F374786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 176 | 265 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10252511|Ga0163161_102525112 |
| Length | 331 |
| Sequence | MRLVDNGQLIIENVMNVKESWIAIIHQMQDSICTALEECDGKAKFVEDKWERPEGGGGKTRVIANGNVIEKGGVNTSIVFGEVTDIMKSQLKGSPLGDRGSNWFACGLSLVIHPGNPFVPTVHCNYRMFELYDEAGEVIDRWFGGGTDLTPYYLFEEDAKHFHQTYKDTCDHFDILFYPFVNWHRNEERRGIGGIFYDYQRPGETQDVNFWINFGKACGNAFMEAYIPIIEKRKDTIYTPENKYWQEIRRGRYVEFNLVHDRGTLFGLKTNGRIESILMSLPPTVLFEYNYVPAYGTEEYKMQEACLHPRDWLEEITDEERNEWARRSNTC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 109 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 112 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 113 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 118 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 130 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 131 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 132 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 133 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 134 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 148 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 153 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 154 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 157 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 158 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 159 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 160 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 161 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 163 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 171 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 172 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 173 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 174 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 175 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 176 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0 |
| Isolates | 0.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.49 |
| Nodule | 0 |
| Rhizoplane | 0.37 |
| Rhizosphere | 91.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1006044 | 3300002155 | Bacteria | 1350 |
| 2 | JGI25406J46586_10042741 | 3300003203 | Bacteria | 1583 |
| 3 | Ga0065714_10105646 | 3300005288 | Bacteria | 1563 |
| 4 | Ga0065704_10120379 | 3300005289 | Bacteria | 1783 |
| 5 | Ga0065712_10019083 | 3300005290 | Bacteria | 1992 |
| 6 | Ga0065712_10073227 | 3300005290 | Bacteria | 4460 |
| 7 | Ga0070658_10066365 | 3300005327 | Bacteria | 2948 |
| 8 | Ga0070658_10200582 | 3300005327 | Bacteria | 1683 |
| 9 | Ga0070658_10307098 | 3300005327 | Bacteria | 1353 |
| 10 | Ga0070683_100009457 | 3300005329 | Bacteria | 8335 |
| 11 | Ga0070683_100012654 | 3300005329 | Bacteria | 7336 |
| 12 | Ga0070690_100103150 | 3300005330 | Bacteria | 1894 |
| 13 | Ga0070670_100029014 | 3300005331 | Bacteria | 4762 |
| 14 | Ga0070670_100382179 | 3300005331 | Bacteria | 1241 |
| 15 | Ga0070680_100070765 | 3300005336 | Bacteria | 2865 |
| 16 | Ga0068868_100240798 | 3300005338 | Bacteria | 1520 |
| 17 | Ga0068868_100286782 | 3300005338 | Bacteria | 1395 |
| 18 | Ga0068868_100359674 | 3300005338 | Bacteria | 1248 |
| 19 | Ga0070689_100210638 | 3300005340 | Bacteria | 1590 |
| 20 | Ga0070691_10016671 | 3300005341 | Bacteria | 3377 |
| 21 | Ga0070687_100005370 | 3300005343 | Bacteria | 5180 |
| 22 | Ga0070687_100097817 | 3300005343 | Unclassified | 1637 |
| 23 | Ga0070669_100032809 | 3300005353 | Bacteria | 3752 |
| 24 | Ga0070675_100002984 | 3300005354 | Bacteria | 12783 |
| 25 | Ga0070675_100027792 | 3300005354 | Bacteria | 4548 |
| 26 | Ga0070675_100222102 | 3300005354 | Bacteria | 1646 |
| 27 | Ga0070671_100021862 | 3300005355 | Bacteria | 5224 |
| 28 | Ga0070671_100047740 | 3300005355 | Bacteria | 3559 |
| 29 | Ga0070674_100121571 | 3300005356 | Bacteria | 1934 |
| 30 | Ga0070673_100085466 | 3300005364 | Bacteria | 2568 |
| 31 | Ga0070688_100159985 | 3300005365 | Bacteria | 1546 |
| 32 | Ga0070659_100013648 | 3300005366 | Bacteria | 6052 |
| 33 | Ga0070659_100014635 | 3300005366 | Bacteria | 5866 |
| 34 | Ga0070659_100081523 | 3300005366 | Bacteria | 2584 |
| 35 | Ga0070667_100010542 | 3300005367 | Bacteria | 7627 |
| 36 | Ga0070667_100180067 | 3300005367 | Bacteria | 1869 |
| 37 | Ga0070667_100362033 | 3300005367 | Bacteria | 1315 |
| 38 | Ga0070667_100431070 | 3300005367 | Bacteria | 1203 |
| 39 | Ga0070701_10017310 | 3300005438 | Bacteria | 3367 |
| 40 | Ga0070681_10097023 | 3300005458 | Bacteria | 2895 |
| 41 | Ga0070681_10129367 | 3300005458 | Bacteria | 2457 |
| 42 | Ga0068867_100025914 | 3300005459 | Bacteria | 4206 |
| 43 | Ga0068867_100206899 | 3300005459 | Bacteria | 1574 |
| 44 | Ga0070679_100000762 | 3300005530 | Bacteria | 27934 |
| 45 | Ga0070679_100050640 | 3300005530 | Bacteria | 4137 |
| 46 | Ga0070679_100156030 | 3300005530 | Bacteria | 2257 |
| 47 | Ga0070679_100326711 | 3300005530 | Bacteria | 1483 |
| 48 | Ga0070684_100010359 | 3300005535 | Bacteria | 7382 |
| 49 | Ga0068853_100231430 | 3300005539 | Bacteria | 1691 |
| 50 | Ga0070686_100017607 | 3300005544 | Bacteria | 4178 |
| 51 | Ga0070693_100050921 | 3300005547 | Bacteria | 2369 |
| 52 | Ga0068855_100004043 | 3300005563 | Bacteria | 17897 |
| 53 | Ga0068855_100046182 | 3300005563 | Bacteria | 5149 |
| 54 | Ga0070664_100019758 | 3300005564 | Bacteria | 5543 |
| 55 | Ga0068857_100063568 | 3300005577 | Bacteria | 3281 |
| 56 | Ga0070702_100012202 | 3300005615 | Bacteria | 4299 |
| 57 | Ga0068852_100155268 | 3300005616 | Bacteria | 2131 |
| 58 | Ga0068852_100217636 | 3300005616 | Bacteria | 1815 |
| 59 | Ga0068852_100268936 | 3300005616 | Unclassified | 1639 |
| 60 | Ga0068859_100149155 | 3300005617 | Bacteria | 2414 |
| 61 | Ga0068864_100123718 | 3300005618 | Bacteria | 2315 |
| 62 | Ga0068866_10081704 | 3300005718 | Bacteria | 1737 |
| 63 | Ga0068861_100015637 | 3300005719 | Bacteria | 5352 |
| 64 | Ga0068851_10044230 | 3300005834 | Bacteria | 2247 |
| 65 | Ga0068851_10066086 | 3300005834 | Bacteria | 1863 |
| 66 | Ga0068870_10043928 | 3300005840 | Bacteria | 2332 |
| 67 | Ga0068870_10137904 | 3300005840 | Bacteria | 1424 |
| 68 | Ga0068858_100048390 | 3300005842 | Bacteria | 3940 |
| 69 | Ga0068858_100064887 | 3300005842 | Bacteria | 3379 |
| 70 | Ga0068860_100113282 | 3300005843 | Bacteria | 2593 |
| 71 | Ga0068860_100161726 | 3300005843 | Bacteria | 2159 |
| 72 | Ga0081539_10000382 | 3300005985 | Bacteria | 96235 |
| 73 | Ga0075366_10025711 | 3300006195 | Bacteria | 3442 |
| 74 | Ga0097621_100389513 | 3300006237 | Bacteria | 1246 |
| 75 | Ga0075370_10205204 | 3300006353 | Bacteria | 1163 |
| 76 | Ga0068871_100195017 | 3300006358 | Bacteria | 1746 |
| 77 | Ga0097620_100149158 | 3300006931 | Bacteria | 2414 |
| 78 | Ga0105240_10160766 | 3300009093 | Bacteria | 2668 |
| 79 | Ga0111539_10035579 | 3300009094 | Bacteria | 6028 |
| 80 | Ga0105247_10080059 | 3300009101 | Bacteria | 2057 |
| 81 | Ga0114129_10049647 | 3300009147 | Bacteria | 5895 |
| 82 | Ga0114129_10166838 | 3300009147 | Bacteria | 3004 |
| 83 | Ga0105241_10007669 | 3300009174 | Bacteria | 7933 |
| 84 | Ga0105242_10033077 | 3300009176 | Bacteria | 4138 |
| 85 | Ga0105242_10409902 | 3300009176 | Bacteria | 1267 |
| 86 | Ga0105242_10507859 | 3300009176 | Bacteria | 1148 |
| 87 | Ga0105248_10504054 | 3300009177 | Bacteria | 1365 |
| 88 | Ga0105249_10029206 | 3300009553 | Bacteria | 4979 |
| 89 | Ga0105249_10036040 | 3300009553 | Bacteria | 4488 |
| 90 | Ga0157373_10012931 | 3300013100 | Bacteria | 6127 |
| 91 | Ga0157373_10019248 | 3300013100 | Bacteria | 4971 |
| 92 | Ga0157373_10156355 | 3300013100 | Bacteria | 1604 |
| 93 | Ga0157371_10004208 | 3300013102 | Bacteria | 12666 |
| 94 | Ga0157371_10004402 | 3300013102 | Bacteria | 12311 |
| 95 | Ga0157371_10005080 | 3300013102 | Bacteria | 11236 |
| 96 | Ga0157371_10007002 | 3300013102 | Bacteria | 9174 |
| 97 | Ga0157371_10035545 | 3300013102 | Bacteria | 3569 |
| 98 | Ga0157371_10037639 | 3300013102 | Bacteria | 3462 |
| 99 | Ga0157371_10176214 | 3300013102 | Bacteria | 1529 |
| 100 | Ga0157371_10204961 | 3300013102 | Bacteria | 1414 |
| 101 | Ga0157371_10219819 | 3300013102 | Bacteria | 1364 |
| 102 | Ga0157370_10000526 | 3300013104 | Bacteria | 47828 |
| 103 | Ga0157370_10000722 | 3300013104 | Bacteria | 41392 |
| 104 | Ga0157370_10031349 | 3300013104 | Bacteria | 5202 |
| 105 | Ga0157370_10040296 | 3300013104 | Bacteria | 4510 |
| 106 | Ga0157369_10008996 | 3300013105 | Bacteria | 11440 |
| 107 | Ga0157369_10083750 | 3300013105 | Bacteria | 3410 |
| 108 | Ga0157369_10549564 | 3300013105 | Bacteria | 1194 |
| 109 | Ga0157374_10162082 | 3300013296 | Bacteria | 2178 |
| 110 | Ga0157374_10258036 | 3300013296 | Bacteria | 1716 |
| 111 | Ga0157378_10032706 | 3300013297 | Bacteria | 4596 |
| 112 | Ga0157378_10037163 | 3300013297 | Bacteria | 4312 |
| 113 | Ga0157378_10090640 | 3300013297 | Bacteria | 2778 |
| 114 | Ga0157372_10015393 | 3300013307 | Bacteria | 8197 |
| 115 | Ga0157372_10039735 | 3300013307 | Bacteria | 5194 |
| 116 | Ga0157372_10046302 | 3300013307 | Bacteria | 4828 |
| 117 | Ga0157372_10261735 | 3300013307 | Bacteria | 2009 |
| 118 | Ga0157372_10299161 | 3300013307 | Bacteria | 1872 |
| 119 | Ga0163163_10107382 | 3300014325 | Bacteria | 2818 |
| 120 | Ga0157380_10001666 | 3300014326 | Bacteria | 14658 |
| 121 | Ga0157380_10004001 | 3300014326 | Bacteria | 10175 |
| 122 | Ga0157380_10021198 | 3300014326 | Bacteria | 4871 |
| 123 | Ga0157377_10178645 | 3300014745 | Bacteria | 1333 |
| 124 | Ga0157379_10141581 | 3300014968 | Bacteria | 2168 |
| 125 | Ga0157376_10018126 | 3300014969 | Bacteria | 5388 |
| 126 | Ga0163161_10008158 | 3300017792 | Bacteria | 7243 |
| 127 | Ga0163161_10156233 | 3300017792 | Bacteria | 1737 |
| 128 | Ga0163161_10252511 | 3300017792 | Bacteria | 1375 |
| 129 | Ga0207642_10018740 | 3300025899 | Bacteria | 2664 |
| 130 | Ga0207688_10014014 | 3300025901 | Bacteria | 4359 |
| 131 | Ga0207647_10000061 | 3300025904 | Bacteria | 83985 |
| 132 | Ga0207645_10010633 | 3300025907 | Bacteria | 6314 |
| 133 | Ga0207705_10013466 | 3300025909 | Bacteria | 5901 |
| 134 | Ga0207707_10000160 | 3300025912 | Bacteria | 70695 |
| 135 | Ga0207695_10036269 | 3300025913 | Bacteria | 5332 |
| 136 | Ga0207695_10249937 | 3300025913 | Bacteria | 1673 |
| 137 | Ga0207660_10007609 | 3300025917 | Bacteria | 7011 |
| 138 | Ga0207662_10004158 | 3300025918 | Bacteria | 7576 |
| 139 | Ga0207657_10006852 | 3300025919 | Bacteria | 11753 |
| 140 | Ga0207652_10000108 | 3300025921 | Bacteria | 90141 |
| 141 | Ga0207652_10003607 | 3300025921 | Bacteria | 12749 |
| 142 | Ga0207652_10028288 | 3300025921 | Bacteria | 4676 |
| 143 | Ga0207652_10031366 | 3300025921 | Bacteria | 4464 |
| 144 | Ga0207652_10035389 | 3300025921 | Bacteria | 4214 |
| 145 | Ga0207650_10010103 | 3300025925 | Bacteria | 6467 |
| 146 | Ga0207650_10267246 | 3300025925 | Bacteria | 1389 |
| 147 | Ga0207659_10004794 | 3300025926 | Bacteria | 8202 |
| 148 | Ga0207659_10011234 | 3300025926 | Bacteria | 5652 |
| 149 | Ga0207644_10096089 | 3300025931 | Bacteria | 2217 |
| 150 | Ga0207690_10063300 | 3300025932 | Bacteria | 2522 |
| 151 | Ga0207686_10005907 | 3300025934 | Bacteria | 6574 |
| 152 | Ga0207670_10100261 | 3300025936 | Bacteria | 2067 |
| 153 | Ga0207669_10044693 | 3300025937 | Bacteria | 2605 |
| 154 | Ga0207691_10224129 | 3300025940 | Bacteria | 1629 |
| 155 | Ga0207689_10088927 | 3300025942 | Bacteria | 2537 |
| 156 | Ga0207689_10126258 | 3300025942 | Bacteria | 2104 |
| 157 | Ga0207667_10014841 | 3300025949 | Bacteria | 8860 |
| 158 | Ga0207667_10034371 | 3300025949 | Bacteria | 5444 |
| 159 | Ga0207712_10001552 | 3300025961 | Bacteria | 15491 |
| 160 | Ga0207677_10070649 | 3300026023 | Bacteria | 2461 |
| 161 | Ga0207677_10076990 | 3300026023 | Bacteria | 2377 |
| 162 | Ga0207703_10019588 | 3300026035 | Bacteria | 5287 |
| 163 | Ga0207639_10058064 | 3300026041 | Bacteria | 2974 |
| 164 | Ga0207641_10001032 | 3300026088 | Bacteria | 28240 |
| 165 | Ga0207648_10016277 | 3300026089 | Bacteria | 6802 |
| 166 | Ga0207648_10055128 | 3300026089 | Bacteria | 3471 |
| 167 | Ga0207648_10065397 | 3300026089 | Bacteria | 3171 |
| 168 | Ga0207648_10263867 | 3300026089 | Unclassified | 1537 |
| 169 | Ga0207676_10166395 | 3300026095 | Bacteria | 1916 |
| 170 | Ga0207674_10122384 | 3300026116 | Bacteria | 2568 |
| 171 | Ga0207674_10159812 | 3300026116 | Bacteria | 2208 |
| 172 | Ga0207675_100015062 | 3300026118 | Bacteria | 7216 |
| 173 | Ga0207683_10332462 | 3300026121 | Bacteria | 1393 |
| 174 | Ga0207698_10258008 | 3300026142 | Bacteria | 1600 |
| 175 | Ga0209974_10039779 | 3300027876 | Bacteria | 1564 |
| 176 | Ga0207428_10180931 | 3300027907 | Bacteria | 1593 |
| 177 | Ga0268264_10090825 | 3300028381 | Bacteria | 2633 |
| 178 | Ga0307515_10000010 | 3300028794 | Bacteria | 651586 |
| 179 | Ga0307512_10098246 | 3300030522 | Bacteria | 1999 |
| 180 | Ga0265327_10000022 | 3300031251 | Bacteria | 402724 |
| 181 | Ga0265327_10033009 | 3300031251 | Bacteria | 2891 |
| 182 | Ga0307513_10121448 | 3300031456 | Bacteria | 2579 |
| 183 | Ga0307509_10039848 | 3300031507 | Bacteria | 5114 |
| 184 | Ga0307509_10106523 | 3300031507 | Bacteria | 2822 |
| 185 | Ga0307508_10000181 | 3300031616 | Bacteria | 76433 |
| 186 | Ga0307410_10239576 | 3300031852 | Unclassified | 1405 |
| 187 | Ga0307406_10295386 | 3300031901 | Unclassified | 1242 |
| 188 | Ga0307416_100460423 | 3300032002 | Unclassified | 1327 |
| 189 | Ga0307414_10249802 | 3300032004 | Bacteria | 1474 |
| 190 | Ga0307411_10052252 | 3300032005 | Bacteria | 2671 |
| 191 | Ga0307510_10010449 | 3300033180 | Bacteria | 11027 |
| 192 | Ga0373943_0085609 | 3300035170 | Bacteria | 1624 |
| 193 | Ga0373955_0125642 | 3300035172 | Bacteria | 1494 |
| 194 | Ga0373955_0131018 | 3300035172 | Bacteria | 1464 |
| 195 | Ga0373933_0023059 | 3300035724 | Bacteria | 3552 |
| 196 | Ga0373937_0025725 | 3300036401 | Bacteria | 5315 |
| 197 | Ga0373937_0270062 | 3300036401 | Bacteria | 1605 |
| 198 | Ga0395899_0004787 | 3300037312 | Bacteria | 10548 |
| 199 | Ga0395899_0006089 | 3300037312 | Bacteria | 9353 |
| 200 | Ga0395899_0025043 | 3300037312 | Bacteria | 4505 |
| 201 | Ga0395899_0211195 | 3300037312 | Bacteria | 1348 |
| 202 | Ga0395900_0000573 | 3300037418 | Bacteria | 50934 |
| 203 | Ga0395900_0015000 | 3300037418 | Bacteria | 7897 |
| 204 | Ga0395900_0116983 | 3300037418 | Bacteria | 2735 |
| 205 | Ga0395898_0009807 | 3300037466 | Bacteria | 10035 |
| 206 | Ga0395898_0010823 | 3300037466 | Bacteria | 9529 |
| 207 | Ga0395898_0042553 | 3300037466 | Bacteria | 4480 |
| 208 | Ga0395905_0000744 | 3300037471 | Bacteria | 42929 |
| 209 | Ga0395905_0499844 | 3300037471 | Bacteria | 1116 |
| 210 | Ga0395901_0001343 | 3300038443 | Bacteria | 25786 |
| 211 | Ga0395901_0002235 | 3300038443 | Bacteria | 19752 |
| 212 | Ga0395901_0004128 | 3300038443 | Bacteria | 14639 |
| 213 | Ga0439439_0008743 | 3300041406 | Bacteria | 2397 |
| 214 | Ga0451841_0697222 | 3300041498 | Bacteria | 1052 |
| 215 | Ga0439457_000159 | 3300042014 | Bacteria | 17442 |
| 216 | Ga0439462_0000485 | 3300042015 | Bacteria | 7838 |
| 217 | Ga0451577_0031421 | 3300042876 | Bacteria | 4790 |
| 218 | Ga0451577_0071539 | 3300042876 | Bacteria | 3093 |
| 219 | Ga0466972_0000974 | 3300044658 | Bacteria | 13787 |
| 220 | Ga0453684_0084061 | 3300044712 | Bacteria | 3960 |
| 221 | Ga0453684_0147415 | 3300044712 | Bacteria | 2801 |
| 222 | Ga0466957_0002233 | 3300044842 | Bacteria | 10386 |
| 223 | Ga0495592_0067116 | 3300046454 | Bacteria | 2623 |
| 224 | Ga0495651_0188370 | 3300046462 | Bacteria | 1454 |
| 225 | Ga0495653_0143205 | 3300046463 | Bacteria | 1679 |
| 226 | Ga0495618_0167095 | 3300046514 | Bacteria | 1401 |
| 227 | Ga0495628_0059068 | 3300046516 | Bacteria | 3012 |
| 228 | Ga0495587_0120973 | 3300046536 | Bacteria | 1500 |
| 229 | Ga0495634_0076273 | 3300046642 | Bacteria | 2201 |
| 230 | Ga0495599_0099004 | 3300046678 | Bacteria | 1817 |
| 231 | Ga0495676_0088198 | 3300047321 | Bacteria | 2328 |
| 232 | Ga0496115_0207865 | 3300048918 | Bacteria | 1617 |
| 233 | Ga0501298_002003 | 3300049521 | Bacteria | 3048 |
| 234 | Ga0501033_0024864 | 3300049570 | Bacteria | 4516 |
| 235 | Ga0501047_0010954 | 3300049581 | Bacteria | 8579 |
| 236 | Ga0501047_0011378 | 3300049581 | Bacteria | 8422 |
| 237 | Ga0501075_0020580 | 3300049591 | Bacteria | 4802 |
| 238 | Ga0501077_0149043 | 3300049593 | Bacteria | 1484 |
| 239 | Ga0501201_000412 | 3300049651 | Bacteria | 3928 |
| 240 | Ga0501217_003675 | 3300049661 | Bacteria | 3114 |
| 241 | Ga0501223_003634 | 3300049663 | Bacteria | 3332 |
| 242 | Ga0501235_003514 | 3300049669 | Bacteria | 3392 |
| 243 | Ga0501243_004889 | 3300049675 | Bacteria | 2011 |
| 244 | Ga0501259_001848 | 3300049688 | Bacteria | 3510 |
| 245 | Ga0501221_001585 | 3300049704 | Bacteria | 3778 |
| 246 | Ga0501225_0001570 | 3300049705 | Bacteria | 7160 |
| 247 | Ga0501225_0027007 | 3300049705 | Bacteria | 1580 |
| 248 | Ga0501245_000228 | 3300049708 | Bacteria | 6347 |
| 249 | Ga0501081_0031536 | 3300049743 | Bacteria | 3592 |
| 250 | Ga0501232_002747 | 3300049757 | Bacteria | 1551 |
| 251 | Ga0501044_0006949 | 3300049823 | Bacteria | 12454 |
| 252 | Ga0501212_000657 | 3300049851 | Bacteria | 3496 |
| 253 | nmdc:mga0k408_32426_c1 | 3300050493 | Bacteria | 2985 |
| 254 | nmdc:mga07m45_219015_c1 | 3300050496 | Bacteria | 1107 |
| 255 | nmdc:mga05p37_108781_c1 | 3300050507 | Bacteria | 3410 |
| 256 | nmdc:mga08y16_50451_c1 | 3300050511 | Bacteria | 4354 |
| 257 | Ga0495619_0290168 | 3300053085 | Bacteria | 1133 |
| 258 | Ga0500578_0000010 | 3300053086 | Bacteria | 217642 |
| 259 | Ga0500646_0006754 | 3300053090 | Bacteria | 2920 |
| 260 | Ga0500646_0053654 | 3300053090 | Bacteria | 1169 |
| 261 | Ga0500583_0030376 | 3300053092 | Bacteria | 2366 |
| 262 | Ga0500604_0006248 | 3300053151 | Bacteria | 3146 |
| 263 | Ga0500616_0007045 | 3300053153 | Bacteria | 7218 |
| 264 | Ga0500622_0008875 | 3300053156 | Bacteria | 5596 |
| 265 | Ga0500636_0059767 | 3300053177 | Bacteria | 2227 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0207865 | Ga0496115_0207865_13_813 | 183 |
| 2 | 3300005327 | Ga0070658_10307098 | Ga0070658_103070981 | 209 |
| 3 | 3300005366 | Ga0070659_100081523 | Ga0070659_1000815233 | 209 |
| 4 | 3300005458 | Ga0070681_10129367 | Ga0070681_101293671 | 209 |
| 5 | 3300005530 | Ga0070679_100156030 | Ga0070679_1001560301 | 209 |
| 6 | 3300013307 | Ga0157372_10299161 | Ga0157372_102991612 | 209 |
| 7 | 3300025909 | Ga0207705_10013466 | Ga0207705_100134662 | 209 |
| 8 | 3300025949 | Ga0207667_10014841 | Ga0207667_100148415 | 209 |
| 9 | 3300037312 | Ga0395899_0006089 | Ga0395899_0006089_1901_2812 | 209 |
| 10 | 3300037312 | Ga0395899_0025043 | Ga0395899_0025043_1809_2720 | 209 |
| 11 | 3300037418 | Ga0395900_0015000 | Ga0395900_0015000_231_1142 | 209 |
| 12 | 3300037466 | Ga0395898_0009807 | Ga0395898_0009807_8121_9032 | 209 |
| 13 | 3300037466 | Ga0395898_0010823 | Ga0395898_0010823_5611_6522 | 209 |
| 14 | 3300038443 | Ga0395901_0002235 | Ga0395901_0002235_13308_14219 | 209 |
| 15 | 3300038443 | Ga0395901_0004128 | Ga0395901_0004128_9616_10527 | 209 |
| 16 | 3300044712 | Ga0453684_0147415 | Ga0453684_0147415_782_1693 | 209 |
| 17 | 3300005289 | Ga0065704_10120379 | Ga0065704_101203792 | 210 |
| 18 | 3300005327 | Ga0070658_10066365 | Ga0070658_100663652 | 210 |
| 19 | 3300005336 | Ga0070680_100070765 | Ga0070680_1000707654 | 210 |
| 20 | 3300005458 | Ga0070681_10097023 | Ga0070681_100970231 | 210 |
| 21 | 3300005530 | Ga0070679_100000762 | Ga0070679_10000076218 | 210 |
| 22 | 3300013102 | Ga0157371_10035545 | Ga0157371_100355452 | 210 |
| 23 | 3300013105 | Ga0157369_10549564 | Ga0157369_105495641 | 210 |
| 24 | 3300025921 | Ga0207652_10000108 | Ga0207652_1000010821 | 210 |
| 25 | 3300025921 | Ga0207652_10035389 | Ga0207652_100353893 | 210 |
| 26 | 3300042876 | Ga0451577_0071539 | Ga0451577_0071539_1475_2386 | 210 |
| 27 | 3300005354 | Ga0070675_100222102 | Ga0070675_1002221022 | 211 |
| 28 | 3300005366 | Ga0070659_100014635 | Ga0070659_1000146356 | 211 |
| 29 | 3300005539 | Ga0068853_100231430 | Ga0068853_1002314302 | 211 |
| 30 | 3300005563 | Ga0068855_100004043 | Ga0068855_10000404313 | 211 |
| 31 | 3300005563 | Ga0068855_100046182 | Ga0068855_1000461824 | 211 |
| 32 | 3300005577 | Ga0068857_100063568 | Ga0068857_1000635682 | 211 |
| 33 | 3300013102 | Ga0157371_10004402 | Ga0157371_100044027 | 211 |
| 34 | 3300013102 | Ga0157371_10204961 | Ga0157371_102049612 | 211 |
| 35 | 3300013104 | Ga0157370_10000722 | Ga0157370_1000072228 | 211 |
| 36 | 3300013296 | Ga0157374_10258036 | Ga0157374_102580361 | 211 |
| 37 | 3300025921 | Ga0207652_10028288 | Ga0207652_100282882 | 211 |
| 38 | 3300025932 | Ga0207690_10063300 | Ga0207690_100633001 | 211 |
| 39 | 3300025949 | Ga0207667_10034371 | Ga0207667_100343712 | 211 |
| 40 | 3300026041 | Ga0207639_10058064 | Ga0207639_100580643 | 211 |
| 41 | 3300026116 | Ga0207674_10122384 | Ga0207674_101223843 | 211 |
| 42 | 3300005535 | Ga0070684_100010359 | Ga0070684_1000103591 | 212 |
| 43 | 3300005338 | Ga0068868_100286782 | Ga0068868_1002867822 | 213 |
| 44 | 3300005355 | Ga0070671_100047740 | Ga0070671_1000477404 | 213 |
| 45 | 3300005834 | Ga0068851_10066086 | Ga0068851_100660862 | 213 |
| 46 | 3300006237 | Ga0097621_100389513 | Ga0097621_1003895132 | 213 |
| 47 | 3300013102 | Ga0157371_10219819 | Ga0157371_102198192 | 213 |
| 48 | 3300025931 | Ga0207644_10096089 | Ga0207644_100960892 | 213 |
| 49 | 3300026023 | Ga0207677_10070649 | Ga0207677_100706492 | 213 |
| 50 | 3300049570 | Ga0501033_0024864 | Ga0501033_0024864_1644_2555 | 213 |
| 51 | 3300005329 | Ga0070683_100012654 | Ga0070683_1000126541 | 214 |
| 52 | 3300013102 | Ga0157371_10004208 | Ga0157371_100042086 | 214 |
| 53 | 3300013105 | Ga0157369_10083750 | Ga0157369_100837503 | 214 |
| 54 | 3300013307 | Ga0157372_10046302 | Ga0157372_100463025 | 214 |
| 55 | 3300025925 | Ga0207650_10010103 | Ga0207650_100101032 | 214 |
| 56 | 3300005331 | Ga0070670_100382179 | Ga0070670_1003821791 | 215 |
| 57 | 3300013100 | Ga0157373_10019248 | Ga0157373_100192483 | 215 |
| 58 | 3300037312 | Ga0395899_0211195 | Ga0395899_0211195_70_1008 | 215 |
| 59 | 3300037418 | Ga0395900_0116983 | Ga0395900_0116983_812_1750 | 215 |
| 60 | 3300013102 | Ga0157371_10005080 | Ga0157371_100050807 | 216 |
| 61 | 3300013307 | Ga0157372_10261735 | Ga0157372_102617352 | 216 |
| 62 | 3300009093 | Ga0105240_10160766 | Ga0105240_101607662 | 218 |
| 63 | 3300013104 | Ga0157370_10000526 | Ga0157370_100005267 | 218 |
| 64 | 3300025913 | Ga0207695_10249937 | Ga0207695_102499371 | 218 |
| 65 | 3300033180 | Ga0307510_10010449 | Ga0307510_100104498 | 218 |
| 66 | 3300013104 | Ga0157370_10031349 | Ga0157370_100313495 | 219 |
| 67 | 3300005290 | Ga0065712_10019083 | Ga0065712_100190832 | 223 |
| 68 | 3300005367 | Ga0070667_100010542 | Ga0070667_1000105423 | 223 |
| 69 | 3300005616 | Ga0068852_100217636 | Ga0068852_1002176362 | 223 |
| 70 | 3300005617 | Ga0068859_100149155 | Ga0068859_1001491552 | 223 |
| 71 | 3300005618 | Ga0068864_100123718 | Ga0068864_1001237182 | 223 |
| 72 | 3300005719 | Ga0068861_100015637 | Ga0068861_1000156372 | 223 |
| 73 | 3300005834 | Ga0068851_10044230 | Ga0068851_100442302 | 223 |
| 74 | 3300005842 | Ga0068858_100064887 | Ga0068858_1000648873 | 223 |
| 75 | 3300006931 | Ga0097620_100149158 | Ga0097620_1001491582 | 223 |
| 76 | 3300009176 | Ga0105242_10033077 | Ga0105242_100330774 | 223 |
| 77 | 3300009553 | Ga0105249_10036040 | Ga0105249_100360405 | 223 |
| 78 | 3300013102 | Ga0157371_10037639 | Ga0157371_100376392 | 223 |
| 79 | 3300014968 | Ga0157379_10141581 | Ga0157379_101415811 | 223 |
| 80 | 3300025934 | Ga0207686_10005907 | Ga0207686_100059074 | 223 |
| 81 | 3300025936 | Ga0207670_10100261 | Ga0207670_101002612 | 223 |
| 82 | 3300025961 | Ga0207712_10001552 | Ga0207712_100015529 | 223 |
| 83 | 3300026035 | Ga0207703_10019588 | Ga0207703_100195885 | 223 |
| 84 | 3300026095 | Ga0207676_10166395 | Ga0207676_101663952 | 223 |
| 85 | 3300026118 | Ga0207675_100015062 | Ga0207675_1000150625 | 223 |
| 86 | 3300005356 | Ga0070674_100121571 | Ga0070674_1001215712 | 226 |
| 87 | 3300009094 | Ga0111539_10035579 | Ga0111539_100355794 | 227 |
| 88 | 3300027907 | Ga0207428_10180931 | Ga0207428_101809312 | 227 |
| 89 | 3300050511 | nmdc:mga08y16_50451_c1 | nmdc:mga08y16_50451_c1_1419_2369 | 227 |
| 90 | 3300013297 | Ga0157378_10032706 | Ga0157378_100327065 | 228 |
| 91 | 3300031507 | Ga0307509_10039848 | Ga0307509_100398483 | 229 |
| 92 | 3300049591 | Ga0501075_0020580 | Ga0501075_0020580_1590_2567 | 232 |
| 93 | 3300049593 | Ga0501077_0149043 | Ga0501077_0149043_206_1207 | 232 |
| 94 | 3300049743 | Ga0501081_0031536 | Ga0501081_0031536_1968_2945 | 232 |
| 95 | iso_pu_bacteria | 2738541278 | 2738724712 | 232 |
| 96 | 3300003203 | JGI25406J46586_10042741 | JGI25406J46586_100427411 | 233 |
| 97 | 3300005564 | Ga0070664_100019758 | Ga0070664_1000197582 | 233 |
| 98 | 3300005985 | Ga0081539_10000382 | Ga0081539_1000038213 | 233 |
| 99 | 3300014745 | Ga0157377_10178645 | Ga0157377_101786451 | 233 |
| 100 | 3300030522 | Ga0307512_10098246 | Ga0307512_100982462 | 233 |
| 101 | 3300031456 | Ga0307513_10121448 | Ga0307513_101214483 | 233 |
| 102 | 3300037471 | Ga0395905_0000744 | Ga0395905_0000744_38256_39167 | 233 |
| 103 | 3300053090 | Ga0500646_0006754 | Ga0500646_0006754_1795_2712 | 233 |
| 104 | 3300005338 | Ga0068868_100240798 | Ga0068868_1002407981 | 234 |
| 105 | 3300005843 | Ga0068860_100161726 | Ga0068860_1001617262 | 234 |
| 106 | 3300013105 | Ga0157369_10008996 | Ga0157369_1000899611 | 234 |
| 107 | 3300028381 | Ga0268264_10090825 | Ga0268264_100908252 | 234 |
| 108 | 3300049521 | Ga0501298_002003 | Ga0501298_002003_894_1808 | 234 |
| 109 | 3300049651 | Ga0501201_000412 | Ga0501201_000412_1825_2739 | 234 |
| 110 | 3300049661 | Ga0501217_003675 | Ga0501217_003675_1276_2190 | 234 |
| 111 | 3300049663 | Ga0501223_003634 | Ga0501223_003634_1413_2327 | 234 |
| 112 | 3300049669 | Ga0501235_003514 | Ga0501235_003514_1261_2175 | 234 |
| 113 | 3300049675 | Ga0501243_004889 | Ga0501243_004889_224_1138 | 234 |
| 114 | 3300049688 | Ga0501259_001848 | Ga0501259_001848_2388_3302 | 234 |
| 115 | 3300049704 | Ga0501221_001585 | Ga0501221_001585_2761_3675 | 234 |
| 116 | 3300049708 | Ga0501245_000228 | Ga0501245_000228_848_1762 | 234 |
| 117 | 3300049757 | Ga0501232_002747 | Ga0501232_002747_298_1212 | 234 |
| 118 | 3300049851 | Ga0501212_000657 | Ga0501212_000657_405_1319 | 234 |
| 119 | 3300005288 | Ga0065714_10105646 | Ga0065714_101056462 | 235 |
| 120 | 3300005459 | Ga0068867_100025914 | Ga0068867_1000259145 | 235 |
| 121 | 3300005718 | Ga0068866_10081704 | Ga0068866_100817043 | 235 |
| 122 | 3300009176 | Ga0105242_10409902 | Ga0105242_104099022 | 235 |
| 123 | 3300025899 | Ga0207642_10018740 | Ga0207642_100187402 | 235 |
| 124 | 3300026089 | Ga0207648_10065397 | Ga0207648_100653973 | 235 |
| 125 | 3300037312 | Ga0395899_0004787 | Ga0395899_0004787_4088_5023 | 235 |
| 126 | 3300037418 | Ga0395900_0000573 | Ga0395900_0000573_8479_9414 | 235 |
| 127 | 3300037466 | Ga0395898_0042553 | Ga0395898_0042553_2825_3760 | 235 |
| 128 | 3300037471 | Ga0395905_0499844 | Ga0395905_0499844_137_1048 | 235 |
| 129 | 3300038443 | Ga0395901_0001343 | Ga0395901_0001343_10885_11820 | 235 |
| 130 | 3300005327 | Ga0070658_10200582 | Ga0070658_102005821 | 236 |
| 131 | 3300005330 | Ga0070690_100103150 | Ga0070690_1001031502 | 236 |
| 132 | 3300005331 | Ga0070670_100029014 | Ga0070670_1000290143 | 236 |
| 133 | 3300005338 | Ga0068868_100359674 | Ga0068868_1003596742 | 236 |
| 134 | 3300005340 | Ga0070689_100210638 | Ga0070689_1002106382 | 236 |
| 135 | 3300005343 | Ga0070687_100005370 | Ga0070687_1000053703 | 236 |
| 136 | 3300005343 | Ga0070687_100097817 | Ga0070687_1000978171 | 236 |
| 137 | 3300005353 | Ga0070669_100032809 | Ga0070669_1000328094 | 236 |
| 138 | 3300005354 | Ga0070675_100002984 | Ga0070675_1000029848 | 236 |
| 139 | 3300005355 | Ga0070671_100021862 | Ga0070671_1000218624 | 236 |
| 140 | 3300005364 | Ga0070673_100085466 | Ga0070673_1000854662 | 236 |
| 141 | 3300005365 | Ga0070688_100159985 | Ga0070688_1001599852 | 236 |
| 142 | 3300005367 | Ga0070667_100362033 | Ga0070667_1003620332 | 236 |
| 143 | 3300005367 | Ga0070667_100431070 | Ga0070667_1004310701 | 236 |
| 144 | 3300005438 | Ga0070701_10017310 | Ga0070701_100173102 | 236 |
| 145 | 3300005544 | Ga0070686_100017607 | Ga0070686_1000176072 | 236 |
| 146 | 3300005615 | Ga0070702_100012202 | Ga0070702_1000122023 | 236 |
| 147 | 3300005616 | Ga0068852_100268936 | Ga0068852_1002689361 | 236 |
| 148 | 3300005840 | Ga0068870_10043928 | Ga0068870_100439282 | 236 |
| 149 | 3300005840 | Ga0068870_10137904 | Ga0068870_101379042 | 236 |
| 150 | 3300005842 | Ga0068858_100048390 | Ga0068858_1000483903 | 236 |
| 151 | 3300006195 | Ga0075366_10025711 | Ga0075366_100257112 | 236 |
| 152 | 3300009101 | Ga0105247_10080059 | Ga0105247_100800592 | 236 |
| 153 | 3300009147 | Ga0114129_10166838 | Ga0114129_101668383 | 236 |
| 154 | 3300009176 | Ga0105242_10507859 | Ga0105242_105078591 | 236 |
| 155 | 3300009177 | Ga0105248_10504054 | Ga0105248_105040542 | 236 |
| 156 | 3300013100 | Ga0157373_10012931 | Ga0157373_100129313 | 236 |
| 157 | 3300013100 | Ga0157373_10156355 | Ga0157373_101563552 | 236 |
| 158 | 3300013102 | Ga0157371_10007002 | Ga0157371_100070023 | 236 |
| 159 | 3300013102 | Ga0157371_10176214 | Ga0157371_101762142 | 236 |
| 160 | 3300013297 | Ga0157378_10037163 | Ga0157378_100371634 | 236 |
| 161 | 3300013307 | Ga0157372_10015393 | Ga0157372_100153939 | 236 |
| 162 | 3300014325 | Ga0163163_10107382 | Ga0163163_101073822 | 236 |
| 163 | 3300014326 | Ga0157380_10001666 | Ga0157380_100016664 | 236 |
| 164 | 3300014326 | Ga0157380_10021198 | Ga0157380_100211982 | 236 |
| 165 | 3300017792 | Ga0163161_10008158 | Ga0163161_100081584 | 236 |
| 166 | 3300017792 | Ga0163161_10156233 | Ga0163161_101562332 | 236 |
| 167 | 3300025901 | Ga0207688_10014014 | Ga0207688_100140144 | 236 |
| 168 | 3300025904 | Ga0207647_10000061 | Ga0207647_1000006187 | 236 |
| 169 | 3300025907 | Ga0207645_10010633 | Ga0207645_100106336 | 236 |
| 170 | 3300025918 | Ga0207662_10004158 | Ga0207662_100041588 | 236 |
| 171 | 3300025921 | Ga0207652_10003607 | Ga0207652_1000360711 | 236 |
| 172 | 3300025925 | Ga0207650_10267246 | Ga0207650_102672461 | 236 |
| 173 | 3300025926 | Ga0207659_10011234 | Ga0207659_100112342 | 236 |
| 174 | 3300025937 | Ga0207669_10044693 | Ga0207669_100446933 | 236 |
| 175 | 3300025940 | Ga0207691_10224129 | Ga0207691_102241291 | 236 |
| 176 | 3300025942 | Ga0207689_10126258 | Ga0207689_101262582 | 236 |
| 177 | 3300026023 | Ga0207677_10076990 | Ga0207677_100769903 | 236 |
| 178 | 3300026088 | Ga0207641_10001032 | Ga0207641_1000103210 | 236 |
| 179 | 3300026089 | Ga0207648_10016277 | Ga0207648_100162772 | 236 |
| 180 | 3300026089 | Ga0207648_10263867 | Ga0207648_102638671 | 236 |
| 181 | 3300026121 | Ga0207683_10332462 | Ga0207683_103324622 | 236 |
| 182 | 3300027876 | Ga0209974_10039779 | Ga0209974_100397792 | 236 |
| 183 | 3300028794 | Ga0307515_10000010 | Ga0307515_10000010315 | 236 |
| 184 | 3300032005 | Ga0307411_10052252 | Ga0307411_100522522 | 236 |
| 185 | 3300035172 | Ga0373955_0131018 | Ga0373955_0131018_163_1128 | 236 |
| 186 | 3300036401 | Ga0373937_0270062 | Ga0373937_0270062_609_1520 | 236 |
| 187 | 3300041498 | Ga0451841_0697222 | Ga0451841_0697222_102_1019 | 236 |
| 188 | 3300042876 | Ga0451577_0031421 | Ga0451577_0031421_3240_4205 | 236 |
| 189 | 3300044658 | Ga0466972_0000974 | Ga0466972_0000974_4779_5696 | 236 |
| 190 | 3300044842 | Ga0466957_0002233 | Ga0466957_0002233_1153_2085 | 236 |
| 191 | 3300046642 | Ga0495634_0076273 | Ga0495634_0076273_497_1408 | 236 |
| 192 | 3300049581 | Ga0501047_0010954 | Ga0501047_0010954_6427_7341 | 236 |
| 193 | 3300049581 | Ga0501047_0011378 | Ga0501047_0011378_7304_8239 | 236 |
| 194 | 3300049705 | Ga0501225_0001570 | Ga0501225_0001570_1242_2207 | 236 |
| 195 | 3300049823 | Ga0501044_0006949 | Ga0501044_0006949_5867_6781 | 236 |
| 196 | 3300050493 | nmdc:mga0k408_32426_c1 | nmdc:mga0k408_32426_c1_357_1268 | 236 |
| 197 | 3300050507 | nmdc:mga05p37_108781_c1 | nmdc:mga05p37_108781_c1_748_1707 | 236 |
| 198 | 3300053090 | Ga0500646_0053654 | Ga0500646_0053654_65_976 | 236 |
| 199 | 3300053092 | Ga0500583_0030376 | Ga0500583_0030376_474_1391 | 236 |
| 200 | 3300053156 | Ga0500622_0008875 | Ga0500622_0008875_861_1778 | 236 |
| 201 | 3300053177 | Ga0500636_0059767 | Ga0500636_0059767_660_1592 | 236 |
| 202 | 3300005616 | Ga0068852_100155268 | Ga0068852_1001552683 | 237 |
| 203 | 3300026142 | Ga0207698_10258008 | Ga0207698_102580082 | 237 |
| 204 | 3300031251 | Ga0265327_10033009 | Ga0265327_100330092 | 237 |
| 205 | 3300013104 | Ga0157370_10040296 | Ga0157370_100402962 | 238 |
| 206 | 3300031901 | Ga0307406_10295386 | Ga0307406_102953861 | 238 |
| 207 | 3300041406 | Ga0439439_0008743 | Ga0439439_0008743_292_1221 | 238 |
| 208 | 3300042014 | Ga0439457_000159 | Ga0439457_000159_6859_7788 | 238 |
| 209 | 3300042015 | Ga0439462_0000485 | Ga0439462_0000485_2119_3048 | 238 |
| 210 | 3300009147 | Ga0114129_10049647 | Ga0114129_100496474 | 239 |
| 211 | 3300005329 | Ga0070683_100009457 | Ga0070683_1000094576 | 240 |
| 212 | 3300005341 | Ga0070691_10016671 | Ga0070691_100166713 | 240 |
| 213 | 3300005530 | Ga0070679_100050640 | Ga0070679_1000506403 | 240 |
| 214 | 3300005547 | Ga0070693_100050921 | Ga0070693_1000509211 | 240 |
| 215 | 3300009174 | Ga0105241_10007669 | Ga0105241_100076692 | 240 |
| 216 | 3300014969 | Ga0157376_10018126 | Ga0157376_100181264 | 240 |
| 217 | 3300025912 | Ga0207707_10000160 | Ga0207707_1000016048 | 240 |
| 218 | 3300025913 | Ga0207695_10036269 | Ga0207695_100362693 | 240 |
| 219 | 3300025917 | Ga0207660_10007609 | Ga0207660_100076094 | 240 |
| 220 | 3300025921 | Ga0207652_10031366 | Ga0207652_100313663 | 240 |
| 221 | 3300032004 | Ga0307414_10249802 | Ga0307414_102498022 | 240 |
| 222 | 3300035170 | Ga0373943_0085609 | Ga0373943_0085609_132_1070 | 240 |
| 223 | 3300035172 | Ga0373955_0125642 | Ga0373955_0125642_505_1443 | 240 |
| 224 | 3300035724 | Ga0373933_0023059 | Ga0373933_0023059_294_1232 | 240 |
| 225 | 3300036401 | Ga0373937_0025725 | Ga0373937_0025725_1590_2528 | 240 |
| 226 | 3300044712 | Ga0453684_0084061 | Ga0453684_0084061_1362_2300 | 240 |
| 227 | 3300046454 | Ga0495592_0067116 | Ga0495592_0067116_393_1331 | 240 |
| 228 | 3300046462 | Ga0495651_0188370 | Ga0495651_0188370_442_1380 | 240 |
| 229 | 3300046463 | Ga0495653_0143205 | Ga0495653_0143205_664_1602 | 240 |
| 230 | 3300046514 | Ga0495618_0167095 | Ga0495618_0167095_64_1002 | 240 |
| 231 | 3300046516 | Ga0495628_0059068 | Ga0495628_0059068_1349_2287 | 240 |
| 232 | 3300046536 | Ga0495587_0120973 | Ga0495587_0120973_380_1318 | 240 |
| 233 | 3300046678 | Ga0495599_0099004 | Ga0495599_0099004_507_1445 | 240 |
| 234 | 3300047321 | Ga0495676_0088198 | Ga0495676_0088198_1102_2040 | 240 |
| 235 | 3300049705 | Ga0501225_0027007 | Ga0501225_0027007_88_1014 | 240 |
| 236 | 3300053085 | Ga0495619_0290168 | Ga0495619_0290168_149_1087 | 240 |
| 237 | 3300026116 | Ga0207674_10159812 | Ga0207674_101598122 | 241 |
| 238 | 3300031852 | Ga0307410_10239576 | Ga0307410_102395761 | 241 |
| 239 | 3300032002 | Ga0307416_100460423 | Ga0307416_1004604231 | 241 |
| 240 | 3300031251 | Ga0265327_10000022 | Ga0265327_10000022145 | 242 |
| 241 | 3300005367 | Ga0070667_100180067 | Ga0070667_1001800672 | 243 |
| 242 | 3300005459 | Ga0068867_100206899 | Ga0068867_1002068991 | 243 |
| 243 | 3300005843 | Ga0068860_100113282 | Ga0068860_1001132822 | 243 |
| 244 | 3300006353 | Ga0075370_10205204 | Ga0075370_102052041 | 243 |
| 245 | 3300006358 | Ga0068871_100195017 | Ga0068871_1001950172 | 243 |
| 246 | 3300009553 | Ga0105249_10029206 | Ga0105249_100292065 | 243 |
| 247 | 3300013297 | Ga0157378_10090640 | Ga0157378_100906402 | 243 |
| 248 | 3300025942 | Ga0207689_10088927 | Ga0207689_100889272 | 243 |
| 249 | 3300026089 | Ga0207648_10055128 | Ga0207648_100551283 | 243 |
| 250 | 3300031507 | Ga0307509_10106523 | Ga0307509_101065232 | 243 |
| 251 | 3300031616 | Ga0307508_10000181 | Ga0307508_1000018151 | 243 |
| 252 | 3300050496 | nmdc:mga07m45_219015_c1 | nmdc:mga07m45_219015_c1_36_986 | 243 |
| 253 | 3300005366 | Ga0070659_100013648 | Ga0070659_1000136486 | 244 |
| 254 | 3300013307 | Ga0157372_10039735 | Ga0157372_100397355 | 244 |
| 255 | 3300025919 | Ga0207657_10006852 | Ga0207657_100068529 | 244 |
| 256 | 3300053151 | Ga0500604_0006248 | Ga0500604_0006248_902_1840 | 244 |
| 257 | iso_pu_bacteria | 2914759650 | 2914762398 | 244 |
| 258 | 3300005530 | Ga0070679_100326711 | Ga0070679_1003267112 | 245 |
| 259 | 3300014326 | Ga0157380_10004001 | Ga0157380_100040017 | 245 |
| 260 | 3300017792 | Ga0163161_10252511 | Ga0163161_102525112 | 246 |
| 261 | 3300053086 | Ga0500578_0000010 | Ga0500578_0000010_104616_105587 | 248 |
| 262 | 3300002155 | JGI24033J26618_1006044 | JGI24033J26618_10060443 | 250 |
| 263 | 3300005290 | Ga0065712_10073227 | Ga0065712_100732275 | 250 |
| 264 | 3300005354 | Ga0070675_100027792 | Ga0070675_1000277924 | 250 |
| 265 | 3300013296 | Ga0157374_10162082 | Ga0157374_101620822 | 250 |
| 266 | 3300025926 | Ga0207659_10004794 | Ga0207659_100047946 | 250 |
| 267 | 3300053153 | Ga0500616_0007045 | Ga0500616_0007045_1636_2622 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tk1-assembly1.cif.gz_A | yeast oxygen-dependent coproporphyrinogen oxidase | 0.8928 | 14 | 238 |
| 2qt8-assembly1.cif.gz_A | coproporphyrinogen iii oxidase from leishmania major | 0.8793 | 18 | 247 |
| 1tk1-assembly1.cif.gz_A | yeast oxygen-dependent coproporphyrinogen oxidase | 0.8773 | 14 | 238 |
| 2aex-assembly1.cif.gz_A-2 | the 1.58a crystal structure of human coproporphyrinogen oxidase reveals the structural basis of hereditary coproporphyria | 0.8729 | 16 | 247 |
| 3ejo-assembly1.cif.gz_B | coproporphyrinogen iii oxidase from leishmania donovani | 0.8519 | 18 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q93Z96_46_233_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8951 | 16 | 159 | 3.40.1500.10 |
| 1tk1A00 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8928 | 14 | 238 | 3.40.1500.10 |
| 1tk1A00 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8773 | 14 | 238 | 3.40.1500.10 |
| af_Q9UTE2_2_312_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8608 | 9 | 246 | 3.40.1500.10 |
| af_Q54IA7_2_331_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8444 | 15 | 247 | 3.40.1500.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849EKK0-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9655 | 17 | 143 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A849EKK0-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9581 | 17 | 143 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A519MXW2-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9574 | 17 | 169 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A3D1I5S4-F1-model_v4 | deleted | 0.954 | 33 | 169 |
|
| AF-A0A3C2AJR9-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9468 | 15 | 118 |
GO:0004109
GO:0005737 GO:0006782 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar