F374276

General Info

Members Datasets Scaffolds Average Seq Length
266 164 532 61

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0569948|Ga0495653_0569948_22_243
Length 65
Sequence VDAGGLLSYGNVLRDSYRRAAAYANRILRGEKPSEFELVINLKTAKALGLTVPSTLIDRADELIE

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 7.89
Rhizosphere 91.35
Stem 0
Stem Tuber 0
Unclassified 18.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0569948 3300046463 Unclassified 699
2 JGI26129J50193_1000325 3300003349 Bacteria 2944
3 JGI26141J51220_1002841 3300003503 Bacteria 1061
4 Ga0065707_10012354 3300005295 Bacteria 1978
5 Ga0065707_10227730 3300005295 Bacteria 1200
6 Ga0070691_10045723 3300005341 Bacteria 2078
7 Ga0070692_10377797 3300005345 Bacteria 888
8 Ga0070673_101489002 3300005364 Bacteria 638
9 Ga0070659_101067031 3300005366 Bacteria 711
10 Ga0070714_100236785 3300005435 Bacteria 1684
11 Ga0070713_100110575 3300005436 Bacteria 2395
12 Ga0070705_100059426 3300005440 Unclassified 2264
13 Ga0070694_100003954 3300005444 Bacteria 8867
14 Ga0070694_100484889 3300005444 Unclassified 981
15 Ga0070708_100036424 3300005445 Bacteria 4291
16 Ga0070708_100065394 3300005445 Bacteria 3261
17 Ga0070708_100171533 3300005445 Bacteria 2025
18 Ga0070708_100178810 3300005445 Bacteria 1982
19 Ga0070708_100186983 3300005445 Bacteria 1937
20 Ga0070708_100221042 3300005445 Bacteria 1776
21 Ga0070708_100768837 3300005445 Bacteria 906
22 Ga0070662_100104120 3300005457 Bacteria 2153
23 Ga0070706_100089555 3300005467 Bacteria 2853
24 Ga0070706_100227654 3300005467 Bacteria 1740
25 Ga0070706_100263874 3300005467 Bacteria 1607
26 Ga0070707_100120411 3300005468 Bacteria 2548
27 Ga0070707_100202770 3300005468 Bacteria 1933
28 Ga0070707_101337989 3300005468 Bacteria 683
29 Ga0070698_100095860 3300005471 Bacteria 2944
30 Ga0070698_100096841 3300005471 Bacteria 2927
31 Ga0070698_100143009 3300005471 Bacteria 2342
32 Ga0070698_100158263 3300005471 Bacteria 2210
33 Ga0070698_100288706 3300005471 Bacteria 1571
34 Ga0070698_100401295 3300005471 Bacteria 1304
35 Ga0070698_101417778 3300005471 Bacteria 646
36 Ga0070699_100011838 3300005518 Bacteria 7529
37 Ga0070699_100057873 3300005518 Unclassified 3357
38 Ga0070699_100079553 3300005518 Bacteria 2855
39 Ga0070699_100737818 3300005518 Bacteria 900
40 Ga0070697_100073685 3300005536 Bacteria 2804
41 Ga0070697_100545990 3300005536 Bacteria 1016
42 Ga0070697_100855964 3300005536 Bacteria 806
43 Ga0070695_100017489 3300005545 Bacteria 4349
44 Ga0070696_100092423 3300005546 Unclassified 2156
45 Ga0070704_100277714 3300005549 Bacteria 1386
46 Ga0068858_101468335 3300005842 Bacteria 672
47 Ga0070717_10616368 3300006028 Bacteria 984
48 Ga0070717_11397737 3300006028 Bacteria 636
49 Ga0070712_101045310 3300006175 Bacteria 708
50 Ga0075428_100140284 3300006844 Bacteria 2628
51 Ga0075428_100575483 3300006844 Unclassified 1203
52 Ga0075428_101277297 3300006844 Bacteria 772
53 Ga0075430_100329793 3300006846 Bacteria 1261
54 Ga0075430_100413454 3300006846 Bacteria 1113
55 Ga0075430_100441262 3300006846 Bacteria 1074
56 Ga0075431_100218941 3300006847 Bacteria 1942
57 Ga0075429_100055363 3300006880 Bacteria 3451
58 Ga0075429_101001507 3300006880 Bacteria 730
59 Ga0075429_102015392 3300006880 Unclassified 500
60 Ga0075435_101595121 3300007076 Bacteria 572
61 Ga0099794_10013232 3300007265 Bacteria 3586
62 Ga0114129_10274733 3300009147 Bacteria 2253
63 Ga0114129_10701805 3300009147 Unclassified 1300
64 Ga0114129_11028125 3300009147 Unclassified 1036
65 Ga0114129_11170378 3300009147 Bacteria 959
66 Ga0114129_11247312 3300009147 Bacteria 924
67 Ga0114129_11275713 3300009147 Unclassified 911
68 Ga0114129_12993638 3300009147 Bacteria 556
69 Ga0105243_10306979 3300009148 Bacteria 1440
70 Ga0105243_11838790 3300009148 Bacteria 637
71 Ga0105241_10076061 3300009174 Bacteria 2617
72 Ga0105242_12614432 3300009176 Bacteria 554
73 Ga0105248_12267064 3300009177 Bacteria 618
74 Ga0105237_11499961 3300009545 Unclassified 681
75 Ga0105249_10684829 3300009553 Bacteria 1084
76 Ga0105246_10435766 3300011119 Bacteria 1098
77 Ga0163162_12192398 3300013306 Bacteria 634
78 Ga0163162_12455080 3300013306 Unclassified 599
79 Ga0157372_10059974 3300013307 Bacteria 4257
80 Ga0157380_13050678 3300014326 Bacteria 534
81 Ga0207642_10439011 3300025899 Bacteria 789
82 Ga0207684_10170367 3300025910 Bacteria 1877
83 Ga0207684_10389746 3300025910 Bacteria 1198
84 Ga0207684_10523030 3300025910 Bacteria 1016
85 Ga0207654_10143803 3300025911 Bacteria 1524
86 Ga0207693_10761358 3300025915 Bacteria 748
87 Ga0207657_10305935 3300025919 Bacteria 1259
88 Ga0207646_10269517 3300025922 Bacteria 1539
89 Ga0207646_10528663 3300025922 Bacteria 1061
90 Ga0207646_11159088 3300025922 Bacteria 679
91 Ga0207646_11388418 3300025922 Bacteria 611
92 Ga0207681_11244155 3300025923 Unclassified 625
93 Ga0207687_11055412 3300025927 Unclassified 697
94 Ga0207700_11412917 3300025928 Bacteria 619
95 Ga0207664_11072217 3300025929 Bacteria 721
96 Ga0207706_10222638 3300025933 Bacteria 1652
97 Ga0207669_11967794 3300025937 Bacteria 500
98 Ga0207668_10519929 3300025972 Bacteria 1027
99 Ga0207703_11052560 3300026035 Bacteria 781
100 Ga0207639_10088098 3300026041 Bacteria 2476
101 Ga0207708_10208696 3300026075 Bacteria 1560
102 Ga0209969_1003938 3300027360 Bacteria 2069
103 Ga0209981_1039996 3300027378 Bacteria 700
104 Ga0209996_1001612 3300027395 Unclassified 2745
105 Ga0210000_1003005 3300027462 Bacteria 2414
106 Ga0209995_1001238 3300027471 Bacteria 3927
107 Ga0209968_1000209 3300027526 Bacteria 10195
108 Ga0209999_1001510 3300027543 Bacteria 4006
109 Ga0209982_1007951 3300027552 Bacteria 1551
110 Ga0209970_1005007 3300027614 Bacteria 2189
111 Ga0209983_1001528 3300027665 Bacteria 5144
112 Ga0209588_1084678 3300027671 Bacteria 1023
113 Ga0209971_1000059 3300027682 Bacteria 35248
114 Ga0209966_1000256 3300027695 Bacteria 19430
115 Ga0209998_10000070 3300027717 Bacteria 40919
116 Ga0209974_10002595 3300027876 Bacteria 6567
117 Ga0373950_0154147 3300034818 Bacteria 527
118 Ga0373926_0146723 3300035083 Bacteria 897
119 Ga0373932_0250328 3300035112 Bacteria 646
120 Ga0373932_0366568 3300035112 Bacteria 551
121 Ga0373936_0220273 3300035113 Bacteria 841
122 Ga0373936_0283049 3300035113 Bacteria 745
123 Ga0373945_0345279 3300035116 Bacteria 644
124 Ga0373943_0485369 3300035170 Bacteria 721
125 Ga0373942_0206804 3300035207 Bacteria 653
126 Ga0373962_0319402 3300035242 Unclassified 555
127 Ga0373931_0861422 3300035691 Bacteria 607
128 Ga0373935_0114597 3300035692 Bacteria 1793
129 Ga0373935_0867649 3300035692 Bacteria 668
130 Ga0373927_0089831 3300035695 Bacteria 1995
131 Ga0373927_0634415 3300035695 Unclassified 706
132 Ga0373927_0665496 3300035695 Bacteria 688
133 Ga0373947_0020313 3300035725 Bacteria 3833
134 Ga0373947_0189105 3300035725 Unclassified 1343
135 Ga0373947_1130543 3300035725 Bacteria 534
136 Ga0373937_0086246 3300036401 Bacteria 2905
137 Ga0373937_0718717 3300036401 Bacteria 946
138 Ga0373925_0054146 3300037068 Bacteria 3000
139 Ga0373925_0363269 3300037068 Bacteria 1177
140 Ga0395898_1267097 3300037466 Bacteria 667
141 Ga0436360_0026321 3300039438 Unclassified 701
142 Ga0436360_0116305 3300039438 Unclassified 626
143 Ga0436363_0497876 3300039450 Bacteria 942
144 Ga0436362_0148530 3300039453 Bacteria 610
145 Ga0451793_0820173 3300041452 Bacteria 588
146 Ga0439441_142203 3300042001 Bacteria 561
147 Ga0439455_0004364 3300042012 Bacteria 2799
148 Ga0439434_0357960 3300042435 Unclassified 510
149 Ga0451577_0816512 3300042876 Bacteria 842
150 Ga0453684_0577634 3300044712 Unclassified 1235
151 Ga0451576_1553753 3300045051 Bacteria 687
152 Ga0451576_2368233 3300045051 Bacteria 543
153 Ga0495592_0041178 3300046454 Bacteria 3462
154 Ga0495629_0787721 3300046459 Bacteria 628
155 Ga0495653_0456023 3300046463 Unclassified 803
156 Ga0495580_1066158 3300046472 Unclassified 512
157 Ga0495585_0491022 3300046492 Unclassified 584
158 Ga0495618_0102679 3300046514 Bacteria 1830
159 Ga0495618_0785969 3300046514 Unclassified 555
160 Ga0495620_0032891 3300046515 Bacteria 2359
161 Ga0495630_0047416 3300046517 Bacteria 3214
162 Ga0495666_0211317 3300046526 Bacteria 890
163 Ga0495652_0020536 3300046529 Bacteria 5871
164 Ga0495652_1017356 3300046529 Bacteria 541
165 Ga0495665_0089494 3300046531 Bacteria 1617
166 Ga0495665_0290340 3300046531 Bacteria 838
167 Ga0495640_0896786 3300046533 Unclassified 525
168 Ga0495587_0055862 3300046536 Bacteria 2324
169 Ga0495598_0421981 3300046537 Bacteria 524
170 Ga0495621_0514374 3300046539 Bacteria 517
171 Ga0495622_0241772 3300046557 Bacteria 796
172 Ga0495633_0321144 3300046558 Unclassified 703
173 Ga0495656_0058220 3300046615 Bacteria 1676
174 Ga0495668_0089844 3300046616 Bacteria 1683
175 Ga0495635_0002226 3300046663 Bacteria 13172
176 Ga0495599_0185152 3300046678 Bacteria 1282
177 Ga0495599_0724256 3300046678 Bacteria 572
178 Ga0495647_0133248 3300046681 Bacteria 1054
179 Ga0495613_0317754 3300046689 Unclassified 1075
180 Ga0495624_0245310 3300046690 Bacteria 1084
181 Ga0495624_0819024 3300046690 Bacteria 550
182 Ga0495670_0373455 3300046691 Bacteria 769
183 Ga0495600_0317240 3300046809 Unclassified 981
184 Ga0495581_0743080 3300047315 Unclassified 565
185 Ga0495636_0114229 3300047318 Bacteria 1190
186 Ga0495674_1168710 3300047319 Bacteria 583
187 Ga0495680_0240520 3300047322 Bacteria 1286
188 Ga0495680_0242124 3300047322 Bacteria 1281
189 Ga0495680_0631068 3300047322 Bacteria 714
190 Ga0495675_0226527 3300047444 Bacteria 1129
191 Ga0495593_0134568 3300047673 Unclassified 1253
192 Ga0496100_1037775 3300048903 Bacteria 645
193 Ga0496101_0153523 3300048904 Unclassified 1762
194 Ga0496101_0713561 3300048904 Bacteria 792
195 Ga0496101_0956638 3300048904 Bacteria 674
196 Ga0496101_1357026 3300048904 Bacteria 555
197 Ga0496102_1347086 3300048905 Bacteria 633
198 Ga0496103_0524527 3300048906 Unclassified 757
199 Ga0496104_1355590 3300048907 Unclassified 614
200 Ga0496105_0009798 3300048908 Bacteria 7504
201 Ga0496106_1373332 3300048909 Unclassified 547
202 Ga0496107_0144715 3300048910 Unclassified 1757
203 Ga0496109_0158766 3300048912 Bacteria 2118
204 Ga0496110_0028533 3300048913 Bacteria 4795
205 Ga0496111_0131343 3300048914 Unclassified 1853
206 Ga0496111_1010519 3300048914 Bacteria 596
207 Ga0496111_1268701 3300048914 Bacteria 520
208 Ga0496112_1380944 3300048915 Bacteria 619
209 Ga0496113_0535418 3300048916 Bacteria 940
210 Ga0496114_1499188 3300048917 Bacteria 562
211 Ga0496115_0444213 3300048918 Bacteria 1048
212 Ga0501042_0451237 3300049578 Bacteria 932
213 Ga0501069_0154143 3300049585 Unclassified 1321
214 Ga0501072_0053598 3300049588 Unclassified 3177
215 Ga0501080_0871819 3300049742 Bacteria 786
216 Ga0501080_1591154 3300049742 Unclassified 554
217 Ga0501081_0787502 3300049743 Archaea 715
218 nmdc:mga0yw44_830784_c1 3300050492 Unclassified 627
219 nmdc:mga05p37_1060369_c1 3300050507 Bacteria 854
220 nmdc:mga05p37_1087474_c1 3300050507 Bacteria 839
221 nmdc:mga05p37_112826_c1 3300050507 Bacteria 3343
222 nmdc:mga05p37_1353441_c1 3300050507 Bacteria 721
223 nmdc:mga05p37_2252362_c1 3300050507 Bacteria 504
224 nmdc:mga05p37_402658_c1 3300050507 Unclassified 1598
225 nmdc:mga05p37_471533_c1 3300050507 Bacteria 1448
226 nmdc:mga05p37_97923_c1 3300050507 Bacteria 3613
227 nmdc:mga09592_1119758_c1 3300050508 Bacteria 654
228 nmdc:mga09592_15924_c1 3300050508 Bacteria 6143
229 nmdc:mga09592_1724055_c1 3300050508 Unclassified 505
230 nmdc:mga09592_513777_c1 3300050508 Bacteria 1031
231 nmdc:mga09592_601910_c1 3300050508 Bacteria 942
232 nmdc:mga0qj67_1060566_c1 3300050509 Unclassified 634
233 nmdc:mga0qj67_371720_c1 3300050509 Bacteria 1155
234 nmdc:mga0qj67_395489_c1 3300050509 Bacteria 1115
235 nmdc:mga0qj67_488125_c1 3300050509 Bacteria 991
236 nmdc:mga0qj67_724714_c1 3300050509 Bacteria 790
237 nmdc:mga06r32_1191120_c1 3300050510 Bacteria 708
238 nmdc:mga06r32_1198181_c1 3300050510 Bacteria 706
239 nmdc:mga06r32_34595_c1 3300050510 Bacteria 4765
240 nmdc:mga06r32_462304_c1 3300050510 Bacteria 1248
241 nmdc:mga06r32_64020_c1 3300050510 Bacteria 3545
242 nmdc:mga06r32_664712_c1 3300050510 Unclassified 1009
243 nmdc:mga08y16_1074627_c1 3300050511 Unclassified 781
244 nmdc:mga08y16_1948099_c1 3300050511 Bacteria 538
245 nmdc:mga08y16_74925_c1 3300050511 Bacteria 3528
246 nmdc:mga0n895_131841_c1 3300050512 Bacteria 2524
247 nmdc:mga0n895_1604545_c1 3300050512 Bacteria 615
248 nmdc:mga0n895_2099171_c1 3300050512 Bacteria 522
249 nmdc:mga0n895_480686_c1 3300050512 Unclassified 1253
250 nmdc:mga0n895_883811_c1 3300050512 Bacteria 880
251 nmdc:mga0rr50_101673_c1 3300050513 Bacteria 2260
252 nmdc:mga0rr50_1048869_c1 3300050513 Unclassified 694
253 nmdc:mga0rr50_1199661_c1 3300050513 Bacteria 645
254 nmdc:mga0rr50_127264_c1 3300050513 Bacteria 2036
255 nmdc:mga0rr50_50676_c1 3300050513 Bacteria 3077
256 nmdc:mga0rr50_550526_c1 3300050513 Bacteria 982
257 nmdc:mga08x19_1032951_c1 3300050514 Unclassified 584
258 nmdc:mga0a205_1019083_c1 3300050515 Bacteria 675
259 nmdc:mga0a205_57630_c1 3300050515 Bacteria 3751
260 nmdc:mga0a205_863958_c1 3300050515 Bacteria 752
261 nmdc:mga0a205_96402_c1 3300050515 Bacteria 1831
262 Ga0495601_0961022 3300053077 Bacteria 538
263 Ga0495612_0104314 3300053078 Bacteria 1209
264 Ga0495655_0013008 3300053083 Bacteria 1710
265 Ga0495619_0493358 3300053085 Bacteria 842
266 Ga0501082_0259686 3300060353 Bacteria 1511
267 Ga0495653_0569948
268 JGI26129J50193_1000325
269 JGI26141J51220_1002841
270 Ga0065707_10012354
271 Ga0065707_10227730
272 Ga0070691_10045723
273 Ga0070692_10377797
274 Ga0070673_101489002
275 Ga0070659_101067031
276 Ga0070714_100236785
277 Ga0070713_100110575
278 Ga0070705_100059426
279 Ga0070694_100003954
280 Ga0070694_100484889
281 Ga0070708_100036424
282 Ga0070708_100065394
283 Ga0070708_100171533
284 Ga0070708_100178810
285 Ga0070708_100186983
286 Ga0070708_100221042
287 Ga0070708_100768837
288 Ga0070662_100104120
289 Ga0070706_100089555
290 Ga0070706_100227654
291 Ga0070706_100263874
292 Ga0070707_100120411
293 Ga0070707_100202770
294 Ga0070707_101337989
295 Ga0070698_100095860
296 Ga0070698_100096841
297 Ga0070698_100143009
298 Ga0070698_100158263
299 Ga0070698_100288706
300 Ga0070698_100401295
301 Ga0070698_101417778
302 Ga0070699_100011838
303 Ga0070699_100057873
304 Ga0070699_100079553
305 Ga0070699_100737818
306 Ga0070697_100073685
307 Ga0070697_100545990
308 Ga0070697_100855964
309 Ga0070695_100017489
310 Ga0070696_100092423
311 Ga0070704_100277714
312 Ga0068858_101468335
313 Ga0070717_10616368
314 Ga0070717_11397737
315 Ga0070712_101045310
316 Ga0075428_100140284
317 Ga0075428_100575483
318 Ga0075428_101277297
319 Ga0075430_100329793
320 Ga0075430_100413454
321 Ga0075430_100441262
322 Ga0075431_100218941
323 Ga0075429_100055363
324 Ga0075429_101001507
325 Ga0075429_102015392
326 Ga0075435_101595121
327 Ga0099794_10013232
328 Ga0114129_10274733
329 Ga0114129_10701805
330 Ga0114129_11028125
331 Ga0114129_11170378
332 Ga0114129_11247312
333 Ga0114129_11275713
334 Ga0114129_12993638
335 Ga0105243_10306979
336 Ga0105243_11838790
337 Ga0105241_10076061
338 Ga0105242_12614432
339 Ga0105248_12267064
340 Ga0105237_11499961
341 Ga0105249_10684829
342 Ga0105246_10435766
343 Ga0163162_12192398
344 Ga0163162_12455080
345 Ga0157372_10059974
346 Ga0157380_13050678
347 Ga0207642_10439011
348 Ga0207684_10170367
349 Ga0207684_10389746
350 Ga0207684_10523030
351 Ga0207654_10143803
352 Ga0207693_10761358
353 Ga0207657_10305935
354 Ga0207646_10269517
355 Ga0207646_10528663
356 Ga0207646_11159088
357 Ga0207646_11388418
358 Ga0207681_11244155
359 Ga0207687_11055412
360 Ga0207700_11412917
361 Ga0207664_11072217
362 Ga0207706_10222638
363 Ga0207669_11967794
364 Ga0207668_10519929
365 Ga0207703_11052560
366 Ga0207639_10088098
367 Ga0207708_10208696
368 Ga0209969_1003938
369 Ga0209981_1039996
370 Ga0209996_1001612
371 Ga0210000_1003005
372 Ga0209995_1001238
373 Ga0209968_1000209
374 Ga0209999_1001510
375 Ga0209982_1007951
376 Ga0209970_1005007
377 Ga0209983_1001528
378 Ga0209588_1084678
379 Ga0209971_1000059
380 Ga0209966_1000256
381 Ga0209998_10000070
382 Ga0209974_10002595
383 Ga0373950_0154147
384 Ga0373926_0146723
385 Ga0373932_0250328
386 Ga0373932_0366568
387 Ga0373936_0220273
388 Ga0373936_0283049
389 Ga0373945_0345279
390 Ga0373943_0485369
391 Ga0373942_0206804
392 Ga0373962_0319402
393 Ga0373931_0861422
394 Ga0373935_0114597
395 Ga0373935_0867649
396 Ga0373927_0089831
397 Ga0373927_0634415
398 Ga0373927_0665496
399 Ga0373947_0020313
400 Ga0373947_0189105
401 Ga0373947_1130543
402 Ga0373937_0086246
403 Ga0373937_0718717
404 Ga0373925_0054146
405 Ga0373925_0363269
406 Ga0395898_1267097
407 Ga0436360_0026321
408 Ga0436360_0116305
409 Ga0436363_0497876
410 Ga0436362_0148530
411 Ga0451793_0820173
412 Ga0439441_142203
413 Ga0439455_0004364
414 Ga0439434_0357960
415 Ga0451577_0816512
416 Ga0453684_0577634
417 Ga0451576_1553753
418 Ga0451576_2368233
419 Ga0495592_0041178
420 Ga0495629_0787721
421 Ga0495653_0456023
422 Ga0495580_1066158
423 Ga0495585_0491022
424 Ga0495618_0102679
425 Ga0495618_0785969
426 Ga0495620_0032891
427 Ga0495630_0047416
428 Ga0495666_0211317
429 Ga0495652_0020536
430 Ga0495652_1017356
431 Ga0495665_0089494
432 Ga0495665_0290340
433 Ga0495640_0896786
434 Ga0495587_0055862
435 Ga0495598_0421981
436 Ga0495621_0514374
437 Ga0495622_0241772
438 Ga0495633_0321144
439 Ga0495656_0058220
440 Ga0495668_0089844
441 Ga0495635_0002226
442 Ga0495599_0185152
443 Ga0495599_0724256
444 Ga0495647_0133248
445 Ga0495613_0317754
446 Ga0495624_0245310
447 Ga0495624_0819024
448 Ga0495670_0373455
449 Ga0495600_0317240
450 Ga0495581_0743080
451 Ga0495636_0114229
452 Ga0495674_1168710
453 Ga0495680_0240520
454 Ga0495680_0242124
455 Ga0495680_0631068
456 Ga0495675_0226527
457 Ga0495593_0134568
458 Ga0496100_1037775
459 Ga0496101_0153523
460 Ga0496101_0713561
461 Ga0496101_0956638
462 Ga0496101_1357026
463 Ga0496102_1347086
464 Ga0496103_0524527
465 Ga0496104_1355590
466 Ga0496105_0009798
467 Ga0496106_1373332
468 Ga0496107_0144715
469 Ga0496109_0158766
470 Ga0496110_0028533
471 Ga0496111_0131343
472 Ga0496111_1010519
473 Ga0496111_1268701
474 Ga0496112_1380944
475 Ga0496113_0535418
476 Ga0496114_1499188
477 Ga0496115_0444213
478 Ga0501042_0451237
479 Ga0501069_0154143
480 Ga0501072_0053598
481 Ga0501080_0871819
482 Ga0501080_1591154
483 Ga0501081_0787502
484 nmdc:mga0yw44_830784_c1
485 nmdc:mga05p37_1060369_c1
486 nmdc:mga05p37_1087474_c1
487 nmdc:mga05p37_112826_c1
488 nmdc:mga05p37_1353441_c1
489 nmdc:mga05p37_2252362_c1
490 nmdc:mga05p37_402658_c1
491 nmdc:mga05p37_471533_c1
492 nmdc:mga05p37_97923_c1
493 nmdc:mga09592_1119758_c1
494 nmdc:mga09592_15924_c1
495 nmdc:mga09592_1724055_c1
496 nmdc:mga09592_513777_c1
497 nmdc:mga09592_601910_c1
498 nmdc:mga0qj67_1060566_c1
499 nmdc:mga0qj67_371720_c1
500 nmdc:mga0qj67_395489_c1
501 nmdc:mga0qj67_488125_c1
502 nmdc:mga0qj67_724714_c1
503 nmdc:mga06r32_1191120_c1
504 nmdc:mga06r32_1198181_c1
505 nmdc:mga06r32_34595_c1
506 nmdc:mga06r32_462304_c1
507 nmdc:mga06r32_64020_c1
508 nmdc:mga06r32_664712_c1
509 nmdc:mga08y16_1074627_c1
510 nmdc:mga08y16_1948099_c1
511 nmdc:mga08y16_74925_c1
512 nmdc:mga0n895_131841_c1
513 nmdc:mga0n895_1604545_c1
514 nmdc:mga0n895_2099171_c1
515 nmdc:mga0n895_480686_c1
516 nmdc:mga0n895_883811_c1
517 nmdc:mga0rr50_101673_c1
518 nmdc:mga0rr50_1048869_c1
519 nmdc:mga0rr50_1199661_c1
520 nmdc:mga0rr50_127264_c1
521 nmdc:mga0rr50_50676_c1
522 nmdc:mga0rr50_550526_c1
523 nmdc:mga08x19_1032951_c1
524 nmdc:mga0a205_1019083_c1
525 nmdc:mga0a205_57630_c1
526 nmdc:mga0a205_863958_c1
527 nmdc:mga0a205_96402_c1
528 Ga0495601_0961022
529 Ga0495612_0104314
530 Ga0495655_0013008
531 Ga0495619_0493358
532 Ga0501082_0259686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map