F373630
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 265 | 194 | 265 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0852321|Ga0501048_0852321_242_550 |
| Length | 102 |
| Sequence | MPAAGFEWDEEKDRLNQQKHGVAFELAQYAVLDAHRVIAEDLSHSSGREQRYYCFGWIDGGVMTVRFTWRQGRIRIFGAGYWRKGKKAYERENKALHRRRDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 128 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 129 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 130 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 133 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 134 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 141 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 145 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 146 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 147 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 148 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 169 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 194 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.38 |
| Nodule | 0 |
| Rhizoplane | 6.04 |
| Rhizosphere | 92.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10253265 | 3300003320 | Bacteria | 1094 |
| 2 | Ga0065707_10274379 | 3300005295 | Bacteria | 1063 |
| 3 | Ga0070676_10089031 | 3300005328 | Bacteria | 1887 |
| 4 | Ga0070683_102240825 | 3300005329 | Unclassified | 524 |
| 5 | Ga0070690_101232208 | 3300005330 | Bacteria | 598 |
| 6 | Ga0070670_101137414 | 3300005331 | Unclassified | 712 |
| 7 | Ga0070670_101191507 | 3300005331 | Bacteria | 696 |
| 8 | Ga0068869_100639256 | 3300005334 | Bacteria | 902 |
| 9 | Ga0068869_101771805 | 3300005334 | Unclassified | 552 |
| 10 | Ga0070666_10094143 | 3300005335 | Bacteria | 2060 |
| 11 | Ga0070680_100426062 | 3300005336 | Bacteria | 1132 |
| 12 | Ga0068868_100590237 | 3300005338 | Bacteria | 983 |
| 13 | Ga0070689_100476003 | 3300005340 | Bacteria | 1066 |
| 14 | Ga0070668_100296192 | 3300005347 | Unclassified | 1355 |
| 15 | Ga0070669_100257794 | 3300005353 | Unclassified | 1390 |
| 16 | Ga0070675_100499102 | 3300005354 | Bacteria | 1096 |
| 17 | Ga0070671_100097650 | 3300005355 | Bacteria | 2463 |
| 18 | Ga0070671_100099744 | 3300005355 | Unclassified | 2436 |
| 19 | Ga0070674_100113473 | 3300005356 | Bacteria | 1994 |
| 20 | Ga0070673_100103007 | 3300005364 | Bacteria | 2354 |
| 21 | Ga0070688_100440356 | 3300005365 | Bacteria | 972 |
| 22 | Ga0070659_100264662 | 3300005366 | Unclassified | 1427 |
| 23 | Ga0070667_100277534 | 3300005367 | Bacteria | 1504 |
| 24 | Ga0070709_10215366 | 3300005434 | Bacteria | 1367 |
| 25 | Ga0070705_100803039 | 3300005440 | Bacteria | 749 |
| 26 | Ga0070694_100224840 | 3300005444 | Bacteria | 1409 |
| 27 | Ga0070708_100008634 | 3300005445 | Bacteria | 8188 |
| 28 | Ga0070708_100063984 | 3300005445 | Bacteria | 3294 |
| 29 | Ga0070678_100067004 | 3300005456 | Bacteria | 2670 |
| 30 | Ga0070662_100162975 | 3300005457 | Bacteria | 1745 |
| 31 | Ga0070681_10033584 | 3300005458 | Bacteria | 5150 |
| 32 | Ga0068867_100164037 | 3300005459 | Bacteria | 1754 |
| 33 | Ga0068867_100610223 | 3300005459 | Bacteria | 953 |
| 34 | Ga0070706_100200376 | 3300005467 | Bacteria | 1865 |
| 35 | Ga0070707_100039642 | 3300005468 | Bacteria | 4503 |
| 36 | Ga0070707_101716902 | 3300005468 | Unclassified | 595 |
| 37 | Ga0068853_101824886 | 3300005539 | Bacteria | 589 |
| 38 | Ga0070672_100270791 | 3300005543 | Bacteria | 1434 |
| 39 | Ga0070686_100427862 | 3300005544 | Bacteria | 1013 |
| 40 | Ga0070695_100565705 | 3300005545 | Unclassified | 888 |
| 41 | Ga0070695_100729950 | 3300005545 | Bacteria | 788 |
| 42 | Ga0070696_100767927 | 3300005546 | Bacteria | 791 |
| 43 | Ga0070696_101158301 | 3300005546 | Bacteria | 652 |
| 44 | Ga0070693_100572498 | 3300005547 | Bacteria | 811 |
| 45 | Ga0070665_100181274 | 3300005548 | Bacteria | 2107 |
| 46 | Ga0070704_100429398 | 3300005549 | Bacteria | 1133 |
| 47 | Ga0070704_101818887 | 3300005549 | Unclassified | 564 |
| 48 | Ga0070702_100159335 | 3300005615 | Unclassified | 1457 |
| 49 | Ga0068852_100557026 | 3300005616 | Bacteria | 1147 |
| 50 | Ga0068859_100873180 | 3300005617 | Bacteria | 985 |
| 51 | Ga0068864_100123984 | 3300005618 | Bacteria | 2313 |
| 52 | Ga0068864_100340860 | 3300005618 | Bacteria | 1412 |
| 53 | Ga0068864_101297699 | 3300005618 | Unclassified | 728 |
| 54 | Ga0068861_101271798 | 3300005719 | Bacteria | 714 |
| 55 | Ga0068863_100231072 | 3300005841 | Unclassified | 1784 |
| 56 | Ga0068863_100932121 | 3300005841 | Bacteria | 869 |
| 57 | Ga0068860_100940904 | 3300005843 | Bacteria | 881 |
| 58 | Ga0068862_100428298 | 3300005844 | Unclassified | 1243 |
| 59 | Ga0068862_101118975 | 3300005844 | Bacteria | 783 |
| 60 | Ga0068871_100669527 | 3300006358 | Bacteria | 949 |
| 61 | Ga0075428_100214037 | 3300006844 | Bacteria | 2082 |
| 62 | Ga0075428_100706040 | 3300006844 | Unclassified | 1074 |
| 63 | Ga0075431_100098123 | 3300006847 | Bacteria | 3025 |
| 64 | Ga0075433_10631228 | 3300006852 | Bacteria | 940 |
| 65 | Ga0075434_100054307 | 3300006871 | Unclassified | 3980 |
| 66 | Ga0075434_100373433 | 3300006871 | Bacteria | 1447 |
| 67 | Ga0075434_101855914 | 3300006871 | Bacteria | 609 |
| 68 | Ga0075429_100133601 | 3300006880 | Bacteria | 2171 |
| 69 | Ga0068865_100151688 | 3300006881 | Bacteria | 1759 |
| 70 | Ga0068865_101487641 | 3300006881 | Bacteria | 606 |
| 71 | Ga0068865_101965209 | 3300006881 | Bacteria | 530 |
| 72 | Ga0097620_100873084 | 3300006931 | Bacteria | 985 |
| 73 | Ga0075435_100117557 | 3300007076 | Bacteria | 2216 |
| 74 | Ga0075435_100816719 | 3300007076 | Bacteria | 812 |
| 75 | Ga0099795_10396261 | 3300007788 | Bacteria | 626 |
| 76 | Ga0111539_10511395 | 3300009094 | Bacteria | 1399 |
| 77 | Ga0105245_11723489 | 3300009098 | Bacteria | 679 |
| 78 | Ga0105245_11834356 | 3300009098 | Bacteria | 659 |
| 79 | Ga0105247_10664611 | 3300009101 | Bacteria | 780 |
| 80 | Ga0105247_11423530 | 3300009101 | Bacteria | 562 |
| 81 | Ga0105243_10874588 | 3300009148 | Bacteria | 892 |
| 82 | Ga0105241_10070770 | 3300009174 | Bacteria | 2707 |
| 83 | Ga0105242_10203635 | 3300009176 | Bacteria | 1759 |
| 84 | Ga0105248_10032681 | 3300009177 | Bacteria | 5812 |
| 85 | Ga0105248_10101192 | 3300009177 | Bacteria | 3248 |
| 86 | Ga0105237_10279249 | 3300009545 | Unclassified | 1673 |
| 87 | Ga0105249_10210292 | 3300009553 | Bacteria | 1909 |
| 88 | Ga0105249_10763128 | 3300009553 | Bacteria | 1030 |
| 89 | Ga0105249_11467539 | 3300009553 | Bacteria | 754 |
| 90 | Ga0105030_125207 | 3300009987 | Unclassified | 547 |
| 91 | Ga0157370_10159247 | 3300013104 | Bacteria | 2101 |
| 92 | Ga0157374_10042941 | 3300013296 | Bacteria | 4174 |
| 93 | Ga0157374_10793459 | 3300013296 | Bacteria | 963 |
| 94 | Ga0157378_10128720 | 3300013297 | Unclassified | 2341 |
| 95 | Ga0157378_11055025 | 3300013297 | Bacteria | 848 |
| 96 | Ga0157378_11215065 | 3300013297 | Unclassified | 793 |
| 97 | Ga0157378_11410326 | 3300013297 | Bacteria | 740 |
| 98 | Ga0163162_10081561 | 3300013306 | Bacteria | 3305 |
| 99 | Ga0163162_10086258 | 3300013306 | Bacteria | 3217 |
| 100 | Ga0163162_10546001 | 3300013306 | Bacteria | 1287 |
| 101 | Ga0157372_13355376 | 3300013307 | Unclassified | 510 |
| 102 | Ga0157375_10504808 | 3300013308 | Bacteria | 1373 |
| 103 | Ga0163163_10449022 | 3300014325 | Bacteria | 1349 |
| 104 | Ga0157380_10154701 | 3300014326 | Bacteria | 1986 |
| 105 | Ga0157380_11221854 | 3300014326 | Unclassified | 796 |
| 106 | Ga0157380_11420422 | 3300014326 | Unclassified | 745 |
| 107 | Ga0157379_10176823 | 3300014968 | Bacteria | 1927 |
| 108 | Ga0157376_10543038 | 3300014969 | Bacteria | 1149 |
| 109 | Ga0213876_10000685 | 3300021384 | Bacteria | 23940 |
| 110 | Ga0207682_10011194 | 3300025893 | Bacteria | 3508 |
| 111 | Ga0207680_10193450 | 3300025903 | Bacteria | 1382 |
| 112 | Ga0207685_10851491 | 3300025905 | Bacteria | 505 |
| 113 | Ga0207699_10284713 | 3300025906 | Bacteria | 1149 |
| 114 | Ga0207645_10119291 | 3300025907 | Unclassified | 1712 |
| 115 | Ga0207684_10148730 | 3300025910 | Bacteria | 2015 |
| 116 | Ga0207654_10293061 | 3300025911 | Bacteria | 1104 |
| 117 | Ga0207707_10038421 | 3300025912 | Bacteria | 4182 |
| 118 | Ga0207660_10081458 | 3300025917 | Bacteria | 2379 |
| 119 | Ga0207660_10331105 | 3300025917 | Bacteria | 1218 |
| 120 | Ga0207646_10056454 | 3300025922 | Bacteria | 3509 |
| 121 | Ga0207681_10229101 | 3300025923 | Unclassified | 1441 |
| 122 | Ga0207650_11089215 | 3300025925 | Unclassified | 680 |
| 123 | Ga0207659_10098964 | 3300025926 | Bacteria | 2194 |
| 124 | Ga0207644_10034534 | 3300025931 | Bacteria | 3539 |
| 125 | Ga0207644_10804852 | 3300025931 | Unclassified | 786 |
| 126 | Ga0207690_10546879 | 3300025932 | Unclassified | 941 |
| 127 | Ga0207686_10136390 | 3300025934 | Bacteria | 1690 |
| 128 | Ga0207709_10534237 | 3300025935 | Unclassified | 920 |
| 129 | Ga0207670_10407905 | 3300025936 | Bacteria | 1088 |
| 130 | Ga0207669_10038657 | 3300025937 | Bacteria | 2750 |
| 131 | Ga0207704_11220323 | 3300025938 | Bacteria | 642 |
| 132 | Ga0207665_11116055 | 3300025939 | Bacteria | 629 |
| 133 | Ga0207691_10050517 | 3300025940 | Bacteria | 3806 |
| 134 | Ga0207691_10639488 | 3300025940 | Unclassified | 899 |
| 135 | Ga0207711_10083550 | 3300025941 | Bacteria | 2794 |
| 136 | Ga0207711_10262666 | 3300025941 | Bacteria | 1587 |
| 137 | Ga0207661_12044523 | 3300025944 | Unclassified | 519 |
| 138 | Ga0207651_10073234 | 3300025960 | Bacteria | 2435 |
| 139 | Ga0207712_10259492 | 3300025961 | Bacteria | 1409 |
| 140 | Ga0207712_11690869 | 3300025961 | Bacteria | 567 |
| 141 | Ga0207668_10169418 | 3300025972 | Bacteria | 1711 |
| 142 | Ga0207658_10165724 | 3300025986 | Bacteria | 1815 |
| 143 | Ga0207703_11462379 | 3300026035 | Bacteria | 657 |
| 144 | Ga0207703_11692013 | 3300026035 | Bacteria | 608 |
| 145 | Ga0207708_10234416 | 3300026075 | Bacteria | 1474 |
| 146 | Ga0207641_10586080 | 3300026088 | Bacteria | 1090 |
| 147 | Ga0207641_11009563 | 3300026088 | Unclassified | 829 |
| 148 | Ga0207648_10125874 | 3300026089 | Bacteria | 2254 |
| 149 | Ga0207648_10573596 | 3300026089 | Bacteria | 1038 |
| 150 | Ga0207676_10087788 | 3300026095 | Bacteria | 2544 |
| 151 | Ga0207676_10576233 | 3300026095 | Bacteria | 1078 |
| 152 | Ga0207683_10100428 | 3300026121 | Bacteria | 2583 |
| 153 | Ga0207698_11599970 | 3300026142 | Bacteria | 667 |
| 154 | Ga0209969_1081363 | 3300027360 | Unclassified | 518 |
| 155 | Ga0209970_1070661 | 3300027614 | Bacteria | 648 |
| 156 | Ga0209983_1143640 | 3300027665 | Bacteria | 546 |
| 157 | Ga0209971_1051307 | 3300027682 | Bacteria | 997 |
| 158 | Ga0209974_10136829 | 3300027876 | Bacteria | 876 |
| 159 | Ga0207428_10236901 | 3300027907 | Bacteria | 1364 |
| 160 | Ga0268266_10340486 | 3300028379 | Bacteria | 1408 |
| 161 | Ga0268265_10165681 | 3300028380 | Bacteria | 1883 |
| 162 | Ga0268265_10174325 | 3300028380 | Bacteria | 1842 |
| 163 | Ga0268264_10608824 | 3300028381 | Bacteria | 1077 |
| 164 | Ga0265320_10000114 | 3300031240 | Bacteria | 69880 |
| 165 | Ga0265339_10521543 | 3300031249 | Unclassified | 548 |
| 166 | Ga0265331_10213271 | 3300031250 | Bacteria | 868 |
| 167 | Ga0265327_10214115 | 3300031251 | Bacteria | 868 |
| 168 | Ga0265316_10885541 | 3300031344 | Bacteria | 624 |
| 169 | Ga0316575_10142735 | 3300031665 | Bacteria | 986 |
| 170 | Ga0316575_10186195 | 3300031665 | Bacteria | 863 |
| 171 | Ga0316579_10098914 | 3300031691 | Bacteria | 1396 |
| 172 | Ga0316576_10893809 | 3300031727 | Bacteria | 636 |
| 173 | Ga0316577_10157503 | 3300031733 | Bacteria | 1281 |
| 174 | Ga0307416_103029887 | 3300032002 | Unclassified | 562 |
| 175 | Ga0307416_103894100 | 3300032002 | Unclassified | 500 |
| 176 | Ga0373938_0063558 | 3300034957 | Bacteria | 868 |
| 177 | Ga0373952_0056895 | 3300035092 | Bacteria | 946 |
| 178 | Ga0373941_0390046 | 3300035115 | Unclassified | 574 |
| 179 | Ga0373961_0252395 | 3300035241 | Bacteria | 639 |
| 180 | Ga0316574_0040152 | 3300035398 | Bacteria | 2880 |
| 181 | Ga0316574_0075491 | 3300035398 | Bacteria | 2135 |
| 182 | Ga0373927_0002981 | 3300035695 | Bacteria | 12280 |
| 183 | Ga0373933_0601351 | 3300035724 | Unclassified | 722 |
| 184 | Ga0373937_0338184 | 3300036401 | Bacteria | 1425 |
| 185 | Ga0316582_0329061 | 3300036647 | Bacteria | 1051 |
| 186 | Ga0316584_0067181 | 3300036712 | Unclassified | 2687 |
| 187 | Ga0395901_0100854 | 3300038443 | Bacteria | 3029 |
| 188 | Ga0436365_0589130 | 3300039437 | Bacteria | 7025 |
| 189 | Ga0436360_0822213 | 3300039438 | Unclassified | 1095 |
| 190 | Ga0439453_0050722 | 3300041408 | Bacteria | 838 |
| 191 | Ga0439442_138832 | 3300042002 | Unclassified | 537 |
| 192 | Ga0450923_011884 | 3300042125 | Unclassified | 1576 |
| 193 | Ga0439446_0198043 | 3300042156 | Unclassified | 677 |
| 194 | Ga0451577_0003746 | 3300042876 | Bacteria | 16574 |
| 195 | Ga0453683_0051350 | 3300044673 | Bacteria | 2583 |
| 196 | Ga0466964_0228409 | 3300044706 | Bacteria | 907 |
| 197 | Ga0453684_0002385 | 3300044712 | Bacteria | 45843 |
| 198 | Ga0453684_0204114 | 3300044712 | Unclassified | 2302 |
| 199 | Ga0453684_0611449 | 3300044712 | Bacteria | 1193 |
| 200 | Ga0453684_2539649 | 3300044712 | Unclassified | 505 |
| 201 | Ga0466957_0306850 | 3300044842 | Bacteria | 1068 |
| 202 | Ga0466959_0104688 | 3300045049 | Bacteria | 2024 |
| 203 | Ga0466967_0319994 | 3300045976 | Unclassified | 1496 |
| 204 | Ga0495662_0674214 | 3300046476 | Unclassified | 504 |
| 205 | Ga0496102_0026777 | 3300048905 | Bacteria | 5147 |
| 206 | Ga0496104_0371714 | 3300048907 | Bacteria | 1342 |
| 207 | Ga0496105_0116100 | 3300048908 | Bacteria | 2208 |
| 208 | Ga0496105_0133219 | 3300048908 | Bacteria | 2048 |
| 209 | Ga0496106_0279138 | 3300048909 | Bacteria | 1338 |
| 210 | Ga0496108_0628164 | 3300048911 | Bacteria | 935 |
| 211 | Ga0496109_0058324 | 3300048912 | Bacteria | 3526 |
| 212 | Ga0496109_0367686 | 3300048912 | Bacteria | 1358 |
| 213 | Ga0496110_0643923 | 3300048913 | Bacteria | 959 |
| 214 | Ga0496111_0127760 | 3300048914 | Bacteria | 1880 |
| 215 | Ga0496111_1046799 | 3300048914 | Bacteria | 583 |
| 216 | Ga0496112_0083242 | 3300048915 | Bacteria | 3164 |
| 217 | Ga0496112_0717165 | 3300048915 | Bacteria | 927 |
| 218 | Ga0496113_0019356 | 3300048916 | Bacteria | 4760 |
| 219 | Ga0496113_1037233 | 3300048916 | Bacteria | 645 |
| 220 | Ga0496115_0493187 | 3300048918 | Bacteria | 985 |
| 221 | Ga0496126_0913405 | 3300048929 | Unclassified | 665 |
| 222 | Ga0501033_0061333 | 3300049570 | Bacteria | 2772 |
| 223 | Ga0501034_0365813 | 3300049571 | Bacteria | 1369 |
| 224 | Ga0501034_1016452 | 3300049571 | Bacteria | 712 |
| 225 | Ga0501034_1189001 | 3300049571 | Bacteria | 641 |
| 226 | Ga0501038_0130235 | 3300049574 | Bacteria | 2066 |
| 227 | Ga0501038_0338712 | 3300049574 | Bacteria | 1173 |
| 228 | Ga0501038_0387955 | 3300049574 | Bacteria | 1082 |
| 229 | Ga0501039_0979777 | 3300049575 | Unclassified | 657 |
| 230 | Ga0501047_0678192 | 3300049581 | Bacteria | 849 |
| 231 | Ga0501048_0852321 | 3300049582 | Bacteria | 655 |
| 232 | Ga0501068_1048600 | 3300049584 | Bacteria | 539 |
| 233 | Ga0501070_0018337 | 3300049586 | Bacteria | 5870 |
| 234 | Ga0501072_0000704 | 3300049588 | Bacteria | 24243 |
| 235 | Ga0501072_0109312 | 3300049588 | Unclassified | 2200 |
| 236 | Ga0501073_0013030 | 3300049589 | Bacteria | 6063 |
| 237 | Ga0501073_0333842 | 3300049589 | Bacteria | 1046 |
| 238 | Ga0501073_0805386 | 3300049589 | Unclassified | 647 |
| 239 | Ga0501075_0220455 | 3300049591 | Bacteria | 1447 |
| 240 | Ga0501076_0510525 | 3300049592 | Bacteria | 991 |
| 241 | Ga0501079_1018577 | 3300049741 | Bacteria | 652 |
| 242 | Ga0501080_0126162 | 3300049742 | Bacteria | 2370 |
| 243 | Ga0501081_0541144 | 3300049743 | Bacteria | 870 |
| 244 | Ga0501081_1295368 | 3300049743 | Unclassified | 552 |
| 245 | Ga0501035_1000522 | 3300049822 | Bacteria | 657 |
| 246 | Ga0501044_0198467 | 3300049823 | Bacteria | 1965 |
| 247 | Ga0501044_0452459 | 3300049823 | Unclassified | 1190 |
| 248 | Ga0501044_0664001 | 3300049823 | Bacteria | 930 |
| 249 | nmdc:mga05p37_222056_c1 | 3300050507 | Viruses | 2280 |
| 250 | nmdc:mga05p37_658044_c1 | 3300050507 | Bacteria | 1172 |
| 251 | nmdc:mga09592_125277_c1 | 3300050508 | Bacteria | 2208 |
| 252 | nmdc:mga09592_138027_c1 | 3300050508 | Bacteria | 2101 |
| 253 | nmdc:mga0qj67_247655_c1 | 3300050509 | Bacteria | 1446 |
| 254 | nmdc:mga06r32_238238_c1 | 3300050510 | Bacteria | 1807 |
| 255 | nmdc:mga06r32_351377_c1 | 3300050510 | Bacteria | 1459 |
| 256 | nmdc:mga06r32_931849_c1 | 3300050510 | Viruses | 824 |
| 257 | nmdc:mga08y16_445088_c1 | 3300050511 | Bacteria | 1322 |
| 258 | nmdc:mga0n895_1049320_c1 | 3300050512 | Bacteria | 794 |
| 259 | nmdc:mga0n895_1874283_c1 | 3300050512 | Unclassified | 559 |
| 260 | nmdc:mga0n895_331573_c1 | 3300050512 | Bacteria | 1542 |
| 261 | nmdc:mga0n895_744200_c1 | 3300050512 | Bacteria | 974 |
| 262 | nmdc:mga0a205_29594_c1 | 3300050515 | Bacteria | 5241 |
| 263 | nmdc:mga0a205_537393_c1 | 3300050515 | Bacteria | 1025 |
| 264 | Ga0500555_068542 | 3300053103 | Bacteria | 940 |
| 265 | Ga0501082_0385702 | 3300060353 | Bacteria | 1223 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025936 | Ga0207670_10407905 | Ga0207670_104079053 | 83 |
| 2 | 3300035241 | Ga0373961_0252395 | Ga0373961_0252395_286_543 | 83 |
| 3 | 3300006881 | Ga0068865_101487641 | Ga0068865_1014876412 | 90 |
| 4 | 3300005334 | Ga0068869_100639256 | Ga0068869_1006392562 | 91 |
| 5 | 3300005366 | Ga0070659_100264662 | Ga0070659_1002646623 | 91 |
| 6 | 3300005457 | Ga0070662_100162975 | Ga0070662_1001629754 | 91 |
| 7 | 3300005539 | Ga0068853_101824886 | Ga0068853_1018248862 | 91 |
| 8 | 3300005545 | Ga0070695_100729950 | Ga0070695_1007299501 | 91 |
| 9 | 3300005841 | Ga0068863_100231072 | Ga0068863_1002310723 | 91 |
| 10 | 3300009101 | Ga0105247_11423530 | Ga0105247_114235302 | 91 |
| 11 | 3300009545 | Ga0105237_10279249 | Ga0105237_102792492 | 91 |
| 12 | 3300013306 | Ga0163162_10081561 | Ga0163162_100815614 | 91 |
| 13 | 3300025932 | Ga0207690_10546879 | Ga0207690_105468792 | 91 |
| 14 | 3300031249 | Ga0265339_10521543 | Ga0265339_105215431 | 91 |
| 15 | 3300046476 | Ga0495662_0674214 | Ga0495662_0674214_197_472 | 91 |
| 16 | 3300048905 | Ga0496102_0026777 | Ga0496102_0026777_4818_5093 | 91 |
| 17 | 3300048907 | Ga0496104_0371714 | Ga0496104_0371714_841_1116 | 91 |
| 18 | 3300048908 | Ga0496105_0116100 | Ga0496105_0116100_643_918 | 91 |
| 19 | 3300048908 | Ga0496105_0133219 | Ga0496105_0133219_1383_1658 | 91 |
| 20 | 3300048909 | Ga0496106_0279138 | Ga0496106_0279138_787_1062 | 91 |
| 21 | 3300048911 | Ga0496108_0628164 | Ga0496108_0628164_480_755 | 91 |
| 22 | 3300048912 | Ga0496109_0058324 | Ga0496109_0058324_18_293 | 91 |
| 23 | 3300048912 | Ga0496109_0367686 | Ga0496109_0367686_242_517 | 91 |
| 24 | 3300048913 | Ga0496110_0643923 | Ga0496110_0643923_340_615 | 91 |
| 25 | 3300048914 | Ga0496111_0127760 | Ga0496111_0127760_1364_1639 | 91 |
| 26 | 3300048914 | Ga0496111_1046799 | Ga0496111_1046799_192_467 | 91 |
| 27 | 3300048915 | Ga0496112_0083242 | Ga0496112_0083242_1079_1354 | 91 |
| 28 | 3300048915 | Ga0496112_0717165 | Ga0496112_0717165_345_620 | 91 |
| 29 | 3300048916 | Ga0496113_0019356 | Ga0496113_0019356_1438_1713 | 91 |
| 30 | 3300048916 | Ga0496113_1037233 | Ga0496113_1037233_348_623 | 91 |
| 31 | 3300048918 | Ga0496115_0493187 | Ga0496115_0493187_699_974 | 91 |
| 32 | 3300005330 | Ga0070690_101232208 | Ga0070690_1012322082 | 92 |
| 33 | 3300005331 | Ga0070670_101191507 | Ga0070670_1011915072 | 92 |
| 34 | 3300005334 | Ga0068869_101771805 | Ga0068869_1017718052 | 92 |
| 35 | 3300005335 | Ga0070666_10094143 | Ga0070666_100941436 | 92 |
| 36 | 3300005336 | Ga0070680_100426062 | Ga0070680_1004260622 | 92 |
| 37 | 3300005338 | Ga0068868_100590237 | Ga0068868_1005902373 | 92 |
| 38 | 3300005340 | Ga0070689_100476003 | Ga0070689_1004760032 | 92 |
| 39 | 3300005354 | Ga0070675_100499102 | Ga0070675_1004991022 | 92 |
| 40 | 3300005355 | Ga0070671_100097650 | Ga0070671_1000976501 | 92 |
| 41 | 3300005356 | Ga0070674_100113473 | Ga0070674_1001134733 | 92 |
| 42 | 3300005364 | Ga0070673_100103007 | Ga0070673_1001030072 | 92 |
| 43 | 3300005365 | Ga0070688_100440356 | Ga0070688_1004403562 | 92 |
| 44 | 3300005367 | Ga0070667_100277534 | Ga0070667_1002775341 | 92 |
| 45 | 3300005434 | Ga0070709_10215366 | Ga0070709_102153662 | 92 |
| 46 | 3300005445 | Ga0070708_100063984 | Ga0070708_1000639842 | 92 |
| 47 | 3300005456 | Ga0070678_100067004 | Ga0070678_1000670042 | 92 |
| 48 | 3300005458 | Ga0070681_10033584 | Ga0070681_100335843 | 92 |
| 49 | 3300005459 | Ga0068867_100164037 | Ga0068867_1001640373 | 92 |
| 50 | 3300005467 | Ga0070706_100200376 | Ga0070706_1002003762 | 92 |
| 51 | 3300005468 | Ga0070707_100039642 | Ga0070707_1000396423 | 92 |
| 52 | 3300005543 | Ga0070672_100270791 | Ga0070672_1002707913 | 92 |
| 53 | 3300005545 | Ga0070695_100565705 | Ga0070695_1005657052 | 92 |
| 54 | 3300005546 | Ga0070696_101158301 | Ga0070696_1011583012 | 92 |
| 55 | 3300005547 | Ga0070693_100572498 | Ga0070693_1005724981 | 92 |
| 56 | 3300005548 | Ga0070665_100181274 | Ga0070665_1001812746 | 92 |
| 57 | 3300005549 | Ga0070704_100429398 | Ga0070704_1004293982 | 92 |
| 58 | 3300005615 | Ga0070702_100159335 | Ga0070702_1001593352 | 92 |
| 59 | 3300005618 | Ga0068864_100123984 | Ga0068864_1001239842 | 92 |
| 60 | 3300005618 | Ga0068864_100340860 | Ga0068864_1003408602 | 92 |
| 61 | 3300005719 | Ga0068861_101271798 | Ga0068861_1012717982 | 92 |
| 62 | 3300005841 | Ga0068863_100932121 | Ga0068863_1009321212 | 92 |
| 63 | 3300005843 | Ga0068860_100940904 | Ga0068860_1009409041 | 92 |
| 64 | 3300005844 | Ga0068862_100428298 | Ga0068862_1004282982 | 92 |
| 65 | 3300006358 | Ga0068871_100669527 | Ga0068871_1006695272 | 92 |
| 66 | 3300006852 | Ga0075433_10631228 | Ga0075433_106312282 | 92 |
| 67 | 3300006871 | Ga0075434_100373433 | Ga0075434_1003734332 | 92 |
| 68 | 3300006881 | Ga0068865_100151688 | Ga0068865_1001516884 | 92 |
| 69 | 3300007076 | Ga0075435_100816719 | Ga0075435_1008167192 | 92 |
| 70 | 3300007788 | Ga0099795_10396261 | Ga0099795_103962612 | 92 |
| 71 | 3300009094 | Ga0111539_10511395 | Ga0111539_105113953 | 92 |
| 72 | 3300009098 | Ga0105245_11834356 | Ga0105245_118343562 | 92 |
| 73 | 3300009101 | Ga0105247_10664611 | Ga0105247_106646113 | 92 |
| 74 | 3300009148 | Ga0105243_10874588 | Ga0105243_108745881 | 92 |
| 75 | 3300009174 | Ga0105241_10070770 | Ga0105241_100707705 | 92 |
| 76 | 3300009176 | Ga0105242_10203635 | Ga0105242_102036354 | 92 |
| 77 | 3300009177 | Ga0105248_10032681 | Ga0105248_1003268110 | 92 |
| 78 | 3300009553 | Ga0105249_10763128 | Ga0105249_107631281 | 92 |
| 79 | 3300013296 | Ga0157374_10793459 | Ga0157374_107934592 | 92 |
| 80 | 3300013297 | Ga0157378_10128720 | Ga0157378_101287203 | 92 |
| 81 | 3300013297 | Ga0157378_11410326 | Ga0157378_114103262 | 92 |
| 82 | 3300013306 | Ga0163162_10086258 | Ga0163162_100862582 | 92 |
| 83 | 3300013307 | Ga0157372_13355376 | Ga0157372_133553762 | 92 |
| 84 | 3300013308 | Ga0157375_10504808 | Ga0157375_105048082 | 92 |
| 85 | 3300014325 | Ga0163163_10449022 | Ga0163163_104490221 | 92 |
| 86 | 3300014326 | Ga0157380_10154701 | Ga0157380_101547014 | 92 |
| 87 | 3300014968 | Ga0157379_10176823 | Ga0157379_101768234 | 92 |
| 88 | 3300014969 | Ga0157376_10543038 | Ga0157376_105430382 | 92 |
| 89 | 3300025893 | Ga0207682_10011194 | Ga0207682_100111941 | 92 |
| 90 | 3300025903 | Ga0207680_10193450 | Ga0207680_101934502 | 92 |
| 91 | 3300025905 | Ga0207685_10851491 | Ga0207685_108514911 | 92 |
| 92 | 3300025906 | Ga0207699_10284713 | Ga0207699_102847132 | 92 |
| 93 | 3300025910 | Ga0207684_10148730 | Ga0207684_101487302 | 92 |
| 94 | 3300025911 | Ga0207654_10293061 | Ga0207654_102930614 | 92 |
| 95 | 3300025912 | Ga0207707_10038421 | Ga0207707_100384214 | 92 |
| 96 | 3300025917 | Ga0207660_10331105 | Ga0207660_103311052 | 92 |
| 97 | 3300025922 | Ga0207646_10056454 | Ga0207646_100564543 | 92 |
| 98 | 3300025926 | Ga0207659_10098964 | Ga0207659_100989646 | 92 |
| 99 | 3300025931 | Ga0207644_10034534 | Ga0207644_100345343 | 92 |
| 100 | 3300025937 | Ga0207669_10038657 | Ga0207669_100386576 | 92 |
| 101 | 3300025940 | Ga0207691_10050517 | Ga0207691_100505172 | 92 |
| 102 | 3300025941 | Ga0207711_10262666 | Ga0207711_102626664 | 92 |
| 103 | 3300025960 | Ga0207651_10073234 | Ga0207651_100732343 | 92 |
| 104 | 3300025986 | Ga0207658_10165724 | Ga0207658_101657244 | 92 |
| 105 | 3300026035 | Ga0207703_11462379 | Ga0207703_114623791 | 92 |
| 106 | 3300026075 | Ga0207708_10234416 | Ga0207708_102344164 | 92 |
| 107 | 3300026088 | Ga0207641_10586080 | Ga0207641_105860802 | 92 |
| 108 | 3300026089 | Ga0207648_10125874 | Ga0207648_101258746 | 92 |
| 109 | 3300026095 | Ga0207676_10087788 | Ga0207676_100877882 | 92 |
| 110 | 3300026095 | Ga0207676_10576233 | Ga0207676_105762333 | 92 |
| 111 | 3300026121 | Ga0207683_10100428 | Ga0207683_101004282 | 92 |
| 112 | 3300027907 | Ga0207428_10236901 | Ga0207428_102369012 | 92 |
| 113 | 3300028379 | Ga0268266_10340486 | Ga0268266_103404864 | 92 |
| 114 | 3300028380 | Ga0268265_10174325 | Ga0268265_101743251 | 92 |
| 115 | 3300028381 | Ga0268264_10608824 | Ga0268264_106088241 | 92 |
| 116 | 3300031250 | Ga0265331_10213271 | Ga0265331_102132712 | 92 |
| 117 | 3300031251 | Ga0265327_10214115 | Ga0265327_102141152 | 92 |
| 118 | 3300049586 | Ga0501070_0018337 | Ga0501070_0018337_51_329 | 92 |
| 119 | 3300049588 | Ga0501072_0000704 | Ga0501072_0000704_1136_1414 | 92 |
| 120 | 3300049589 | Ga0501073_0013030 | Ga0501073_0013030_1390_1668 | 92 |
| 121 | 3300049589 | Ga0501073_0805386 | Ga0501073_0805386_352_630 | 92 |
| 122 | 3300049741 | Ga0501079_1018577 | Ga0501079_1018577_297_575 | 92 |
| 123 | 3300049742 | Ga0501080_0126162 | Ga0501080_0126162_1390_1668 | 92 |
| 124 | 3300049823 | Ga0501044_0664001 | Ga0501044_0664001_610_888 | 92 |
| 125 | 3300050511 | nmdc:mga08y16_445088_c1 | nmdc:mga08y16_445088_c1_401_679 | 92 |
| 126 | 3300005329 | Ga0070683_102240825 | Ga0070683_1022408252 | 93 |
| 127 | 3300005331 | Ga0070670_101137414 | Ga0070670_1011374143 | 93 |
| 128 | 3300005355 | Ga0070671_100099744 | Ga0070671_1000997443 | 93 |
| 129 | 3300005616 | Ga0068852_100557026 | Ga0068852_1005570262 | 93 |
| 130 | 3300005618 | Ga0068864_101297699 | Ga0068864_1012976993 | 93 |
| 131 | 3300009098 | Ga0105245_11723489 | Ga0105245_117234892 | 93 |
| 132 | 3300013104 | Ga0157370_10159247 | Ga0157370_101592473 | 93 |
| 133 | 3300013296 | Ga0157374_10042941 | Ga0157374_100429414 | 93 |
| 134 | 3300013297 | Ga0157378_11055025 | Ga0157378_110550251 | 93 |
| 135 | 3300013297 | Ga0157378_11215065 | Ga0157378_112150652 | 93 |
| 136 | 3300013306 | Ga0163162_10546001 | Ga0163162_105460013 | 93 |
| 137 | 3300021384 | Ga0213876_10000685 | Ga0213876_1000068524 | 93 |
| 138 | 3300025925 | Ga0207650_11089215 | Ga0207650_110892153 | 93 |
| 139 | 3300025931 | Ga0207644_10804852 | Ga0207644_108048523 | 93 |
| 140 | 3300025940 | Ga0207691_10639488 | Ga0207691_106394882 | 93 |
| 141 | 3300025944 | Ga0207661_12044523 | Ga0207661_120445231 | 93 |
| 142 | 3300026035 | Ga0207703_11692013 | Ga0207703_116920131 | 93 |
| 143 | 3300026142 | Ga0207698_11599970 | Ga0207698_115999702 | 93 |
| 144 | 3300031240 | Ga0265320_10000114 | Ga0265320_1000011454 | 93 |
| 145 | 3300031691 | Ga0316579_10098914 | Ga0316579_100989143 | 93 |
| 146 | 3300031727 | Ga0316576_10893809 | Ga0316576_108938092 | 93 |
| 147 | 3300032002 | Ga0307416_103029887 | Ga0307416_1030298872 | 93 |
| 148 | 3300036647 | Ga0316582_0329061 | Ga0316582_0329061_596_877 | 93 |
| 149 | 3300036712 | Ga0316584_0067181 | Ga0316584_0067181_129_410 | 93 |
| 150 | 3300039437 | Ga0436365_0589130 | Ga0436365_0589130_4836_5117 | 93 |
| 151 | 3300041408 | Ga0439453_0050722 | Ga0439453_0050722_152_439 | 93 |
| 152 | 3300045049 | Ga0466959_0104688 | Ga0466959_0104688_648_968 | 93 |
| 153 | 3300048929 | Ga0496126_0913405 | Ga0496126_0913405_157_441 | 93 |
| 154 | 3300049571 | Ga0501034_1016452 | Ga0501034_1016452_86_367 | 93 |
| 155 | 3300049571 | Ga0501034_1189001 | Ga0501034_1189001_211_492 | 93 |
| 156 | 3300049574 | Ga0501038_0387955 | Ga0501038_0387955_540_821 | 93 |
| 157 | 3300049581 | Ga0501047_0678192 | Ga0501047_0678192_338_619 | 93 |
| 158 | 3300049584 | Ga0501068_1048600 | Ga0501068_1048600_216_497 | 93 |
| 159 | 3300049822 | Ga0501035_1000522 | Ga0501035_1000522_365_646 | 93 |
| 160 | 3300049823 | Ga0501044_0198467 | Ga0501044_0198467_1550_1831 | 93 |
| 161 | 3300049823 | Ga0501044_0452459 | Ga0501044_0452459_181_462 | 93 |
| 162 | 3300060353 | Ga0501082_0385702 | Ga0501082_0385702_542_823 | 93 |
| 163 | 3300025961 | Ga0207712_10259492 | Ga0207712_102594922 | 94 |
| 164 | 3300031665 | Ga0316575_10142735 | Ga0316575_101427353 | 94 |
| 165 | 3300035398 | Ga0316574_0040152 | Ga0316574_0040152_838_1122 | 94 |
| 166 | 3300044673 | Ga0453683_0051350 | Ga0453683_0051350_22_306 | 94 |
| 167 | 3300053103 | Ga0500555_068542 | Ga0500555_068542_201_491 | 94 |
| 168 | 3300005295 | Ga0065707_10274379 | Ga0065707_102743792 | 95 |
| 169 | 3300005328 | Ga0070676_10089031 | Ga0070676_100890313 | 95 |
| 170 | 3300005347 | Ga0070668_100296192 | Ga0070668_1002961922 | 95 |
| 171 | 3300005353 | Ga0070669_100257794 | Ga0070669_1002577943 | 95 |
| 172 | 3300005459 | Ga0068867_100610223 | Ga0068867_1006102233 | 95 |
| 173 | 3300005468 | Ga0070707_101716902 | Ga0070707_1017169021 | 95 |
| 174 | 3300005617 | Ga0068859_100873180 | Ga0068859_1008731802 | 95 |
| 175 | 3300005844 | Ga0068862_101118975 | Ga0068862_1011189751 | 95 |
| 176 | 3300006844 | Ga0075428_100706040 | Ga0075428_1007060403 | 95 |
| 177 | 3300006881 | Ga0068865_101965209 | Ga0068865_1019652092 | 95 |
| 178 | 3300006931 | Ga0097620_100873084 | Ga0097620_1008730843 | 95 |
| 179 | 3300009553 | Ga0105249_11467539 | Ga0105249_114675392 | 95 |
| 180 | 3300014326 | Ga0157380_11221854 | Ga0157380_112218541 | 95 |
| 181 | 3300014326 | Ga0157380_11420422 | Ga0157380_114204222 | 95 |
| 182 | 3300025907 | Ga0207645_10119291 | Ga0207645_101192912 | 95 |
| 183 | 3300025923 | Ga0207681_10229101 | Ga0207681_102291012 | 95 |
| 184 | 3300025938 | Ga0207704_11220323 | Ga0207704_112203232 | 95 |
| 185 | 3300025961 | Ga0207712_11690869 | Ga0207712_116908691 | 95 |
| 186 | 3300025972 | Ga0207668_10169418 | Ga0207668_101694182 | 95 |
| 187 | 3300026089 | Ga0207648_10573596 | Ga0207648_105735963 | 95 |
| 188 | 3300027614 | Ga0209970_1070661 | Ga0209970_10706611 | 95 |
| 189 | 3300027665 | Ga0209983_1143640 | Ga0209983_11436401 | 95 |
| 190 | 3300027682 | Ga0209971_1051307 | Ga0209971_10513073 | 95 |
| 191 | 3300027876 | Ga0209974_10136829 | Ga0209974_101368292 | 95 |
| 192 | 3300028380 | Ga0268265_10165681 | Ga0268265_101656813 | 95 |
| 193 | 3300031344 | Ga0265316_10885541 | Ga0265316_108855412 | 95 |
| 194 | 3300031665 | Ga0316575_10186195 | Ga0316575_101861952 | 95 |
| 195 | 3300031733 | Ga0316577_10157503 | Ga0316577_101575034 | 95 |
| 196 | 3300035398 | Ga0316574_0075491 | Ga0316574_0075491_602_889 | 95 |
| 197 | 3300035695 | Ga0373927_0002981 | Ga0373927_0002981_5146_5433 | 95 |
| 198 | 3300035724 | Ga0373933_0601351 | Ga0373933_0601351_405_698 | 95 |
| 199 | 3300036401 | Ga0373937_0338184 | Ga0373937_0338184_403_696 | 95 |
| 200 | 3300038443 | Ga0395901_0100854 | Ga0395901_0100854_2023_2319 | 95 |
| 201 | 3300039438 | Ga0436360_0822213 | Ga0436360_0822213_418_705 | 95 |
| 202 | 3300042002 | Ga0439442_138832 | Ga0439442_138832_231_518 | 95 |
| 203 | 3300042125 | Ga0450923_011884 | Ga0450923_011884_328_615 | 95 |
| 204 | 3300042156 | Ga0439446_0198043 | Ga0439446_0198043_129_416 | 95 |
| 205 | 3300044712 | Ga0453684_0611449 | Ga0453684_0611449_616_903 | 95 |
| 206 | 3300050507 | nmdc:mga05p37_222056_c1 | nmdc:mga05p37_222056_c1_563_850 | 95 |
| 207 | 3300050507 | nmdc:mga05p37_658044_c1 | nmdc:mga05p37_658044_c1_152_439 | 95 |
| 208 | 3300050508 | nmdc:mga09592_138027_c1 | nmdc:mga09592_138027_c1_397_684 | 95 |
| 209 | 3300050509 | nmdc:mga0qj67_247655_c1 | nmdc:mga0qj67_247655_c1_20_307 | 95 |
| 210 | 3300050510 | nmdc:mga06r32_351377_c1 | nmdc:mga06r32_351377_c1_467_754 | 95 |
| 211 | 3300050510 | nmdc:mga06r32_931849_c1 | nmdc:mga06r32_931849_c1_360_647 | 95 |
| 212 | 3300050512 | nmdc:mga0n895_744200_c1 | nmdc:mga0n895_744200_c1_316_603 | 95 |
| 213 | 3300050515 | nmdc:mga0a205_537393_c1 | nmdc:mga0a205_537393_c1_392_679 | 95 |
| 214 | 3300003320 | rootH2_10253265 | rootH2_102532652 | 96 |
| 215 | 3300005440 | Ga0070705_100803039 | Ga0070705_1008030392 | 96 |
| 216 | 3300005444 | Ga0070694_100224840 | Ga0070694_1002248402 | 96 |
| 217 | 3300005445 | Ga0070708_100008634 | Ga0070708_1000086346 | 96 |
| 218 | 3300005544 | Ga0070686_100427862 | Ga0070686_1004278623 | 96 |
| 219 | 3300005546 | Ga0070696_100767927 | Ga0070696_1007679272 | 96 |
| 220 | 3300005549 | Ga0070704_101818887 | Ga0070704_1018188872 | 96 |
| 221 | 3300006844 | Ga0075428_100214037 | Ga0075428_1002140372 | 96 |
| 222 | 3300006847 | Ga0075431_100098123 | Ga0075431_1000981233 | 96 |
| 223 | 3300006871 | Ga0075434_100054307 | Ga0075434_1000543075 | 96 |
| 224 | 3300006871 | Ga0075434_101855914 | Ga0075434_1018559141 | 96 |
| 225 | 3300006880 | Ga0075429_100133601 | Ga0075429_1001336014 | 96 |
| 226 | 3300007076 | Ga0075435_100117557 | Ga0075435_1001175573 | 96 |
| 227 | 3300009177 | Ga0105248_10101192 | Ga0105248_101011923 | 96 |
| 228 | 3300009553 | Ga0105249_10210292 | Ga0105249_102102922 | 96 |
| 229 | 3300009987 | Ga0105030_125207 | Ga0105030_1252071 | 96 |
| 230 | 3300025917 | Ga0207660_10081458 | Ga0207660_100814583 | 96 |
| 231 | 3300025934 | Ga0207686_10136390 | Ga0207686_101363902 | 96 |
| 232 | 3300025935 | Ga0207709_10534237 | Ga0207709_105342372 | 96 |
| 233 | 3300025939 | Ga0207665_11116055 | Ga0207665_111160552 | 96 |
| 234 | 3300025941 | Ga0207711_10083550 | Ga0207711_100835502 | 96 |
| 235 | 3300026088 | Ga0207641_11009563 | Ga0207641_110095632 | 96 |
| 236 | 3300027360 | Ga0209969_1081363 | Ga0209969_10813631 | 96 |
| 237 | 3300032002 | Ga0307416_103894100 | Ga0307416_1038941002 | 96 |
| 238 | 3300034957 | Ga0373938_0063558 | Ga0373938_0063558_294_614 | 96 |
| 239 | 3300035092 | Ga0373952_0056895 | Ga0373952_0056895_601_921 | 96 |
| 240 | 3300035115 | Ga0373941_0390046 | Ga0373941_0390046_185_505 | 96 |
| 241 | 3300042876 | Ga0451577_0003746 | Ga0451577_0003746_11880_12170 | 96 |
| 242 | 3300044706 | Ga0466964_0228409 | Ga0466964_0228409_507_797 | 96 |
| 243 | 3300044712 | Ga0453684_0002385 | Ga0453684_0002385_45258_45548 | 96 |
| 244 | 3300044712 | Ga0453684_0204114 | Ga0453684_0204114_1687_1977 | 96 |
| 245 | 3300044712 | Ga0453684_2539649 | Ga0453684_2539649_143_451 | 96 |
| 246 | 3300044842 | Ga0466957_0306850 | Ga0466957_0306850_201_491 | 96 |
| 247 | 3300045976 | Ga0466967_0319994 | Ga0466967_0319994_326_616 | 96 |
| 248 | 3300049570 | Ga0501033_0061333 | Ga0501033_0061333_659_955 | 96 |
| 249 | 3300049571 | Ga0501034_0365813 | Ga0501034_0365813_726_1025 | 96 |
| 250 | 3300049574 | Ga0501038_0130235 | Ga0501038_0130235_802_1104 | 96 |
| 251 | 3300049574 | Ga0501038_0338712 | Ga0501038_0338712_329_625 | 96 |
| 252 | 3300049575 | Ga0501039_0979777 | Ga0501039_0979777_287_613 | 96 |
| 253 | 3300049582 | Ga0501048_0852321 | Ga0501048_0852321_242_550 | 96 |
| 254 | 3300049588 | Ga0501072_0109312 | Ga0501072_0109312_361_681 | 96 |
| 255 | 3300049589 | Ga0501073_0333842 | Ga0501073_0333842_526_828 | 96 |
| 256 | 3300049591 | Ga0501075_0220455 | Ga0501075_0220455_143_451 | 96 |
| 257 | 3300049592 | Ga0501076_0510525 | Ga0501076_0510525_44_352 | 96 |
| 258 | 3300049743 | Ga0501081_0541144 | Ga0501081_0541144_534_842 | 96 |
| 259 | 3300049743 | Ga0501081_1295368 | Ga0501081_1295368_77_397 | 96 |
| 260 | 3300050508 | nmdc:mga09592_125277_c1 | nmdc:mga09592_125277_c1_1523_1825 | 96 |
| 261 | 3300050510 | nmdc:mga06r32_238238_c1 | nmdc:mga06r32_238238_c1_544_846 | 96 |
| 262 | 3300050512 | nmdc:mga0n895_1049320_c1 | nmdc:mga0n895_1049320_c1_300_620 | 96 |
| 263 | 3300050512 | nmdc:mga0n895_1874283_c1 | nmdc:mga0n895_1874283_c1_26_346 | 96 |
| 264 | 3300050512 | nmdc:mga0n895_331573_c1 | nmdc:mga0n895_331573_c1_887_1207 | 96 |
| 265 | 3300050515 | nmdc:mga0a205_29594_c1 | nmdc:mga0a205_29594_c1_3621_3941 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vd7-assembly1.cif.gz_A | toxin - antitoxin complex from salmonella enterica serovar typhimurium | 0.8456 | 6 | 89 |
| 8x2h-assembly1.cif.gz_A | cryo-em structure of the tcsl at ph 5.0 in its closed conformation | 0.8049 | 44 | 78 |
| 7vd7-assembly1.cif.gz_A | toxin - antitoxin complex from salmonella enterica serovar typhimurium | 0.7546 | 6 | 89 |
| 3akn-assembly1.cif.gz_A | x-ray structure of ifabp from human and rat with bound fluorescent fatty acid analogue | 0.6945 | 33 | 67 |
| 6sth-assembly1.cif.gz_A | highly cationic rsl-r8 in complex with sulfonato-calix[8]arene | 0.6801 | 36 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0X824_63_333_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.7401 | 36 | 75 | 2.120.10.80 |
| af_A8DQW8_64_325_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.7106 | 37 | 83 | 2.120.10.80 |
| af_Q9LU90_53_414_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.7051 | 34 | 81 | 2.120.10.30 |
| af_O44817_4_131_2.60.210.10 | Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | 0.6996 | 33 | 70 | 2.60.210.10 |
| af_Q9NEW7_1_162_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6984 | 38 | 78 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A450TLE9-F1-model_v4 | Uncharacterized protein | 0.9966 | 3 | 96 |
|
| AF-A0A2M7MWX1-F1-model_v4 | BrnT family toxin | 0.9958 | 1 | 77 |
|
| AF-A0A7C2NSA0-F1-model_v4 | BrnT family toxin | 0.9921 | 5 | 94 |
|
| AF-A0A2V5VY70-F1-model_v4 | BrnT family toxin | 0.9905 | 3 | 96 |
|
| AF-A0A849STC1-F1-model_v4 | BrnT family toxin | 0.985 | 5 | 91 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar