F374786

General Info

Members Datasets Scaffolds Average Seq Length
267 176 265 293

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10252511|Ga0163161_102525112
Length 331
Sequence MRLVDNGQLIIENVMNVKESWIAIIHQMQDSICTALEECDGKAKFVEDKWERPEGGGGKTRVIANGNVIEKGGVNTSIVFGEVTDIMKSQLKGSPLGDRGSNWFACGLSLVIHPGNPFVPTVHCNYRMFELYDEAGEVIDRWFGGGTDLTPYYLFEEDAKHFHQTYKDTCDHFDILFYPFVNWHRNEERRGIGGIFYDYQRPGETQDVNFWINFGKACGNAFMEAYIPIIEKRKDTIYTPENKYWQEIRRGRYVEFNLVHDRGTLFGLKTNGRIESILMSLPPTVLFEYNYVPAYGTEEYKMQEACLHPRDWLEEITDEERNEWARRSNTC

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
153 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
157 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
158 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0
Rhizoplane 0.37
Rhizosphere 91.76
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1006044 3300002155 Bacteria 1350
2 JGI25406J46586_10042741 3300003203 Bacteria 1583
3 Ga0065714_10105646 3300005288 Bacteria 1563
4 Ga0065704_10120379 3300005289 Bacteria 1783
5 Ga0065712_10019083 3300005290 Bacteria 1992
6 Ga0065712_10073227 3300005290 Bacteria 4460
7 Ga0070658_10066365 3300005327 Bacteria 2948
8 Ga0070658_10200582 3300005327 Bacteria 1683
9 Ga0070658_10307098 3300005327 Bacteria 1353
10 Ga0070683_100009457 3300005329 Bacteria 8335
11 Ga0070683_100012654 3300005329 Bacteria 7336
12 Ga0070690_100103150 3300005330 Bacteria 1894
13 Ga0070670_100029014 3300005331 Bacteria 4762
14 Ga0070670_100382179 3300005331 Bacteria 1241
15 Ga0070680_100070765 3300005336 Bacteria 2865
16 Ga0068868_100240798 3300005338 Bacteria 1520
17 Ga0068868_100286782 3300005338 Bacteria 1395
18 Ga0068868_100359674 3300005338 Bacteria 1248
19 Ga0070689_100210638 3300005340 Bacteria 1590
20 Ga0070691_10016671 3300005341 Bacteria 3377
21 Ga0070687_100005370 3300005343 Bacteria 5180
22 Ga0070687_100097817 3300005343 Unclassified 1637
23 Ga0070669_100032809 3300005353 Bacteria 3752
24 Ga0070675_100002984 3300005354 Bacteria 12783
25 Ga0070675_100027792 3300005354 Bacteria 4548
26 Ga0070675_100222102 3300005354 Bacteria 1646
27 Ga0070671_100021862 3300005355 Bacteria 5224
28 Ga0070671_100047740 3300005355 Bacteria 3559
29 Ga0070674_100121571 3300005356 Bacteria 1934
30 Ga0070673_100085466 3300005364 Bacteria 2568
31 Ga0070688_100159985 3300005365 Bacteria 1546
32 Ga0070659_100013648 3300005366 Bacteria 6052
33 Ga0070659_100014635 3300005366 Bacteria 5866
34 Ga0070659_100081523 3300005366 Bacteria 2584
35 Ga0070667_100010542 3300005367 Bacteria 7627
36 Ga0070667_100180067 3300005367 Bacteria 1869
37 Ga0070667_100362033 3300005367 Bacteria 1315
38 Ga0070667_100431070 3300005367 Bacteria 1203
39 Ga0070701_10017310 3300005438 Bacteria 3367
40 Ga0070681_10097023 3300005458 Bacteria 2895
41 Ga0070681_10129367 3300005458 Bacteria 2457
42 Ga0068867_100025914 3300005459 Bacteria 4206
43 Ga0068867_100206899 3300005459 Bacteria 1574
44 Ga0070679_100000762 3300005530 Bacteria 27934
45 Ga0070679_100050640 3300005530 Bacteria 4137
46 Ga0070679_100156030 3300005530 Bacteria 2257
47 Ga0070679_100326711 3300005530 Bacteria 1483
48 Ga0070684_100010359 3300005535 Bacteria 7382
49 Ga0068853_100231430 3300005539 Bacteria 1691
50 Ga0070686_100017607 3300005544 Bacteria 4178
51 Ga0070693_100050921 3300005547 Bacteria 2369
52 Ga0068855_100004043 3300005563 Bacteria 17897
53 Ga0068855_100046182 3300005563 Bacteria 5149
54 Ga0070664_100019758 3300005564 Bacteria 5543
55 Ga0068857_100063568 3300005577 Bacteria 3281
56 Ga0070702_100012202 3300005615 Bacteria 4299
57 Ga0068852_100155268 3300005616 Bacteria 2131
58 Ga0068852_100217636 3300005616 Bacteria 1815
59 Ga0068852_100268936 3300005616 Unclassified 1639
60 Ga0068859_100149155 3300005617 Bacteria 2414
61 Ga0068864_100123718 3300005618 Bacteria 2315
62 Ga0068866_10081704 3300005718 Bacteria 1737
63 Ga0068861_100015637 3300005719 Bacteria 5352
64 Ga0068851_10044230 3300005834 Bacteria 2247
65 Ga0068851_10066086 3300005834 Bacteria 1863
66 Ga0068870_10043928 3300005840 Bacteria 2332
67 Ga0068870_10137904 3300005840 Bacteria 1424
68 Ga0068858_100048390 3300005842 Bacteria 3940
69 Ga0068858_100064887 3300005842 Bacteria 3379
70 Ga0068860_100113282 3300005843 Bacteria 2593
71 Ga0068860_100161726 3300005843 Bacteria 2159
72 Ga0081539_10000382 3300005985 Bacteria 96235
73 Ga0075366_10025711 3300006195 Bacteria 3442
74 Ga0097621_100389513 3300006237 Bacteria 1246
75 Ga0075370_10205204 3300006353 Bacteria 1163
76 Ga0068871_100195017 3300006358 Bacteria 1746
77 Ga0097620_100149158 3300006931 Bacteria 2414
78 Ga0105240_10160766 3300009093 Bacteria 2668
79 Ga0111539_10035579 3300009094 Bacteria 6028
80 Ga0105247_10080059 3300009101 Bacteria 2057
81 Ga0114129_10049647 3300009147 Bacteria 5895
82 Ga0114129_10166838 3300009147 Bacteria 3004
83 Ga0105241_10007669 3300009174 Bacteria 7933
84 Ga0105242_10033077 3300009176 Bacteria 4138
85 Ga0105242_10409902 3300009176 Bacteria 1267
86 Ga0105242_10507859 3300009176 Bacteria 1148
87 Ga0105248_10504054 3300009177 Bacteria 1365
88 Ga0105249_10029206 3300009553 Bacteria 4979
89 Ga0105249_10036040 3300009553 Bacteria 4488
90 Ga0157373_10012931 3300013100 Bacteria 6127
91 Ga0157373_10019248 3300013100 Bacteria 4971
92 Ga0157373_10156355 3300013100 Bacteria 1604
93 Ga0157371_10004208 3300013102 Bacteria 12666
94 Ga0157371_10004402 3300013102 Bacteria 12311
95 Ga0157371_10005080 3300013102 Bacteria 11236
96 Ga0157371_10007002 3300013102 Bacteria 9174
97 Ga0157371_10035545 3300013102 Bacteria 3569
98 Ga0157371_10037639 3300013102 Bacteria 3462
99 Ga0157371_10176214 3300013102 Bacteria 1529
100 Ga0157371_10204961 3300013102 Bacteria 1414
101 Ga0157371_10219819 3300013102 Bacteria 1364
102 Ga0157370_10000526 3300013104 Bacteria 47828
103 Ga0157370_10000722 3300013104 Bacteria 41392
104 Ga0157370_10031349 3300013104 Bacteria 5202
105 Ga0157370_10040296 3300013104 Bacteria 4510
106 Ga0157369_10008996 3300013105 Bacteria 11440
107 Ga0157369_10083750 3300013105 Bacteria 3410
108 Ga0157369_10549564 3300013105 Bacteria 1194
109 Ga0157374_10162082 3300013296 Bacteria 2178
110 Ga0157374_10258036 3300013296 Bacteria 1716
111 Ga0157378_10032706 3300013297 Bacteria 4596
112 Ga0157378_10037163 3300013297 Bacteria 4312
113 Ga0157378_10090640 3300013297 Bacteria 2778
114 Ga0157372_10015393 3300013307 Bacteria 8197
115 Ga0157372_10039735 3300013307 Bacteria 5194
116 Ga0157372_10046302 3300013307 Bacteria 4828
117 Ga0157372_10261735 3300013307 Bacteria 2009
118 Ga0157372_10299161 3300013307 Bacteria 1872
119 Ga0163163_10107382 3300014325 Bacteria 2818
120 Ga0157380_10001666 3300014326 Bacteria 14658
121 Ga0157380_10004001 3300014326 Bacteria 10175
122 Ga0157380_10021198 3300014326 Bacteria 4871
123 Ga0157377_10178645 3300014745 Bacteria 1333
124 Ga0157379_10141581 3300014968 Bacteria 2168
125 Ga0157376_10018126 3300014969 Bacteria 5388
126 Ga0163161_10008158 3300017792 Bacteria 7243
127 Ga0163161_10156233 3300017792 Bacteria 1737
128 Ga0163161_10252511 3300017792 Bacteria 1375
129 Ga0207642_10018740 3300025899 Bacteria 2664
130 Ga0207688_10014014 3300025901 Bacteria 4359
131 Ga0207647_10000061 3300025904 Bacteria 83985
132 Ga0207645_10010633 3300025907 Bacteria 6314
133 Ga0207705_10013466 3300025909 Bacteria 5901
134 Ga0207707_10000160 3300025912 Bacteria 70695
135 Ga0207695_10036269 3300025913 Bacteria 5332
136 Ga0207695_10249937 3300025913 Bacteria 1673
137 Ga0207660_10007609 3300025917 Bacteria 7011
138 Ga0207662_10004158 3300025918 Bacteria 7576
139 Ga0207657_10006852 3300025919 Bacteria 11753
140 Ga0207652_10000108 3300025921 Bacteria 90141
141 Ga0207652_10003607 3300025921 Bacteria 12749
142 Ga0207652_10028288 3300025921 Bacteria 4676
143 Ga0207652_10031366 3300025921 Bacteria 4464
144 Ga0207652_10035389 3300025921 Bacteria 4214
145 Ga0207650_10010103 3300025925 Bacteria 6467
146 Ga0207650_10267246 3300025925 Bacteria 1389
147 Ga0207659_10004794 3300025926 Bacteria 8202
148 Ga0207659_10011234 3300025926 Bacteria 5652
149 Ga0207644_10096089 3300025931 Bacteria 2217
150 Ga0207690_10063300 3300025932 Bacteria 2522
151 Ga0207686_10005907 3300025934 Bacteria 6574
152 Ga0207670_10100261 3300025936 Bacteria 2067
153 Ga0207669_10044693 3300025937 Bacteria 2605
154 Ga0207691_10224129 3300025940 Bacteria 1629
155 Ga0207689_10088927 3300025942 Bacteria 2537
156 Ga0207689_10126258 3300025942 Bacteria 2104
157 Ga0207667_10014841 3300025949 Bacteria 8860
158 Ga0207667_10034371 3300025949 Bacteria 5444
159 Ga0207712_10001552 3300025961 Bacteria 15491
160 Ga0207677_10070649 3300026023 Bacteria 2461
161 Ga0207677_10076990 3300026023 Bacteria 2377
162 Ga0207703_10019588 3300026035 Bacteria 5287
163 Ga0207639_10058064 3300026041 Bacteria 2974
164 Ga0207641_10001032 3300026088 Bacteria 28240
165 Ga0207648_10016277 3300026089 Bacteria 6802
166 Ga0207648_10055128 3300026089 Bacteria 3471
167 Ga0207648_10065397 3300026089 Bacteria 3171
168 Ga0207648_10263867 3300026089 Unclassified 1537
169 Ga0207676_10166395 3300026095 Bacteria 1916
170 Ga0207674_10122384 3300026116 Bacteria 2568
171 Ga0207674_10159812 3300026116 Bacteria 2208
172 Ga0207675_100015062 3300026118 Bacteria 7216
173 Ga0207683_10332462 3300026121 Bacteria 1393
174 Ga0207698_10258008 3300026142 Bacteria 1600
175 Ga0209974_10039779 3300027876 Bacteria 1564
176 Ga0207428_10180931 3300027907 Bacteria 1593
177 Ga0268264_10090825 3300028381 Bacteria 2633
178 Ga0307515_10000010 3300028794 Bacteria 651586
179 Ga0307512_10098246 3300030522 Bacteria 1999
180 Ga0265327_10000022 3300031251 Bacteria 402724
181 Ga0265327_10033009 3300031251 Bacteria 2891
182 Ga0307513_10121448 3300031456 Bacteria 2579
183 Ga0307509_10039848 3300031507 Bacteria 5114
184 Ga0307509_10106523 3300031507 Bacteria 2822
185 Ga0307508_10000181 3300031616 Bacteria 76433
186 Ga0307410_10239576 3300031852 Unclassified 1405
187 Ga0307406_10295386 3300031901 Unclassified 1242
188 Ga0307416_100460423 3300032002 Unclassified 1327
189 Ga0307414_10249802 3300032004 Bacteria 1474
190 Ga0307411_10052252 3300032005 Bacteria 2671
191 Ga0307510_10010449 3300033180 Bacteria 11027
192 Ga0373943_0085609 3300035170 Bacteria 1624
193 Ga0373955_0125642 3300035172 Bacteria 1494
194 Ga0373955_0131018 3300035172 Bacteria 1464
195 Ga0373933_0023059 3300035724 Bacteria 3552
196 Ga0373937_0025725 3300036401 Bacteria 5315
197 Ga0373937_0270062 3300036401 Bacteria 1605
198 Ga0395899_0004787 3300037312 Bacteria 10548
199 Ga0395899_0006089 3300037312 Bacteria 9353
200 Ga0395899_0025043 3300037312 Bacteria 4505
201 Ga0395899_0211195 3300037312 Bacteria 1348
202 Ga0395900_0000573 3300037418 Bacteria 50934
203 Ga0395900_0015000 3300037418 Bacteria 7897
204 Ga0395900_0116983 3300037418 Bacteria 2735
205 Ga0395898_0009807 3300037466 Bacteria 10035
206 Ga0395898_0010823 3300037466 Bacteria 9529
207 Ga0395898_0042553 3300037466 Bacteria 4480
208 Ga0395905_0000744 3300037471 Bacteria 42929
209 Ga0395905_0499844 3300037471 Bacteria 1116
210 Ga0395901_0001343 3300038443 Bacteria 25786
211 Ga0395901_0002235 3300038443 Bacteria 19752
212 Ga0395901_0004128 3300038443 Bacteria 14639
213 Ga0439439_0008743 3300041406 Bacteria 2397
214 Ga0451841_0697222 3300041498 Bacteria 1052
215 Ga0439457_000159 3300042014 Bacteria 17442
216 Ga0439462_0000485 3300042015 Bacteria 7838
217 Ga0451577_0031421 3300042876 Bacteria 4790
218 Ga0451577_0071539 3300042876 Bacteria 3093
219 Ga0466972_0000974 3300044658 Bacteria 13787
220 Ga0453684_0084061 3300044712 Bacteria 3960
221 Ga0453684_0147415 3300044712 Bacteria 2801
222 Ga0466957_0002233 3300044842 Bacteria 10386
223 Ga0495592_0067116 3300046454 Bacteria 2623
224 Ga0495651_0188370 3300046462 Bacteria 1454
225 Ga0495653_0143205 3300046463 Bacteria 1679
226 Ga0495618_0167095 3300046514 Bacteria 1401
227 Ga0495628_0059068 3300046516 Bacteria 3012
228 Ga0495587_0120973 3300046536 Bacteria 1500
229 Ga0495634_0076273 3300046642 Bacteria 2201
230 Ga0495599_0099004 3300046678 Bacteria 1817
231 Ga0495676_0088198 3300047321 Bacteria 2328
232 Ga0496115_0207865 3300048918 Bacteria 1617
233 Ga0501298_002003 3300049521 Bacteria 3048
234 Ga0501033_0024864 3300049570 Bacteria 4516
235 Ga0501047_0010954 3300049581 Bacteria 8579
236 Ga0501047_0011378 3300049581 Bacteria 8422
237 Ga0501075_0020580 3300049591 Bacteria 4802
238 Ga0501077_0149043 3300049593 Bacteria 1484
239 Ga0501201_000412 3300049651 Bacteria 3928
240 Ga0501217_003675 3300049661 Bacteria 3114
241 Ga0501223_003634 3300049663 Bacteria 3332
242 Ga0501235_003514 3300049669 Bacteria 3392
243 Ga0501243_004889 3300049675 Bacteria 2011
244 Ga0501259_001848 3300049688 Bacteria 3510
245 Ga0501221_001585 3300049704 Bacteria 3778
246 Ga0501225_0001570 3300049705 Bacteria 7160
247 Ga0501225_0027007 3300049705 Bacteria 1580
248 Ga0501245_000228 3300049708 Bacteria 6347
249 Ga0501081_0031536 3300049743 Bacteria 3592
250 Ga0501232_002747 3300049757 Bacteria 1551
251 Ga0501044_0006949 3300049823 Bacteria 12454
252 Ga0501212_000657 3300049851 Bacteria 3496
253 nmdc:mga0k408_32426_c1 3300050493 Bacteria 2985
254 nmdc:mga07m45_219015_c1 3300050496 Bacteria 1107
255 nmdc:mga05p37_108781_c1 3300050507 Bacteria 3410
256 nmdc:mga08y16_50451_c1 3300050511 Bacteria 4354
257 Ga0495619_0290168 3300053085 Bacteria 1133
258 Ga0500578_0000010 3300053086 Bacteria 217642
259 Ga0500646_0006754 3300053090 Bacteria 2920
260 Ga0500646_0053654 3300053090 Bacteria 1169
261 Ga0500583_0030376 3300053092 Bacteria 2366
262 Ga0500604_0006248 3300053151 Bacteria 3146
263 Ga0500616_0007045 3300053153 Bacteria 7218
264 Ga0500622_0008875 3300053156 Bacteria 5596
265 Ga0500636_0059767 3300053177 Bacteria 2227

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0207865 Ga0496115_0207865_13_813 183
2 3300005327 Ga0070658_10307098 Ga0070658_103070981 209
3 3300005366 Ga0070659_100081523 Ga0070659_1000815233 209
4 3300005458 Ga0070681_10129367 Ga0070681_101293671 209
5 3300005530 Ga0070679_100156030 Ga0070679_1001560301 209
6 3300013307 Ga0157372_10299161 Ga0157372_102991612 209
7 3300025909 Ga0207705_10013466 Ga0207705_100134662 209
8 3300025949 Ga0207667_10014841 Ga0207667_100148415 209
9 3300037312 Ga0395899_0006089 Ga0395899_0006089_1901_2812 209
10 3300037312 Ga0395899_0025043 Ga0395899_0025043_1809_2720 209
11 3300037418 Ga0395900_0015000 Ga0395900_0015000_231_1142 209
12 3300037466 Ga0395898_0009807 Ga0395898_0009807_8121_9032 209
13 3300037466 Ga0395898_0010823 Ga0395898_0010823_5611_6522 209
14 3300038443 Ga0395901_0002235 Ga0395901_0002235_13308_14219 209
15 3300038443 Ga0395901_0004128 Ga0395901_0004128_9616_10527 209
16 3300044712 Ga0453684_0147415 Ga0453684_0147415_782_1693 209
17 3300005289 Ga0065704_10120379 Ga0065704_101203792 210
18 3300005327 Ga0070658_10066365 Ga0070658_100663652 210
19 3300005336 Ga0070680_100070765 Ga0070680_1000707654 210
20 3300005458 Ga0070681_10097023 Ga0070681_100970231 210
21 3300005530 Ga0070679_100000762 Ga0070679_10000076218 210
22 3300013102 Ga0157371_10035545 Ga0157371_100355452 210
23 3300013105 Ga0157369_10549564 Ga0157369_105495641 210
24 3300025921 Ga0207652_10000108 Ga0207652_1000010821 210
25 3300025921 Ga0207652_10035389 Ga0207652_100353893 210
26 3300042876 Ga0451577_0071539 Ga0451577_0071539_1475_2386 210
27 3300005354 Ga0070675_100222102 Ga0070675_1002221022 211
28 3300005366 Ga0070659_100014635 Ga0070659_1000146356 211
29 3300005539 Ga0068853_100231430 Ga0068853_1002314302 211
30 3300005563 Ga0068855_100004043 Ga0068855_10000404313 211
31 3300005563 Ga0068855_100046182 Ga0068855_1000461824 211
32 3300005577 Ga0068857_100063568 Ga0068857_1000635682 211
33 3300013102 Ga0157371_10004402 Ga0157371_100044027 211
34 3300013102 Ga0157371_10204961 Ga0157371_102049612 211
35 3300013104 Ga0157370_10000722 Ga0157370_1000072228 211
36 3300013296 Ga0157374_10258036 Ga0157374_102580361 211
37 3300025921 Ga0207652_10028288 Ga0207652_100282882 211
38 3300025932 Ga0207690_10063300 Ga0207690_100633001 211
39 3300025949 Ga0207667_10034371 Ga0207667_100343712 211
40 3300026041 Ga0207639_10058064 Ga0207639_100580643 211
41 3300026116 Ga0207674_10122384 Ga0207674_101223843 211
42 3300005535 Ga0070684_100010359 Ga0070684_1000103591 212
43 3300005338 Ga0068868_100286782 Ga0068868_1002867822 213
44 3300005355 Ga0070671_100047740 Ga0070671_1000477404 213
45 3300005834 Ga0068851_10066086 Ga0068851_100660862 213
46 3300006237 Ga0097621_100389513 Ga0097621_1003895132 213
47 3300013102 Ga0157371_10219819 Ga0157371_102198192 213
48 3300025931 Ga0207644_10096089 Ga0207644_100960892 213
49 3300026023 Ga0207677_10070649 Ga0207677_100706492 213
50 3300049570 Ga0501033_0024864 Ga0501033_0024864_1644_2555 213
51 3300005329 Ga0070683_100012654 Ga0070683_1000126541 214
52 3300013102 Ga0157371_10004208 Ga0157371_100042086 214
53 3300013105 Ga0157369_10083750 Ga0157369_100837503 214
54 3300013307 Ga0157372_10046302 Ga0157372_100463025 214
55 3300025925 Ga0207650_10010103 Ga0207650_100101032 214
56 3300005331 Ga0070670_100382179 Ga0070670_1003821791 215
57 3300013100 Ga0157373_10019248 Ga0157373_100192483 215
58 3300037312 Ga0395899_0211195 Ga0395899_0211195_70_1008 215
59 3300037418 Ga0395900_0116983 Ga0395900_0116983_812_1750 215
60 3300013102 Ga0157371_10005080 Ga0157371_100050807 216
61 3300013307 Ga0157372_10261735 Ga0157372_102617352 216
62 3300009093 Ga0105240_10160766 Ga0105240_101607662 218
63 3300013104 Ga0157370_10000526 Ga0157370_100005267 218
64 3300025913 Ga0207695_10249937 Ga0207695_102499371 218
65 3300033180 Ga0307510_10010449 Ga0307510_100104498 218
66 3300013104 Ga0157370_10031349 Ga0157370_100313495 219
67 3300005290 Ga0065712_10019083 Ga0065712_100190832 223
68 3300005367 Ga0070667_100010542 Ga0070667_1000105423 223
69 3300005616 Ga0068852_100217636 Ga0068852_1002176362 223
70 3300005617 Ga0068859_100149155 Ga0068859_1001491552 223
71 3300005618 Ga0068864_100123718 Ga0068864_1001237182 223
72 3300005719 Ga0068861_100015637 Ga0068861_1000156372 223
73 3300005834 Ga0068851_10044230 Ga0068851_100442302 223
74 3300005842 Ga0068858_100064887 Ga0068858_1000648873 223
75 3300006931 Ga0097620_100149158 Ga0097620_1001491582 223
76 3300009176 Ga0105242_10033077 Ga0105242_100330774 223
77 3300009553 Ga0105249_10036040 Ga0105249_100360405 223
78 3300013102 Ga0157371_10037639 Ga0157371_100376392 223
79 3300014968 Ga0157379_10141581 Ga0157379_101415811 223
80 3300025934 Ga0207686_10005907 Ga0207686_100059074 223
81 3300025936 Ga0207670_10100261 Ga0207670_101002612 223
82 3300025961 Ga0207712_10001552 Ga0207712_100015529 223
83 3300026035 Ga0207703_10019588 Ga0207703_100195885 223
84 3300026095 Ga0207676_10166395 Ga0207676_101663952 223
85 3300026118 Ga0207675_100015062 Ga0207675_1000150625 223
86 3300005356 Ga0070674_100121571 Ga0070674_1001215712 226
87 3300009094 Ga0111539_10035579 Ga0111539_100355794 227
88 3300027907 Ga0207428_10180931 Ga0207428_101809312 227
89 3300050511 nmdc:mga08y16_50451_c1 nmdc:mga08y16_50451_c1_1419_2369 227
90 3300013297 Ga0157378_10032706 Ga0157378_100327065 228
91 3300031507 Ga0307509_10039848 Ga0307509_100398483 229
92 3300049591 Ga0501075_0020580 Ga0501075_0020580_1590_2567 232
93 3300049593 Ga0501077_0149043 Ga0501077_0149043_206_1207 232
94 3300049743 Ga0501081_0031536 Ga0501081_0031536_1968_2945 232
95 iso_pu_bacteria 2738541278 2738724712 232
96 3300003203 JGI25406J46586_10042741 JGI25406J46586_100427411 233
97 3300005564 Ga0070664_100019758 Ga0070664_1000197582 233
98 3300005985 Ga0081539_10000382 Ga0081539_1000038213 233
99 3300014745 Ga0157377_10178645 Ga0157377_101786451 233
100 3300030522 Ga0307512_10098246 Ga0307512_100982462 233
101 3300031456 Ga0307513_10121448 Ga0307513_101214483 233
102 3300037471 Ga0395905_0000744 Ga0395905_0000744_38256_39167 233
103 3300053090 Ga0500646_0006754 Ga0500646_0006754_1795_2712 233
104 3300005338 Ga0068868_100240798 Ga0068868_1002407981 234
105 3300005843 Ga0068860_100161726 Ga0068860_1001617262 234
106 3300013105 Ga0157369_10008996 Ga0157369_1000899611 234
107 3300028381 Ga0268264_10090825 Ga0268264_100908252 234
108 3300049521 Ga0501298_002003 Ga0501298_002003_894_1808 234
109 3300049651 Ga0501201_000412 Ga0501201_000412_1825_2739 234
110 3300049661 Ga0501217_003675 Ga0501217_003675_1276_2190 234
111 3300049663 Ga0501223_003634 Ga0501223_003634_1413_2327 234
112 3300049669 Ga0501235_003514 Ga0501235_003514_1261_2175 234
113 3300049675 Ga0501243_004889 Ga0501243_004889_224_1138 234
114 3300049688 Ga0501259_001848 Ga0501259_001848_2388_3302 234
115 3300049704 Ga0501221_001585 Ga0501221_001585_2761_3675 234
116 3300049708 Ga0501245_000228 Ga0501245_000228_848_1762 234
117 3300049757 Ga0501232_002747 Ga0501232_002747_298_1212 234
118 3300049851 Ga0501212_000657 Ga0501212_000657_405_1319 234
119 3300005288 Ga0065714_10105646 Ga0065714_101056462 235
120 3300005459 Ga0068867_100025914 Ga0068867_1000259145 235
121 3300005718 Ga0068866_10081704 Ga0068866_100817043 235
122 3300009176 Ga0105242_10409902 Ga0105242_104099022 235
123 3300025899 Ga0207642_10018740 Ga0207642_100187402 235
124 3300026089 Ga0207648_10065397 Ga0207648_100653973 235
125 3300037312 Ga0395899_0004787 Ga0395899_0004787_4088_5023 235
126 3300037418 Ga0395900_0000573 Ga0395900_0000573_8479_9414 235
127 3300037466 Ga0395898_0042553 Ga0395898_0042553_2825_3760 235
128 3300037471 Ga0395905_0499844 Ga0395905_0499844_137_1048 235
129 3300038443 Ga0395901_0001343 Ga0395901_0001343_10885_11820 235
130 3300005327 Ga0070658_10200582 Ga0070658_102005821 236
131 3300005330 Ga0070690_100103150 Ga0070690_1001031502 236
132 3300005331 Ga0070670_100029014 Ga0070670_1000290143 236
133 3300005338 Ga0068868_100359674 Ga0068868_1003596742 236
134 3300005340 Ga0070689_100210638 Ga0070689_1002106382 236
135 3300005343 Ga0070687_100005370 Ga0070687_1000053703 236
136 3300005343 Ga0070687_100097817 Ga0070687_1000978171 236
137 3300005353 Ga0070669_100032809 Ga0070669_1000328094 236
138 3300005354 Ga0070675_100002984 Ga0070675_1000029848 236
139 3300005355 Ga0070671_100021862 Ga0070671_1000218624 236
140 3300005364 Ga0070673_100085466 Ga0070673_1000854662 236
141 3300005365 Ga0070688_100159985 Ga0070688_1001599852 236
142 3300005367 Ga0070667_100362033 Ga0070667_1003620332 236
143 3300005367 Ga0070667_100431070 Ga0070667_1004310701 236
144 3300005438 Ga0070701_10017310 Ga0070701_100173102 236
145 3300005544 Ga0070686_100017607 Ga0070686_1000176072 236
146 3300005615 Ga0070702_100012202 Ga0070702_1000122023 236
147 3300005616 Ga0068852_100268936 Ga0068852_1002689361 236
148 3300005840 Ga0068870_10043928 Ga0068870_100439282 236
149 3300005840 Ga0068870_10137904 Ga0068870_101379042 236
150 3300005842 Ga0068858_100048390 Ga0068858_1000483903 236
151 3300006195 Ga0075366_10025711 Ga0075366_100257112 236
152 3300009101 Ga0105247_10080059 Ga0105247_100800592 236
153 3300009147 Ga0114129_10166838 Ga0114129_101668383 236
154 3300009176 Ga0105242_10507859 Ga0105242_105078591 236
155 3300009177 Ga0105248_10504054 Ga0105248_105040542 236
156 3300013100 Ga0157373_10012931 Ga0157373_100129313 236
157 3300013100 Ga0157373_10156355 Ga0157373_101563552 236
158 3300013102 Ga0157371_10007002 Ga0157371_100070023 236
159 3300013102 Ga0157371_10176214 Ga0157371_101762142 236
160 3300013297 Ga0157378_10037163 Ga0157378_100371634 236
161 3300013307 Ga0157372_10015393 Ga0157372_100153939 236
162 3300014325 Ga0163163_10107382 Ga0163163_101073822 236
163 3300014326 Ga0157380_10001666 Ga0157380_100016664 236
164 3300014326 Ga0157380_10021198 Ga0157380_100211982 236
165 3300017792 Ga0163161_10008158 Ga0163161_100081584 236
166 3300017792 Ga0163161_10156233 Ga0163161_101562332 236
167 3300025901 Ga0207688_10014014 Ga0207688_100140144 236
168 3300025904 Ga0207647_10000061 Ga0207647_1000006187 236
169 3300025907 Ga0207645_10010633 Ga0207645_100106336 236
170 3300025918 Ga0207662_10004158 Ga0207662_100041588 236
171 3300025921 Ga0207652_10003607 Ga0207652_1000360711 236
172 3300025925 Ga0207650_10267246 Ga0207650_102672461 236
173 3300025926 Ga0207659_10011234 Ga0207659_100112342 236
174 3300025937 Ga0207669_10044693 Ga0207669_100446933 236
175 3300025940 Ga0207691_10224129 Ga0207691_102241291 236
176 3300025942 Ga0207689_10126258 Ga0207689_101262582 236
177 3300026023 Ga0207677_10076990 Ga0207677_100769903 236
178 3300026088 Ga0207641_10001032 Ga0207641_1000103210 236
179 3300026089 Ga0207648_10016277 Ga0207648_100162772 236
180 3300026089 Ga0207648_10263867 Ga0207648_102638671 236
181 3300026121 Ga0207683_10332462 Ga0207683_103324622 236
182 3300027876 Ga0209974_10039779 Ga0209974_100397792 236
183 3300028794 Ga0307515_10000010 Ga0307515_10000010315 236
184 3300032005 Ga0307411_10052252 Ga0307411_100522522 236
185 3300035172 Ga0373955_0131018 Ga0373955_0131018_163_1128 236
186 3300036401 Ga0373937_0270062 Ga0373937_0270062_609_1520 236
187 3300041498 Ga0451841_0697222 Ga0451841_0697222_102_1019 236
188 3300042876 Ga0451577_0031421 Ga0451577_0031421_3240_4205 236
189 3300044658 Ga0466972_0000974 Ga0466972_0000974_4779_5696 236
190 3300044842 Ga0466957_0002233 Ga0466957_0002233_1153_2085 236
191 3300046642 Ga0495634_0076273 Ga0495634_0076273_497_1408 236
192 3300049581 Ga0501047_0010954 Ga0501047_0010954_6427_7341 236
193 3300049581 Ga0501047_0011378 Ga0501047_0011378_7304_8239 236
194 3300049705 Ga0501225_0001570 Ga0501225_0001570_1242_2207 236
195 3300049823 Ga0501044_0006949 Ga0501044_0006949_5867_6781 236
196 3300050493 nmdc:mga0k408_32426_c1 nmdc:mga0k408_32426_c1_357_1268 236
197 3300050507 nmdc:mga05p37_108781_c1 nmdc:mga05p37_108781_c1_748_1707 236
198 3300053090 Ga0500646_0053654 Ga0500646_0053654_65_976 236
199 3300053092 Ga0500583_0030376 Ga0500583_0030376_474_1391 236
200 3300053156 Ga0500622_0008875 Ga0500622_0008875_861_1778 236
201 3300053177 Ga0500636_0059767 Ga0500636_0059767_660_1592 236
202 3300005616 Ga0068852_100155268 Ga0068852_1001552683 237
203 3300026142 Ga0207698_10258008 Ga0207698_102580082 237
204 3300031251 Ga0265327_10033009 Ga0265327_100330092 237
205 3300013104 Ga0157370_10040296 Ga0157370_100402962 238
206 3300031901 Ga0307406_10295386 Ga0307406_102953861 238
207 3300041406 Ga0439439_0008743 Ga0439439_0008743_292_1221 238
208 3300042014 Ga0439457_000159 Ga0439457_000159_6859_7788 238
209 3300042015 Ga0439462_0000485 Ga0439462_0000485_2119_3048 238
210 3300009147 Ga0114129_10049647 Ga0114129_100496474 239
211 3300005329 Ga0070683_100009457 Ga0070683_1000094576 240
212 3300005341 Ga0070691_10016671 Ga0070691_100166713 240
213 3300005530 Ga0070679_100050640 Ga0070679_1000506403 240
214 3300005547 Ga0070693_100050921 Ga0070693_1000509211 240
215 3300009174 Ga0105241_10007669 Ga0105241_100076692 240
216 3300014969 Ga0157376_10018126 Ga0157376_100181264 240
217 3300025912 Ga0207707_10000160 Ga0207707_1000016048 240
218 3300025913 Ga0207695_10036269 Ga0207695_100362693 240
219 3300025917 Ga0207660_10007609 Ga0207660_100076094 240
220 3300025921 Ga0207652_10031366 Ga0207652_100313663 240
221 3300032004 Ga0307414_10249802 Ga0307414_102498022 240
222 3300035170 Ga0373943_0085609 Ga0373943_0085609_132_1070 240
223 3300035172 Ga0373955_0125642 Ga0373955_0125642_505_1443 240
224 3300035724 Ga0373933_0023059 Ga0373933_0023059_294_1232 240
225 3300036401 Ga0373937_0025725 Ga0373937_0025725_1590_2528 240
226 3300044712 Ga0453684_0084061 Ga0453684_0084061_1362_2300 240
227 3300046454 Ga0495592_0067116 Ga0495592_0067116_393_1331 240
228 3300046462 Ga0495651_0188370 Ga0495651_0188370_442_1380 240
229 3300046463 Ga0495653_0143205 Ga0495653_0143205_664_1602 240
230 3300046514 Ga0495618_0167095 Ga0495618_0167095_64_1002 240
231 3300046516 Ga0495628_0059068 Ga0495628_0059068_1349_2287 240
232 3300046536 Ga0495587_0120973 Ga0495587_0120973_380_1318 240
233 3300046678 Ga0495599_0099004 Ga0495599_0099004_507_1445 240
234 3300047321 Ga0495676_0088198 Ga0495676_0088198_1102_2040 240
235 3300049705 Ga0501225_0027007 Ga0501225_0027007_88_1014 240
236 3300053085 Ga0495619_0290168 Ga0495619_0290168_149_1087 240
237 3300026116 Ga0207674_10159812 Ga0207674_101598122 241
238 3300031852 Ga0307410_10239576 Ga0307410_102395761 241
239 3300032002 Ga0307416_100460423 Ga0307416_1004604231 241
240 3300031251 Ga0265327_10000022 Ga0265327_10000022145 242
241 3300005367 Ga0070667_100180067 Ga0070667_1001800672 243
242 3300005459 Ga0068867_100206899 Ga0068867_1002068991 243
243 3300005843 Ga0068860_100113282 Ga0068860_1001132822 243
244 3300006353 Ga0075370_10205204 Ga0075370_102052041 243
245 3300006358 Ga0068871_100195017 Ga0068871_1001950172 243
246 3300009553 Ga0105249_10029206 Ga0105249_100292065 243
247 3300013297 Ga0157378_10090640 Ga0157378_100906402 243
248 3300025942 Ga0207689_10088927 Ga0207689_100889272 243
249 3300026089 Ga0207648_10055128 Ga0207648_100551283 243
250 3300031507 Ga0307509_10106523 Ga0307509_101065232 243
251 3300031616 Ga0307508_10000181 Ga0307508_1000018151 243
252 3300050496 nmdc:mga07m45_219015_c1 nmdc:mga07m45_219015_c1_36_986 243
253 3300005366 Ga0070659_100013648 Ga0070659_1000136486 244
254 3300013307 Ga0157372_10039735 Ga0157372_100397355 244
255 3300025919 Ga0207657_10006852 Ga0207657_100068529 244
256 3300053151 Ga0500604_0006248 Ga0500604_0006248_902_1840 244
257 iso_pu_bacteria 2914759650 2914762398 244
258 3300005530 Ga0070679_100326711 Ga0070679_1003267112 245
259 3300014326 Ga0157380_10004001 Ga0157380_100040017 245
260 3300017792 Ga0163161_10252511 Ga0163161_102525112 246
261 3300053086 Ga0500578_0000010 Ga0500578_0000010_104616_105587 248
262 3300002155 JGI24033J26618_1006044 JGI24033J26618_10060443 250
263 3300005290 Ga0065712_10073227 Ga0065712_100732275 250
264 3300005354 Ga0070675_100027792 Ga0070675_1000277924 250
265 3300013296 Ga0157374_10162082 Ga0157374_101620822 250
266 3300025926 Ga0207659_10004794 Ga0207659_100047946 250
267 3300053153 Ga0500616_0007045 Ga0500616_0007045_1636_2622 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01218

Coprogen_oxidas

Coproporphyrinogen III oxidase

20

312

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tk1-assembly1.cif.gz_A yeast oxygen-dependent coproporphyrinogen oxidase 0.8928 14 238
2qt8-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania major 0.8793 18 247
1tk1-assembly1.cif.gz_A yeast oxygen-dependent coproporphyrinogen oxidase 0.8773 14 238
2aex-assembly1.cif.gz_A-2 the 1.58a crystal structure of human coproporphyrinogen oxidase reveals the structural basis of hereditary coproporphyria 0.8729 16 247
3ejo-assembly1.cif.gz_B coproporphyrinogen iii oxidase from leishmania donovani 0.8519 18 247
ID Description Score Start End Superfamily
af_Q93Z96_46_233_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8951 16 159 3.40.1500.10
1tk1A00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8928 14 238 3.40.1500.10
1tk1A00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8773 14 238 3.40.1500.10
af_Q9UTE2_2_312_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8608 9 246 3.40.1500.10
af_Q54IA7_2_331_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8444 15 247 3.40.1500.10
ID Description Score Start End GO Terms
AF-A0A849EKK0-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9655 17 143 GO:0004109
GO:0005737
GO:0006782
AF-A0A849EKK0-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9581 17 143 GO:0004109
GO:0005737
GO:0006782
AF-A0A519MXW2-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9574 17 169 GO:0004109
GO:0005737
GO:0006782
AF-A0A3D1I5S4-F1-model_v4 deleted 0.954 33 169
AF-A0A3C2AJR9-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9468 15 118 GO:0004109
GO:0005737
GO:0006782

Feature Viewer

pLDDT pTM Quality
85.1 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map