga0068858_100070356 3300005842 Unclassified 3243
78 Ga0068858_100107620 3300005842 Unclassified 2603
79 Ga0068858_100109424 3300005842 Bacteria 2580
80 Ga0068860_100027938 3300005843 Bacteria 5432
81 Ga0068860_100041066 3300005843 Bacteria 4419
82 Ga0068860_100119543 3300005843 Bacteria 2522
83 Ga0068860_100129916 3300005843 Unclassified 2417
84 Ga0068862_100618647 3300005844 Bacteria 1042
85 Ga0068862_100741506 3300005844 Bacteria 955
86 Ga0068862_100823293 3300005844 Unclassified 908
87 Ga0081540_1128865 3300005983 Bacteria 1036
88 Ga0097621_100005230 3300006237 Bacteria 9125
89 Ga0097621_100020584 3300006237 Bacteria 5084
90 Ga0097621_100035354 3300006237 Bacteria 3992
91 Ga0097621_100078664 3300006237 Bacteria 2740
92 Ga0097621_100507110 3300006237 Bacteria 1093
93 Ga0068871_100012277 3300006358 Bacteria 6310
94 Ga0068871_100021066 3300006358 Bacteria 5004
95 Ga0075428_100510089 3300006844 Bacteria 1286
96 Ga0075430_100000075 3300006846 Archaea 54285
97 Ga0075431_100000241 3300006847 Archaea 41229
98 Ga0075431_100295752 3300006847 Unclassified 1637
99 Ga0075433_10036439 3300006852 Bacteria 4238
100 Ga0075433_10143871 3300006852 Bacteria 2120
101 Ga0075433_10497156 3300006852 Unclassified 1074
102 Ga0075434_100019323 3300006871 Bacteria 6593
103 Ga0075434_100157647 3300006871 Bacteria 2289
104 Ga0075429_100000311 3300006880 Archaea 34678
105 Ga0068865_100502572 3300006881 Bacteria 1011
106 Ga0097620_100108343 3300006931 Bacteria 2839
107 Ga0097620_100173365 3300006931 Bacteria 2239
108 Ga0097620_100236221 3300006931 Unclassified 1916
109 Ga0097620_100379778 3300006931 Unclassified 1508
110 Ga0075435_100111314 3300007076 Bacteria 2278
111 Ga0099795_10013072 3300007788 Bacteria 2537
112 Ga0111539_10000598 3300009094 Archaea 46631
113 Ga0111539_10014267 3300009094 Bacteria 9925
114 Ga0111539_10449800 3300009094 Unclassified 1500
115 Ga0105245_10021406 3300009098 Bacteria 5672
116 Ga0114129_10011614 3300009147 Bacteria 12538
117 Ga0114129_10016189 3300009147 Archaea 10612
118 Ga0114129_10138092 3300009147 Bacteria 3344
119 Ga0114129_11398099 3300009147 Unclassified 864
120 Ga0105243_10026789 3300009148 Bacteria 4414
121 Ga0105243_10163462 3300009148 Unclassified 1921
122 Ga0105243_10191797 3300009148 Bacteria 1785
123 Ga0105243_10748788 3300009148 Unclassified 958
124 Ga0105242_10036133 3300009176 Bacteria 3962
125 Ga0105242_10177771 3300009176 Bacteria 1875
126 Ga0105242_10641341 3300009176 Unclassified 1032
127 Ga0105242_10842250 3300009176 Bacteria 912
128 Ga0105248_10007038 3300009177 Bacteria 12321
129 Ga0105248_10012449 3300009177 Bacteria 9383
130 Ga0105248_10037524 3300009177 Bacteria 5422
131 Ga0105248_10354994 3300009177 Unclassified 1651
132 Ga0105248_10479696 3300009177 Bacteria 1402
133 Ga0105237_10117584 3300009545 Bacteria 2652
134 Ga0105237_10185646 3300009545 Bacteria 2079
135 Ga0105237_11191514 3300009545 Unclassified 768
136 Ga0105249_10037001 3300009553 Bacteria 4428
137 Ga0105249_10200542 3300009553 Unclassified 1952
138 Ga0105239_10152863 3300010375 Bacteria 2576
139 Ga0105239_10225893 3300010375 Bacteria 2100
140 Ga0105246_10056755 3300011119 Bacteria 2708
141 Ga0157374_10572398 3300013296 Unclassified 1138
142 Ga0157378_10000878 3300013297 Bacteria 27758
143 Ga0157378_10059080 3300013297 Bacteria 3420
144 Ga0157378_10189698 3300013297 Bacteria 1938
145 Ga0163162_10000838 3300013306 Bacteria 28591
146 Ga0163162_10035211 3300013306 Bacteria 4985
147 Ga0157372_10049094 3300013307 Bacteria 4692
148 Ga0157372_10671166 3300013307 Unclassified 1207
149 Ga0157375_10019783 3300013308 Bacteria 6134
150 Ga0157375_10131985 3300013308 Bacteria 2618
151 Ga0157375_11162911 3300013308 Bacteria 904
152 Ga0163163_10000144 3300014325 Bacteria 74369
153 Ga0163163_10004068 3300014325 Bacteria 12470
154 Ga0163163_10058369 3300014325 Unclassified 3815
155 Ga0163163_10254892 3300014325 Bacteria 1805
156 Ga0157380_10508939 3300014326 Bacteria 1171
157 Ga0157380_10669197 3300014326 Bacteria 1038
158 Ga0157379_10149629 3300014968 Bacteria 2106
159 Ga0157376_10024546 3300014969 Unclassified 4736
160 Ga0163161_10012424 3300017792 Bacteria 5913
161 Ga0163161_10398498 3300017792 Bacteria 1103
162 Ga0213876_10000118 3300021384 Bacteria 86390
163 Ga0213876_10000367 3300021384 Bacteria 38378
164 Ga0213876_10016015 3300021384 Bacteria 3966
165 Ga0207697_10117060 3300025315 Bacteria 1145
166 Ga0207682_10011747 3300025893 Bacteria 3422
167 Ga0207688_10098156 3300025901 Bacteria 1688
168 Ga0207680_10075461 3300025903 Unclassified 2103
169 Ga0207647_10017875 3300025904 Unclassified 4811
170 Ga0207647_10103115 3300025904 Unclassified 1692
171 Ga0207684_10042668 3300025910 Bacteria 3846
172 Ga0207654_10313406 3300025911 Unclassified 1070
173 Ga0207707_10000014 3300025912 Bacteria 261972
174 Ga0207660_10002404 3300025917 Bacteria 12302
175 Ga0207662_10013909 3300025918 Unclassified 4505
176 Ga0207662_10075422 3300025918 Unclassified 2049
177 Ga0207662_10438354 3300025918 Unclassified 892
178 Ga0207652_10000031 3300025921 Bacteria 143723
179 Ga0207646_10030348 3300025922 Bacteria 4902
180 Ga0207646_10602061 3300025922 Unclassified 986
181 Ga0207681_10437140 3300025923 Bacteria 1062
182 Ga0207694_10103454 3300025924 Bacteria 2258
183 Ga0207650_10282057 3300025925 Unclassified 1353
184 Ga0207644_10126490 3300025931 Unclassified 1951
185 Ga0207644_10246044 3300025931 Bacteria 1425
186 Ga0207686_10619914 3300025934 Unclassified 853
187 Ga0207669_10570295 3300025937 Bacteria 916
188 Ga0207704_10430175 3300025938 Bacteria 1049
189 Ga0207691_10005670 3300025940 Bacteria 12067
190 Ga0207711_10069638 3300025941 Bacteria 3050
191 Ga0207711_10340105 3300025941 Bacteria 1389
192 Ga0207711_10686367 3300025941 Unclassified 955
193 Ga0207689_10014720 3300025942 Bacteria 6643
194 Ga0207689_10024503 3300025942 Bacteria 5063
195 Ga0207689_10533607 3300025942 Bacteria 985
196 Ga0207651_10171464 3300025960 Bacteria 1712
197 Ga0207651_10382237 3300025960 Bacteria 1193
198 Ga0207712_10087026 3300025961 Bacteria 2290
199 Ga0207712_10157497 3300025961 Unclassified 1761
200 Ga0207640_10188916 3300025981 Bacteria 1551
201 Ga0207677_10068686 3300026023 Unclassified 2489
202 Ga0207677_10317096 3300026023 Bacteria 1294
203 Ga0207703_10012423 3300026035 Bacteria 6638
204 Ga0207703_10090992 3300026035 Unclassified 2565
205 Ga0207708_10052655 3300026075 Bacteria 3100
206 Ga0207708_10494120 3300026075 Bacteria 1025
207 Ga0207702_10017043 3300026078 Bacteria 6010
208 Ga0207702_10560671 3300026078 Bacteria 1118
209 Ga0207641_10209481 3300026088 Bacteria 1802
210 Ga0207641_10599510 3300026088 Bacteria 1078
211 Ga0207648_10031995 3300026089 Bacteria 4648
212 Ga0207648_10120261 3300026089 Unclassified 2309
213 Ga0207676_10006622 3300026095 Bacteria 8191
214 Ga0207675_100006726 3300026118 Bacteria 10871
215 Ga0207675_100346150 3300026118 Bacteria 1456
216 Ga0207675_100777479 3300026118 Unclassified 970
217 Ga0207698_10175384 3300026142 Bacteria 1892
218 Ga0207698_10190354 3300026142 Bacteria 1827
219 Ga0207428_10000396 3300027907 Archaea 54187
220 Ga0207428_10031813 3300027907 Bacteria 4347
221 Ga0207428_10037594 3300027907 Bacteria 3938
222 Ga0268265_10605779 3300028380 Unclassified 1047
223 Ga0268265_10776032 3300028380 Bacteria 932
224 Ga0268265_10872251 3300028380 Unclassified 882
225 Ga0268264_10003557 3300028381 Bacteria 13414
226 Ga0268264_10092190 3300028381 Unclassified 2614
227 Ga0307416_100500869 3300032002 Bacteria 1279
228 Ga0307416_100853420 3300032002 Unclassified 1009
229 Ga0307415_100330680 3300032126 Bacteria 1275
230 Ga0373937_0266130 3300036401 Bacteria 1617
231 Ga0395900_0101005 3300037418 Bacteria 2963
232 Ga0395905_0239201 3300037471 Unclassified 1697
233 Ga0242420_000825 3300038996 Unclassified 3793
234 Ga0436365_0058572 3300039437 Bacteria 10762
235 Ga0436365_1046599 3300039437 Bacteria 47009
236 Ga0436365_1468983 3300039437 Bacteria 43990
237 Ga0439439_0087082 3300041406 Bacteria 850
238 Ga0453683_0203547 3300044673 Bacteria 1257
239 Ga0466966_0127783 3300044684 Unclassified 1558
240 Ga0495632_0001279 3300046519 Bacteria 21296
241 Ga0495598_0046259 3300046537 Unclassified 1293
242 Ga0495621_0007733 3300046539 Bacteria 3193
243 Ga0495672_0083086 3300047320 Bacteria 1780
244 Ga0496102_0040918 3300048905 Bacteria 4195
245 Ga0496104_0099392 3300048907 Bacteria 2786
246 Ga0496106_0032790 3300048909 Bacteria 3874
247 Ga0496106_0129153 3300048909 Bacteria 1981
248 Ga0496108_0239236 3300048911 Bacteria 1579
249 Ga0496112_0345829 3300048915 Bacteria 1430
250 Ga0501259_072117 3300049688 Bacteria 743
251 Ga0501081_0635224 3300049743 Unclassified 800
252 nmdc:mga05p37_237469_c1 3300050507 Bacteria 2193
253 nmdc:mga05p37_477_c1 3300050507 Archaea 43697
254 nmdc:mga09592_564365_c1 3300050508 Unclassified 977
255 nmdc:mga09592_73_c1 3300050508 Archaea 56945
256 nmdc:mga09592_845715_c1 3300050508 Bacteria 772
257 nmdc:mga0qj67_845_c1 3300050509 Archaea 20985
258 nmdc:mga06r32_454_c2 3300050510 Archaea 10408
259 nmdc:mga08y16_3858_c1 3300050511 Bacteria 15586
260 nmdc:mga08y16_4537_c1 3300050511 Archaea 14471
261 nmdc:mga08y16_755517_c1 3300050511 Unclassified 968
262 nmdc:mga08y16_81328_c1 3300050511 Bacteria 3378
263 nmdc:mga0n895_572185_c1 3300050512 Unclassified 1134
264 nmdc:mga0n895_659112_c1 3300050512 Unclassified 1045
265 nmdc:mga0a205_105061_c1 3300050515 Unclassified 2723
266 nmdc:mga0a205_85903_c1 3300050515 Bacteria 3038
267 nmdc:mga0a205_981296_c1 3300050515 Unclassified 692
268 Ga0268265_10905907
269 SwRhRL3b_contig_1649321
270 LJNas_1000026
271 Ga0065704_10008682
272 Ga0065704_10188615
273 Ga0065712_10154741
274 Ga0065715_10252688
275 Ga0065707_10001703
276 Ga0070670_100000043
277 Ga0070670_100483349
278 Ga0070680_100017203
279 Ga0070682_100000570
280 Ga0068868_100231707
281 Ga0070689_100705517
282 Ga0070687_100085247
283 Ga0070687_100433921
284 Ga0070669_100189813
285 Ga0070671_100003581
286 Ga0070674_100163453
287 Ga0070673_100017845
288 Ga0070673_100041702
289 Ga0070688_100733036
290 Ga0070701_10048831
291 Ga0070701_10141853
292 Ga0070705_100455558
293 Ga0070700_100033394
294 Ga0070700_100197456
295 Ga0070694_100062687
296 Ga0070694_100095664
297 Ga0070694_100129673
298 Ga0070708_100127164
299 Ga0070678_100279315
300 Ga0070681_10003300
301 Ga0068867_100092543
302 Ga0068867_100148344
303 Ga0070685_10158195
304 Ga0070706_100008961
305 Ga0070706_100350700
306 Ga0070707_100019137
307 Ga0070707_100477867
308 Ga0070698_100002686
309 Ga0070698_100197903
310 Ga0070698_100574851
311 Ga0070699_100449352
312 Ga0070679_100000052
313 Ga0070697_100125857
314 Ga0070697_100728126
315 Ga0068853_100062155
316 Ga0070672_100101640
317 Ga0070672_100233952
318 Ga0070686_100110827
319 Ga0070686_100671917
320 Ga0070695_100155782
321 Ga0070695_100363404
322 Ga0070695_100540468
323 Ga0070695_100822410
324 Ga0070696_100141181
325 Ga0070696_100726477
326 Ga0070665_100131993
327 Ga0070665_101209017
328 Ga0070704_100014233
329 Ga0070704_100071506
330 Ga0068854_100279336
331 Ga0068856_100026049
332 Ga0070702_100048347
333 Ga0068852_100275629
334 Ga0068859_100108339
335 Ga0068859_100173365
336 Ga0068859_100236235
337 Ga0068859_100379779
338 Ga0068864_100001404
339 Ga0068866_10022472
340 Ga0068870_10117987
341 Ga0068870_10129197
342 Ga0068863_100112448
343 Ga0068863_100218631
344 Ga0068858_100070356
345 Ga0068858_100107620
346 Ga0068858_100109424
347 Ga0068860_100027938
348 Ga0068860_100041066
349 Ga0068860_100119543
350 Ga0068860_100129916
351 Ga0068862_100618647
352 Ga0068862_100741506
353 Ga0068862_100823293
354 Ga0081540_1128865
355 Ga0097621_100005230
356 Ga0097621_100020584
357 Ga0097621_100035354
358 Ga0097621_100078664
359 Ga0097621_100507110
360 Ga0068871_100012277
361 Ga0068871_100021066
362 Ga0075428_100510089
363 Ga0075430_100000075
364 Ga0075431_100000241
365 Ga0075431_100295752
366 Ga0075433_10036439
367 Ga0075433_10143871
368 Ga0075433_10497156
369 Ga0075434_100019323
370 Ga0075434_100157647
371 Ga0075429_100000311
372 Ga0068865_100502572
373 Ga0097620_100108343
374 Ga0097620_100173365
375 Ga0097620_100236221
376 Ga0097620_100379778
377 Ga0075435_100111314
378 Ga0099795_10013072
379 Ga0111539_10000598
380 Ga0111539_10014267
381 Ga0111539_10449800
382 Ga0105245_10021406
383 Ga0114129_10011614
384 Ga0114129_10016189
385 Ga0114129_10138092
386 Ga0114129_11398099
387 Ga0105243_10026789
388 Ga0105243_10163462
389 Ga0105243_10191797
390 Ga0105243_10748788
391 Ga0105242_10036133
392 Ga0105242_10177771
393 Ga0105242_10641341
394 Ga0105242_10842250
395 Ga0105248_10007038
396 Ga0105248_10012449
397 Ga0105248_10037524
398 Ga0105248_10354994
399 Ga0105248_10479696
400 Ga0105237_10117584
401 Ga0105237_10185646
402 Ga0105237_11191514
403 Ga0105249_10037001
404 Ga0105249_10200542
405 Ga0105239_10152863
406 Ga0105239_10225893
407 Ga0105246_10056755
408 Ga0157374_10572398
409 Ga0157378_10000878
410 Ga0157378_10059080
411 Ga0157378_10189698
412 Ga0163162_10000838
413 Ga0163162_10035211
414 Ga0157372_10049094
415 Ga0157372_10671166
416 Ga0157375_10019783
417 Ga0157375_10131985
418 Ga0157375_11162911
419 Ga0163163_10000144
420 Ga0163163_10004068
421 Ga0163163_10058369
422 Ga0163163_10254892
423 Ga0157380_10508939
424 Ga0157380_10669197
425 Ga0157379_10149629
426 Ga0157376_10024546
427 Ga0163161_10012424
428 Ga0163161_10398498
429 Ga0213876_10000118
430 Ga0213876_10000367
431 Ga0213876_10016015
432 Ga0207697_10117060
433 Ga0207682_10011747
434 Ga0207688_10098156
435 Ga0207680_10075461
436 Ga0207647_10017875
437 Ga0207647_10103115
438 Ga0207684_10042668
439 Ga0207654_10313406
440 Ga0207707_10000014
441 Ga0207660_10002404
442 Ga0207662_10013909
443 Ga0207662_10075422
444 Ga0207662_10438354
445 Ga0207652_10000031
446 Ga0207646_10030348
447 Ga0207646_10602061
448 Ga0207681_10437140
449 Ga0207694_10103454
450 Ga0207650_10282057
451 Ga0207644_10126490
452 Ga0207644_10246044
453 Ga0207686_10619914
454 Ga0207669_10570295
455 Ga0207704_10430175
456 Ga0207691_10005670
457 Ga0207711_10069638
458 Ga0207711_10340105
459 Ga0207711_10686367
460 Ga0207689_10014720
461 Ga0207689_10024503
462 Ga0207689_10533607
463 Ga0207651_10171464
464 Ga0207651_10382237
465 Ga0207712_10087026
466 Ga0207712_10157497
467 Ga0207640_10188916
468 Ga0207677_10068686
469 Ga0207677_10317096
470 Ga0207703_10012423
471 Ga0207703_10090992
472 Ga0207708_10052655
473 Ga0207708_10494120
474 Ga0207702_10017043
475 Ga0207702_10560671
476 Ga0207641_10209481
477 Ga0207641_10599510
478 Ga0207648_10031995
479 Ga0207648_10120261
480 Ga0207676_10006622
481 Ga0207675_100006726
482 Ga0207675_100346150
483 Ga0207675_100777479
484 Ga0207698_10175384
485 Ga0207698_10190354
486 Ga0207428_10000396
487 Ga0207428_10031813
488 Ga0207428_10037594
489 Ga0268265_10605779
490 Ga0268265_10776032
491 Ga0268265_10872251
492 Ga0268264_10003557
493 Ga0268264_10092190
494 Ga0307416_100500869
495 Ga0307416_100853420
496 Ga0307415_100330680
497 Ga0373937_0266130
498 Ga0395900_0101005
499 Ga0395905_0239201
500 Ga0242420_000825
501 Ga0436365_0058572
502 Ga0436365_1046599
503 Ga0436365_1468983
504 Ga0439439_0087082
505 Ga0453683_0203547
506 Ga0466966_0127783
507 Ga0495632_0001279
508 Ga0495598_0046259
509 Ga0495621_0007733
510 Ga0495672_0083086
511 Ga0496102_0040918
512 Ga0496104_0099392
513 Ga0496106_0032790
514 Ga0496106_0129153
515 Ga0496108_0239236
516 Ga0496112_0345829
517 Ga0501259_072117
518 Ga0501081_0635224
519 nmdc:mga05p37_237469_c1
520 nmdc:mga05p37_477_c1
521 nmdc:mga09592_564365_c1
522 nmdc:mga09592_73_c1
523 nmdc:mga09592_845715_c1
524 nmdc:mga0qj67_845_c1
525 nmdc:mga06r32_454_c2
526 nmdc:mga08y16_3858_c1
527 nmdc:mga08y16_4537_c1
528 nmdc:mga08y16_755517_c1
529 nmdc:mga08y16_81328_c1
530 nmdc:mga0n895_572185_c1
531 nmdc:mga0n895_659112_c1
532 nmdc:mga0a205_105061_c1
533 nmdc:mga0a205_85903_c1
534 nmdc:mga0a205_981296_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

72

185

0.98

PF03475

YiiM_3-alpha

YiiM-like, 3-alpha helix domain

194

236

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.9252 15 224
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.9115 15 224
5yhi-assembly1.cif.gz_B crystal structure of yiim from escherichia coli 0.8937 14 226
1o67-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8797 8 226
1o65-assembly2.cif.gz_B crystal structure of an hypothetical protein 0.874 8 226
ID Description Score Start End Superfamily
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.918 15 227 2.40.33.20
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9019 15 227 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8946 13 223 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8923 14 226 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8241 13 223 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A2V9TYI1-F1-model_v4 MOSC domain-containing protein 0.9914 76 180 GO:0003824
GO:0030151
GO:0030170
AF-A0A2V7YDR0-F1-model_v4 MOSC domain-containing protein 0.9763 16 194 GO:0003824
GO:0030151
GO:0030170
AF-A0A535PAS5-F1-model_v4 MOSC domain-containing protein 0.974 65 228 GO:0003824
GO:0030151
GO:0030170
AF-A0A2V9TYI1-F1-model_v4 MOSC domain-containing protein 0.973 76 180 GO:0003824
GO:0030151
GO:0030170
AF-A0A6J4PVW3-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9728 16 193 GO:0003824
GO:0030151
GO:0030170

Map