F373630

General Info

Members Datasets Scaffolds Average Seq Length
265 194 265 95

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0852321|Ga0501048_0852321_242_550
Length 102
Sequence MPAAGFEWDEEKDRLNQQKHGVAFELAQYAVLDAHRVIAEDLSHSSGREQRYYCFGWIDGGVMTVRFTWRQGRIRIFGAGYWRKGKKAYERENKALHRRRDR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 6.04
Rhizosphere 92.08
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10253265 3300003320 Bacteria 1094
2 Ga0065707_10274379 3300005295 Bacteria 1063
3 Ga0070676_10089031 3300005328 Bacteria 1887
4 Ga0070683_102240825 3300005329 Unclassified 524
5 Ga0070690_101232208 3300005330 Bacteria 598
6 Ga0070670_101137414 3300005331 Unclassified 712
7 Ga0070670_101191507 3300005331 Bacteria 696
8 Ga0068869_100639256 3300005334 Bacteria 902
9 Ga0068869_101771805 3300005334 Unclassified 552
10 Ga0070666_10094143 3300005335 Bacteria 2060
11 Ga0070680_100426062 3300005336 Bacteria 1132
12 Ga0068868_100590237 3300005338 Bacteria 983
13 Ga0070689_100476003 3300005340 Bacteria 1066
14 Ga0070668_100296192 3300005347 Unclassified 1355
15 Ga0070669_100257794 3300005353 Unclassified 1390
16 Ga0070675_100499102 3300005354 Bacteria 1096
17 Ga0070671_100097650 3300005355 Bacteria 2463
18 Ga0070671_100099744 3300005355 Unclassified 2436
19 Ga0070674_100113473 3300005356 Bacteria 1994
20 Ga0070673_100103007 3300005364 Bacteria 2354
21 Ga0070688_100440356 3300005365 Bacteria 972
22 Ga0070659_100264662 3300005366 Unclassified 1427
23 Ga0070667_100277534 3300005367 Bacteria 1504
24 Ga0070709_10215366 3300005434 Bacteria 1367
25 Ga0070705_100803039 3300005440 Bacteria 749
26 Ga0070694_100224840 3300005444 Bacteria 1409
27 Ga0070708_100008634 3300005445 Bacteria 8188
28 Ga0070708_100063984 3300005445 Bacteria 3294
29 Ga0070678_100067004 3300005456 Bacteria 2670
30 Ga0070662_100162975 3300005457 Bacteria 1745
31 Ga0070681_10033584 3300005458 Bacteria 5150
32 Ga0068867_100164037 3300005459 Bacteria 1754
33 Ga0068867_100610223 3300005459 Bacteria 953
34 Ga0070706_100200376 3300005467 Bacteria 1865
35 Ga0070707_100039642 3300005468 Bacteria 4503
36 Ga0070707_101716902 3300005468 Unclassified 595
37 Ga0068853_101824886 3300005539 Bacteria 589
38 Ga0070672_100270791 3300005543 Bacteria 1434
39 Ga0070686_100427862 3300005544 Bacteria 1013
40 Ga0070695_100565705 3300005545 Unclassified 888
41 Ga0070695_100729950 3300005545 Bacteria 788
42 Ga0070696_100767927 3300005546 Bacteria 791
43 Ga0070696_101158301 3300005546 Bacteria 652
44 Ga0070693_100572498 3300005547 Bacteria 811
45 Ga0070665_100181274 3300005548 Bacteria 2107
46 Ga0070704_100429398 3300005549 Bacteria 1133
47 Ga0070704_101818887 3300005549 Unclassified 564
48 Ga0070702_100159335 3300005615 Unclassified 1457
49 Ga0068852_100557026 3300005616 Bacteria 1147
50 Ga0068859_100873180 3300005617 Bacteria 985
51 Ga0068864_100123984 3300005618 Bacteria 2313
52 Ga0068864_100340860 3300005618 Bacteria 1412
53 Ga0068864_101297699 3300005618 Unclassified 728
54 Ga0068861_101271798 3300005719 Bacteria 714
55 Ga0068863_100231072 3300005841 Unclassified 1784
56 Ga0068863_100932121 3300005841 Bacteria 869
57 Ga0068860_100940904 3300005843 Bacteria 881
58 Ga0068862_100428298 3300005844 Unclassified 1243
59 Ga0068862_101118975 3300005844 Bacteria 783
60 Ga0068871_100669527 3300006358 Bacteria 949
61 Ga0075428_100214037 3300006844 Bacteria 2082
62 Ga0075428_100706040 3300006844 Unclassified 1074
63 Ga0075431_100098123 3300006847 Bacteria 3025
64 Ga0075433_10631228 3300006852 Bacteria 940
65 Ga0075434_100054307 3300006871 Unclassified 3980
66 Ga0075434_100373433 3300006871 Bacteria 1447
67 Ga0075434_101855914 3300006871 Bacteria 609
68 Ga0075429_100133601 3300006880 Bacteria 2171
69 Ga0068865_100151688 3300006881 Bacteria 1759
70 Ga0068865_101487641 3300006881 Bacteria 606
71 Ga0068865_101965209 3300006881 Bacteria 530
72 Ga0097620_100873084 3300006931 Bacteria 985
73 Ga0075435_100117557 3300007076 Bacteria 2216
74 Ga0075435_100816719 3300007076 Bacteria 812
75 Ga0099795_10396261 3300007788 Bacteria 626
76 Ga0111539_10511395 3300009094 Bacteria 1399
77 Ga0105245_11723489 3300009098 Bacteria 679
78 Ga0105245_11834356 3300009098 Bacteria 659
79 Ga0105247_10664611 3300009101 Bacteria 780
80 Ga0105247_11423530 3300009101 Bacteria 562
81 Ga0105243_10874588 3300009148 Bacteria 892
82 Ga0105241_10070770 3300009174 Bacteria 2707
83 Ga0105242_10203635 3300009176 Bacteria 1759
84 Ga0105248_10032681 3300009177 Bacteria 5812
85 Ga0105248_10101192 3300009177 Bacteria 3248
86 Ga0105237_10279249 3300009545 Unclassified 1673
87 Ga0105249_10210292 3300009553 Bacteria 1909
88 Ga0105249_10763128 3300009553 Bacteria 1030
89 Ga0105249_11467539 3300009553 Bacteria 754
90 Ga0105030_125207 3300009987 Unclassified 547
91 Ga0157370_10159247 3300013104 Bacteria 2101
92 Ga0157374_10042941 3300013296 Bacteria 4174
93 Ga0157374_10793459 3300013296 Bacteria 963
94 Ga0157378_10128720 3300013297 Unclassified 2341
95 Ga0157378_11055025 3300013297 Bacteria 848
96 Ga0157378_11215065 3300013297 Unclassified 793
97 Ga0157378_11410326 3300013297 Bacteria 740
98 Ga0163162_10081561 3300013306 Bacteria 3305
99 Ga0163162_10086258 3300013306 Bacteria 3217
100 Ga0163162_10546001 3300013306 Bacteria 1287
101 Ga0157372_13355376 3300013307 Unclassified 510
102 Ga0157375_10504808 3300013308 Bacteria 1373
103 Ga0163163_10449022 3300014325 Bacteria 1349
104 Ga0157380_10154701 3300014326 Bacteria 1986
105 Ga0157380_11221854 3300014326 Unclassified 796
106 Ga0157380_11420422 3300014326 Unclassified 745
107 Ga0157379_10176823 3300014968 Bacteria 1927
108 Ga0157376_10543038 3300014969 Bacteria 1149
109 Ga0213876_10000685 3300021384 Bacteria 23940
110 Ga0207682_10011194 3300025893 Bacteria 3508
111 Ga0207680_10193450 3300025903 Bacteria 1382
112 Ga0207685_10851491 3300025905 Bacteria 505
113 Ga0207699_10284713 3300025906 Bacteria 1149
114 Ga0207645_10119291 3300025907 Unclassified 1712
115 Ga0207684_10148730 3300025910 Bacteria 2015
116 Ga0207654_10293061 3300025911 Bacteria 1104
117 Ga0207707_10038421 3300025912 Bacteria 4182
118 Ga0207660_10081458 3300025917 Bacteria 2379
119 Ga0207660_10331105 3300025917 Bacteria 1218
120 Ga0207646_10056454 3300025922 Bacteria 3509
121 Ga0207681_10229101 3300025923 Unclassified 1441
122 Ga0207650_11089215 3300025925 Unclassified 680
123 Ga0207659_10098964 3300025926 Bacteria 2194
124 Ga0207644_10034534 3300025931 Bacteria 3539
125 Ga0207644_10804852 3300025931 Unclassified 786
126 Ga0207690_10546879 3300025932 Unclassified 941
127 Ga0207686_10136390 3300025934 Bacteria 1690
128 Ga0207709_10534237 3300025935 Unclassified 920
129 Ga0207670_10407905 3300025936 Bacteria 1088
130 Ga0207669_10038657 3300025937 Bacteria 2750
131 Ga0207704_11220323 3300025938 Bacteria 642
132 Ga0207665_11116055 3300025939 Bacteria 629
133 Ga0207691_10050517 3300025940 Bacteria 3806
134 Ga0207691_10639488 3300025940 Unclassified 899
135 Ga0207711_10083550 3300025941 Bacteria 2794
136 Ga0207711_10262666 3300025941 Bacteria 1587
137 Ga0207661_12044523 3300025944 Unclassified 519
138 Ga0207651_10073234 3300025960 Bacteria 2435
139 Ga0207712_10259492 3300025961 Bacteria 1409
140 Ga0207712_11690869 3300025961 Bacteria 567
141 Ga0207668_10169418 3300025972 Bacteria 1711
142 Ga0207658_10165724 3300025986 Bacteria 1815
143 Ga0207703_11462379 3300026035 Bacteria 657
144 Ga0207703_11692013 3300026035 Bacteria 608
145 Ga0207708_10234416 3300026075 Bacteria 1474
146 Ga0207641_10586080 3300026088 Bacteria 1090
147 Ga0207641_11009563 3300026088 Unclassified 829
148 Ga0207648_10125874 3300026089 Bacteria 2254
149 Ga0207648_10573596 3300026089 Bacteria 1038
150 Ga0207676_10087788 3300026095 Bacteria 2544
151 Ga0207676_10576233 3300026095 Bacteria 1078
152 Ga0207683_10100428 3300026121 Bacteria 2583
153 Ga0207698_11599970 3300026142 Bacteria 667
154 Ga0209969_1081363 3300027360 Unclassified 518
155 Ga0209970_1070661 3300027614 Bacteria 648
156 Ga0209983_1143640 3300027665 Bacteria 546
157 Ga0209971_1051307 3300027682 Bacteria 997
158 Ga0209974_10136829 3300027876 Bacteria 876
159 Ga0207428_10236901 3300027907 Bacteria 1364
160 Ga0268266_10340486 3300028379 Bacteria 1408
161 Ga0268265_10165681 3300028380 Bacteria 1883
162 Ga0268265_10174325 3300028380 Bacteria 1842
163 Ga0268264_10608824 3300028381 Bacteria 1077
164 Ga0265320_10000114 3300031240 Bacteria 69880
165 Ga0265339_10521543 3300031249 Unclassified 548
166 Ga0265331_10213271 3300031250 Bacteria 868
167 Ga0265327_10214115 3300031251 Bacteria 868
168 Ga0265316_10885541 3300031344 Bacteria 624
169 Ga0316575_10142735 3300031665 Bacteria 986
170 Ga0316575_10186195 3300031665 Bacteria 863
171 Ga0316579_10098914 3300031691 Bacteria 1396
172 Ga0316576_10893809 3300031727 Bacteria 636
173 Ga0316577_10157503 3300031733 Bacteria 1281
174 Ga0307416_103029887 3300032002 Unclassified 562
175 Ga0307416_103894100 3300032002 Unclassified 500
176 Ga0373938_0063558 3300034957 Bacteria 868
177 Ga0373952_0056895 3300035092 Bacteria 946
178 Ga0373941_0390046 3300035115 Unclassified 574
179 Ga0373961_0252395 3300035241 Bacteria 639
180 Ga0316574_0040152 3300035398 Bacteria 2880
181 Ga0316574_0075491 3300035398 Bacteria 2135
182 Ga0373927_0002981 3300035695 Bacteria 12280
183 Ga0373933_0601351 3300035724 Unclassified 722
184 Ga0373937_0338184 3300036401 Bacteria 1425
185 Ga0316582_0329061 3300036647 Bacteria 1051
186 Ga0316584_0067181 3300036712 Unclassified 2687
187 Ga0395901_0100854 3300038443 Bacteria 3029
188 Ga0436365_0589130 3300039437 Bacteria 7025
189 Ga0436360_0822213 3300039438 Unclassified 1095
190 Ga0439453_0050722 3300041408 Bacteria 838
191 Ga0439442_138832 3300042002 Unclassified 537
192 Ga0450923_011884 3300042125 Unclassified 1576
193 Ga0439446_0198043 3300042156 Unclassified 677
194 Ga0451577_0003746 3300042876 Bacteria 16574
195 Ga0453683_0051350 3300044673 Bacteria 2583
196 Ga0466964_0228409 3300044706 Bacteria 907
197 Ga0453684_0002385 3300044712 Bacteria 45843
198 Ga0453684_0204114 3300044712 Unclassified 2302
199 Ga0453684_0611449 3300044712 Bacteria 1193
200 Ga0453684_2539649 3300044712 Unclassified 505
201 Ga0466957_0306850 3300044842 Bacteria 1068
202 Ga0466959_0104688 3300045049 Bacteria 2024
203 Ga0466967_0319994 3300045976 Unclassified 1496
204 Ga0495662_0674214 3300046476 Unclassified 504
205 Ga0496102_0026777 3300048905 Bacteria 5147
206 Ga0496104_0371714 3300048907 Bacteria 1342
207 Ga0496105_0116100 3300048908 Bacteria 2208
208 Ga0496105_0133219 3300048908 Bacteria 2048
209 Ga0496106_0279138 3300048909 Bacteria 1338
210 Ga0496108_0628164 3300048911 Bacteria 935
211 Ga0496109_0058324 3300048912 Bacteria 3526
212 Ga0496109_0367686 3300048912 Bacteria 1358
213 Ga0496110_0643923 3300048913 Bacteria 959
214 Ga0496111_0127760 3300048914 Bacteria 1880
215 Ga0496111_1046799 3300048914 Bacteria 583
216 Ga0496112_0083242 3300048915 Bacteria 3164
217 Ga0496112_0717165 3300048915 Bacteria 927
218 Ga0496113_0019356 3300048916 Bacteria 4760
219 Ga0496113_1037233 3300048916 Bacteria 645
220 Ga0496115_0493187 3300048918 Bacteria 985
221 Ga0496126_0913405 3300048929 Unclassified 665
222 Ga0501033_0061333 3300049570 Bacteria 2772
223 Ga0501034_0365813 3300049571 Bacteria 1369
224 Ga0501034_1016452 3300049571 Bacteria 712
225 Ga0501034_1189001 3300049571 Bacteria 641
226 Ga0501038_0130235 3300049574 Bacteria 2066
227 Ga0501038_0338712 3300049574 Bacteria 1173
228 Ga0501038_0387955 3300049574 Bacteria 1082
229 Ga0501039_0979777 3300049575 Unclassified 657
230 Ga0501047_0678192 3300049581 Bacteria 849
231 Ga0501048_0852321 3300049582 Bacteria 655
232 Ga0501068_1048600 3300049584 Bacteria 539
233 Ga0501070_0018337 3300049586 Bacteria 5870
234 Ga0501072_0000704 3300049588 Bacteria 24243
235 Ga0501072_0109312 3300049588 Unclassified 2200
236 Ga0501073_0013030 3300049589 Bacteria 6063
237 Ga0501073_0333842 3300049589 Bacteria 1046
238 Ga0501073_0805386 3300049589 Unclassified 647
239 Ga0501075_0220455 3300049591 Bacteria 1447
240 Ga0501076_0510525 3300049592 Bacteria 991
241 Ga0501079_1018577 3300049741 Bacteria 652
242 Ga0501080_0126162 3300049742 Bacteria 2370
243 Ga0501081_0541144 3300049743 Bacteria 870
244 Ga0501081_1295368 3300049743 Unclassified 552
245 Ga0501035_1000522 3300049822 Bacteria 657
246 Ga0501044_0198467 3300049823 Bacteria 1965
247 Ga0501044_0452459 3300049823 Unclassified 1190
248 Ga0501044_0664001 3300049823 Bacteria 930
249 nmdc:mga05p37_222056_c1 3300050507 Viruses 2280
250 nmdc:mga05p37_658044_c1 3300050507 Bacteria 1172
251 nmdc:mga09592_125277_c1 3300050508 Bacteria 2208
252 nmdc:mga09592_138027_c1 3300050508 Bacteria 2101
253 nmdc:mga0qj67_247655_c1 3300050509 Bacteria 1446
254 nmdc:mga06r32_238238_c1 3300050510 Bacteria 1807
255 nmdc:mga06r32_351377_c1 3300050510 Bacteria 1459
256 nmdc:mga06r32_931849_c1 3300050510 Viruses 824
257 nmdc:mga08y16_445088_c1 3300050511 Bacteria 1322
258 nmdc:mga0n895_1049320_c1 3300050512 Bacteria 794
259 nmdc:mga0n895_1874283_c1 3300050512 Unclassified 559
260 nmdc:mga0n895_331573_c1 3300050512 Bacteria 1542
261 nmdc:mga0n895_744200_c1 3300050512 Bacteria 974
262 nmdc:mga0a205_29594_c1 3300050515 Bacteria 5241
263 nmdc:mga0a205_537393_c1 3300050515 Bacteria 1025
264 Ga0500555_068542 3300053103 Bacteria 940
265 Ga0501082_0385702 3300060353 Bacteria 1223

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025936 Ga0207670_10407905 Ga0207670_104079053 83
2 3300035241 Ga0373961_0252395 Ga0373961_0252395_286_543 83
3 3300006881 Ga0068865_101487641 Ga0068865_1014876412 90
4 3300005334 Ga0068869_100639256 Ga0068869_1006392562 91
5 3300005366 Ga0070659_100264662 Ga0070659_1002646623 91
6 3300005457 Ga0070662_100162975 Ga0070662_1001629754 91
7 3300005539 Ga0068853_101824886 Ga0068853_1018248862 91
8 3300005545 Ga0070695_100729950 Ga0070695_1007299501 91
9 3300005841 Ga0068863_100231072 Ga0068863_1002310723 91
10 3300009101 Ga0105247_11423530 Ga0105247_114235302 91
11 3300009545 Ga0105237_10279249 Ga0105237_102792492 91
12 3300013306 Ga0163162_10081561 Ga0163162_100815614 91
13 3300025932 Ga0207690_10546879 Ga0207690_105468792 91
14 3300031249 Ga0265339_10521543 Ga0265339_105215431 91
15 3300046476 Ga0495662_0674214 Ga0495662_0674214_197_472 91
16 3300048905 Ga0496102_0026777 Ga0496102_0026777_4818_5093 91
17 3300048907 Ga0496104_0371714 Ga0496104_0371714_841_1116 91
18 3300048908 Ga0496105_0116100 Ga0496105_0116100_643_918 91
19 3300048908 Ga0496105_0133219 Ga0496105_0133219_1383_1658 91
20 3300048909 Ga0496106_0279138 Ga0496106_0279138_787_1062 91
21 3300048911 Ga0496108_0628164 Ga0496108_0628164_480_755 91
22 3300048912 Ga0496109_0058324 Ga0496109_0058324_18_293 91
23 3300048912 Ga0496109_0367686 Ga0496109_0367686_242_517 91
24 3300048913 Ga0496110_0643923 Ga0496110_0643923_340_615 91
25 3300048914 Ga0496111_0127760 Ga0496111_0127760_1364_1639 91
26 3300048914 Ga0496111_1046799 Ga0496111_1046799_192_467 91
27 3300048915 Ga0496112_0083242 Ga0496112_0083242_1079_1354 91
28 3300048915 Ga0496112_0717165 Ga0496112_0717165_345_620 91
29 3300048916 Ga0496113_0019356 Ga0496113_0019356_1438_1713 91
30 3300048916 Ga0496113_1037233 Ga0496113_1037233_348_623 91
31 3300048918 Ga0496115_0493187 Ga0496115_0493187_699_974 91
32 3300005330 Ga0070690_101232208 Ga0070690_1012322082 92
33 3300005331 Ga0070670_101191507 Ga0070670_1011915072 92
34 3300005334 Ga0068869_101771805 Ga0068869_1017718052 92
35 3300005335 Ga0070666_10094143 Ga0070666_100941436 92
36 3300005336 Ga0070680_100426062 Ga0070680_1004260622 92
37 3300005338 Ga0068868_100590237 Ga0068868_1005902373 92
38 3300005340 Ga0070689_100476003 Ga0070689_1004760032 92
39 3300005354 Ga0070675_100499102 Ga0070675_1004991022 92
40 3300005355 Ga0070671_100097650 Ga0070671_1000976501 92
41 3300005356 Ga0070674_100113473 Ga0070674_1001134733 92
42 3300005364 Ga0070673_100103007 Ga0070673_1001030072 92
43 3300005365 Ga0070688_100440356 Ga0070688_1004403562 92
44 3300005367 Ga0070667_100277534 Ga0070667_1002775341 92
45 3300005434 Ga0070709_10215366 Ga0070709_102153662 92
46 3300005445 Ga0070708_100063984 Ga0070708_1000639842 92
47 3300005456 Ga0070678_100067004 Ga0070678_1000670042 92
48 3300005458 Ga0070681_10033584 Ga0070681_100335843 92
49 3300005459 Ga0068867_100164037 Ga0068867_1001640373 92
50 3300005467 Ga0070706_100200376 Ga0070706_1002003762 92
51 3300005468 Ga0070707_100039642 Ga0070707_1000396423 92
52 3300005543 Ga0070672_100270791 Ga0070672_1002707913 92
53 3300005545 Ga0070695_100565705 Ga0070695_1005657052 92
54 3300005546 Ga0070696_101158301 Ga0070696_1011583012 92
55 3300005547 Ga0070693_100572498 Ga0070693_1005724981 92
56 3300005548 Ga0070665_100181274 Ga0070665_1001812746 92
57 3300005549 Ga0070704_100429398 Ga0070704_1004293982 92
58 3300005615 Ga0070702_100159335 Ga0070702_1001593352 92
59 3300005618 Ga0068864_100123984 Ga0068864_1001239842 92
60 3300005618 Ga0068864_100340860 Ga0068864_1003408602 92
61 3300005719 Ga0068861_101271798 Ga0068861_1012717982 92
62 3300005841 Ga0068863_100932121 Ga0068863_1009321212 92
63 3300005843 Ga0068860_100940904 Ga0068860_1009409041 92
64 3300005844 Ga0068862_100428298 Ga0068862_1004282982 92
65 3300006358 Ga0068871_100669527 Ga0068871_1006695272 92
66 3300006852 Ga0075433_10631228 Ga0075433_106312282 92
67 3300006871 Ga0075434_100373433 Ga0075434_1003734332 92
68 3300006881 Ga0068865_100151688 Ga0068865_1001516884 92
69 3300007076 Ga0075435_100816719 Ga0075435_1008167192 92
70 3300007788 Ga0099795_10396261 Ga0099795_103962612 92
71 3300009094 Ga0111539_10511395 Ga0111539_105113953 92
72 3300009098 Ga0105245_11834356 Ga0105245_118343562 92
73 3300009101 Ga0105247_10664611 Ga0105247_106646113 92
74 3300009148 Ga0105243_10874588 Ga0105243_108745881 92
75 3300009174 Ga0105241_10070770 Ga0105241_100707705 92
76 3300009176 Ga0105242_10203635 Ga0105242_102036354 92
77 3300009177 Ga0105248_10032681 Ga0105248_1003268110 92
78 3300009553 Ga0105249_10763128 Ga0105249_107631281 92
79 3300013296 Ga0157374_10793459 Ga0157374_107934592 92
80 3300013297 Ga0157378_10128720 Ga0157378_101287203 92
81 3300013297 Ga0157378_11410326 Ga0157378_114103262 92
82 3300013306 Ga0163162_10086258 Ga0163162_100862582 92
83 3300013307 Ga0157372_13355376 Ga0157372_133553762 92
84 3300013308 Ga0157375_10504808 Ga0157375_105048082 92
85 3300014325 Ga0163163_10449022 Ga0163163_104490221 92
86 3300014326 Ga0157380_10154701 Ga0157380_101547014 92
87 3300014968 Ga0157379_10176823 Ga0157379_101768234 92
88 3300014969 Ga0157376_10543038 Ga0157376_105430382 92
89 3300025893 Ga0207682_10011194 Ga0207682_100111941 92
90 3300025903 Ga0207680_10193450 Ga0207680_101934502 92
91 3300025905 Ga0207685_10851491 Ga0207685_108514911 92
92 3300025906 Ga0207699_10284713 Ga0207699_102847132 92
93 3300025910 Ga0207684_10148730 Ga0207684_101487302 92
94 3300025911 Ga0207654_10293061 Ga0207654_102930614 92
95 3300025912 Ga0207707_10038421 Ga0207707_100384214 92
96 3300025917 Ga0207660_10331105 Ga0207660_103311052 92
97 3300025922 Ga0207646_10056454 Ga0207646_100564543 92
98 3300025926 Ga0207659_10098964 Ga0207659_100989646 92
99 3300025931 Ga0207644_10034534 Ga0207644_100345343 92
100 3300025937 Ga0207669_10038657 Ga0207669_100386576 92
101 3300025940 Ga0207691_10050517 Ga0207691_100505172 92
102 3300025941 Ga0207711_10262666 Ga0207711_102626664 92
103 3300025960 Ga0207651_10073234 Ga0207651_100732343 92
104 3300025986 Ga0207658_10165724 Ga0207658_101657244 92
105 3300026035 Ga0207703_11462379 Ga0207703_114623791 92
106 3300026075 Ga0207708_10234416 Ga0207708_102344164 92
107 3300026088 Ga0207641_10586080 Ga0207641_105860802 92
108 3300026089 Ga0207648_10125874 Ga0207648_101258746 92
109 3300026095 Ga0207676_10087788 Ga0207676_100877882 92
110 3300026095 Ga0207676_10576233 Ga0207676_105762333 92
111 3300026121 Ga0207683_10100428 Ga0207683_101004282 92
112 3300027907 Ga0207428_10236901 Ga0207428_102369012 92
113 3300028379 Ga0268266_10340486 Ga0268266_103404864 92
114 3300028380 Ga0268265_10174325 Ga0268265_101743251 92
115 3300028381 Ga0268264_10608824 Ga0268264_106088241 92
116 3300031250 Ga0265331_10213271 Ga0265331_102132712 92
117 3300031251 Ga0265327_10214115 Ga0265327_102141152 92
118 3300049586 Ga0501070_0018337 Ga0501070_0018337_51_329 92
119 3300049588 Ga0501072_0000704 Ga0501072_0000704_1136_1414 92
120 3300049589 Ga0501073_0013030 Ga0501073_0013030_1390_1668 92
121 3300049589 Ga0501073_0805386 Ga0501073_0805386_352_630 92
122 3300049741 Ga0501079_1018577 Ga0501079_1018577_297_575 92
123 3300049742 Ga0501080_0126162 Ga0501080_0126162_1390_1668 92
124 3300049823 Ga0501044_0664001 Ga0501044_0664001_610_888 92
125 3300050511 nmdc:mga08y16_445088_c1 nmdc:mga08y16_445088_c1_401_679 92
126 3300005329 Ga0070683_102240825 Ga0070683_1022408252 93
127 3300005331 Ga0070670_101137414 Ga0070670_1011374143 93
128 3300005355 Ga0070671_100099744 Ga0070671_1000997443 93
129 3300005616 Ga0068852_100557026 Ga0068852_1005570262 93
130 3300005618 Ga0068864_101297699 Ga0068864_1012976993 93
131 3300009098 Ga0105245_11723489 Ga0105245_117234892 93
132 3300013104 Ga0157370_10159247 Ga0157370_101592473 93
133 3300013296 Ga0157374_10042941 Ga0157374_100429414 93
134 3300013297 Ga0157378_11055025 Ga0157378_110550251 93
135 3300013297 Ga0157378_11215065 Ga0157378_112150652 93
136 3300013306 Ga0163162_10546001 Ga0163162_105460013 93
137 3300021384 Ga0213876_10000685 Ga0213876_1000068524 93
138 3300025925 Ga0207650_11089215 Ga0207650_110892153 93
139 3300025931 Ga0207644_10804852 Ga0207644_108048523 93
140 3300025940 Ga0207691_10639488 Ga0207691_106394882 93
141 3300025944 Ga0207661_12044523 Ga0207661_120445231 93
142 3300026035 Ga0207703_11692013 Ga0207703_116920131 93
143 3300026142 Ga0207698_11599970 Ga0207698_115999702 93
144 3300031240 Ga0265320_10000114 Ga0265320_1000011454 93
145 3300031691 Ga0316579_10098914 Ga0316579_100989143 93
146 3300031727 Ga0316576_10893809 Ga0316576_108938092 93
147 3300032002 Ga0307416_103029887 Ga0307416_1030298872 93
148 3300036647 Ga0316582_0329061 Ga0316582_0329061_596_877 93
149 3300036712 Ga0316584_0067181 Ga0316584_0067181_129_410 93
150 3300039437 Ga0436365_0589130 Ga0436365_0589130_4836_5117 93
151 3300041408 Ga0439453_0050722 Ga0439453_0050722_152_439 93
152 3300045049 Ga0466959_0104688 Ga0466959_0104688_648_968 93
153 3300048929 Ga0496126_0913405 Ga0496126_0913405_157_441 93
154 3300049571 Ga0501034_1016452 Ga0501034_1016452_86_367 93
155 3300049571 Ga0501034_1189001 Ga0501034_1189001_211_492 93
156 3300049574 Ga0501038_0387955 Ga0501038_0387955_540_821 93
157 3300049581 Ga0501047_0678192 Ga0501047_0678192_338_619 93
158 3300049584 Ga0501068_1048600 Ga0501068_1048600_216_497 93
159 3300049822 Ga0501035_1000522 Ga0501035_1000522_365_646 93
160 3300049823 Ga0501044_0198467 Ga0501044_0198467_1550_1831 93
161 3300049823 Ga0501044_0452459 Ga0501044_0452459_181_462 93
162 3300060353 Ga0501082_0385702 Ga0501082_0385702_542_823 93
163 3300025961 Ga0207712_10259492 Ga0207712_102594922 94
164 3300031665 Ga0316575_10142735 Ga0316575_101427353 94
165 3300035398 Ga0316574_0040152 Ga0316574_0040152_838_1122 94
166 3300044673 Ga0453683_0051350 Ga0453683_0051350_22_306 94
167 3300053103 Ga0500555_068542 Ga0500555_068542_201_491 94
168 3300005295 Ga0065707_10274379 Ga0065707_102743792 95
169 3300005328 Ga0070676_10089031 Ga0070676_100890313 95
170 3300005347 Ga0070668_100296192 Ga0070668_1002961922 95
171 3300005353 Ga0070669_100257794 Ga0070669_1002577943 95
172 3300005459 Ga0068867_100610223 Ga0068867_1006102233 95
173 3300005468 Ga0070707_101716902 Ga0070707_1017169021 95
174 3300005617 Ga0068859_100873180 Ga0068859_1008731802 95
175 3300005844 Ga0068862_101118975 Ga0068862_1011189751 95
176 3300006844 Ga0075428_100706040 Ga0075428_1007060403 95
177 3300006881 Ga0068865_101965209 Ga0068865_1019652092 95
178 3300006931 Ga0097620_100873084 Ga0097620_1008730843 95
179 3300009553 Ga0105249_11467539 Ga0105249_114675392 95
180 3300014326 Ga0157380_11221854 Ga0157380_112218541 95
181 3300014326 Ga0157380_11420422 Ga0157380_114204222 95
182 3300025907 Ga0207645_10119291 Ga0207645_101192912 95
183 3300025923 Ga0207681_10229101 Ga0207681_102291012 95
184 3300025938 Ga0207704_11220323 Ga0207704_112203232 95
185 3300025961 Ga0207712_11690869 Ga0207712_116908691 95
186 3300025972 Ga0207668_10169418 Ga0207668_101694182 95
187 3300026089 Ga0207648_10573596 Ga0207648_105735963 95
188 3300027614 Ga0209970_1070661 Ga0209970_10706611 95
189 3300027665 Ga0209983_1143640 Ga0209983_11436401 95
190 3300027682 Ga0209971_1051307 Ga0209971_10513073 95
191 3300027876 Ga0209974_10136829 Ga0209974_101368292 95
192 3300028380 Ga0268265_10165681 Ga0268265_101656813 95
193 3300031344 Ga0265316_10885541 Ga0265316_108855412 95
194 3300031665 Ga0316575_10186195 Ga0316575_101861952 95
195 3300031733 Ga0316577_10157503 Ga0316577_101575034 95
196 3300035398 Ga0316574_0075491 Ga0316574_0075491_602_889 95
197 3300035695 Ga0373927_0002981 Ga0373927_0002981_5146_5433 95
198 3300035724 Ga0373933_0601351 Ga0373933_0601351_405_698 95
199 3300036401 Ga0373937_0338184 Ga0373937_0338184_403_696 95
200 3300038443 Ga0395901_0100854 Ga0395901_0100854_2023_2319 95
201 3300039438 Ga0436360_0822213 Ga0436360_0822213_418_705 95
202 3300042002 Ga0439442_138832 Ga0439442_138832_231_518 95
203 3300042125 Ga0450923_011884 Ga0450923_011884_328_615 95
204 3300042156 Ga0439446_0198043 Ga0439446_0198043_129_416 95
205 3300044712 Ga0453684_0611449 Ga0453684_0611449_616_903 95
206 3300050507 nmdc:mga05p37_222056_c1 nmdc:mga05p37_222056_c1_563_850 95
207 3300050507 nmdc:mga05p37_658044_c1 nmdc:mga05p37_658044_c1_152_439 95
208 3300050508 nmdc:mga09592_138027_c1 nmdc:mga09592_138027_c1_397_684 95
209 3300050509 nmdc:mga0qj67_247655_c1 nmdc:mga0qj67_247655_c1_20_307 95
210 3300050510 nmdc:mga06r32_351377_c1 nmdc:mga06r32_351377_c1_467_754 95
211 3300050510 nmdc:mga06r32_931849_c1 nmdc:mga06r32_931849_c1_360_647 95
212 3300050512 nmdc:mga0n895_744200_c1 nmdc:mga0n895_744200_c1_316_603 95
213 3300050515 nmdc:mga0a205_537393_c1 nmdc:mga0a205_537393_c1_392_679 95
214 3300003320 rootH2_10253265 rootH2_102532652 96
215 3300005440 Ga0070705_100803039 Ga0070705_1008030392 96
216 3300005444 Ga0070694_100224840 Ga0070694_1002248402 96
217 3300005445 Ga0070708_100008634 Ga0070708_1000086346 96
218 3300005544 Ga0070686_100427862 Ga0070686_1004278623 96
219 3300005546 Ga0070696_100767927 Ga0070696_1007679272 96
220 3300005549 Ga0070704_101818887 Ga0070704_1018188872 96
221 3300006844 Ga0075428_100214037 Ga0075428_1002140372 96
222 3300006847 Ga0075431_100098123 Ga0075431_1000981233 96
223 3300006871 Ga0075434_100054307 Ga0075434_1000543075 96
224 3300006871 Ga0075434_101855914 Ga0075434_1018559141 96
225 3300006880 Ga0075429_100133601 Ga0075429_1001336014 96
226 3300007076 Ga0075435_100117557 Ga0075435_1001175573 96
227 3300009177 Ga0105248_10101192 Ga0105248_101011923 96
228 3300009553 Ga0105249_10210292 Ga0105249_102102922 96
229 3300009987 Ga0105030_125207 Ga0105030_1252071 96
230 3300025917 Ga0207660_10081458 Ga0207660_100814583 96
231 3300025934 Ga0207686_10136390 Ga0207686_101363902 96
232 3300025935 Ga0207709_10534237 Ga0207709_105342372 96
233 3300025939 Ga0207665_11116055 Ga0207665_111160552 96
234 3300025941 Ga0207711_10083550 Ga0207711_100835502 96
235 3300026088 Ga0207641_11009563 Ga0207641_110095632 96
236 3300027360 Ga0209969_1081363 Ga0209969_10813631 96
237 3300032002 Ga0307416_103894100 Ga0307416_1038941002 96
238 3300034957 Ga0373938_0063558 Ga0373938_0063558_294_614 96
239 3300035092 Ga0373952_0056895 Ga0373952_0056895_601_921 96
240 3300035115 Ga0373941_0390046 Ga0373941_0390046_185_505 96
241 3300042876 Ga0451577_0003746 Ga0451577_0003746_11880_12170 96
242 3300044706 Ga0466964_0228409 Ga0466964_0228409_507_797 96
243 3300044712 Ga0453684_0002385 Ga0453684_0002385_45258_45548 96
244 3300044712 Ga0453684_0204114 Ga0453684_0204114_1687_1977 96
245 3300044712 Ga0453684_2539649 Ga0453684_2539649_143_451 96
246 3300044842 Ga0466957_0306850 Ga0466957_0306850_201_491 96
247 3300045976 Ga0466967_0319994 Ga0466967_0319994_326_616 96
248 3300049570 Ga0501033_0061333 Ga0501033_0061333_659_955 96
249 3300049571 Ga0501034_0365813 Ga0501034_0365813_726_1025 96
250 3300049574 Ga0501038_0130235 Ga0501038_0130235_802_1104 96
251 3300049574 Ga0501038_0338712 Ga0501038_0338712_329_625 96
252 3300049575 Ga0501039_0979777 Ga0501039_0979777_287_613 96
253 3300049582 Ga0501048_0852321 Ga0501048_0852321_242_550 96
254 3300049588 Ga0501072_0109312 Ga0501072_0109312_361_681 96
255 3300049589 Ga0501073_0333842 Ga0501073_0333842_526_828 96
256 3300049591 Ga0501075_0220455 Ga0501075_0220455_143_451 96
257 3300049592 Ga0501076_0510525 Ga0501076_0510525_44_352 96
258 3300049743 Ga0501081_0541144 Ga0501081_0541144_534_842 96
259 3300049743 Ga0501081_1295368 Ga0501081_1295368_77_397 96
260 3300050508 nmdc:mga09592_125277_c1 nmdc:mga09592_125277_c1_1523_1825 96
261 3300050510 nmdc:mga06r32_238238_c1 nmdc:mga06r32_238238_c1_544_846 96
262 3300050512 nmdc:mga0n895_1049320_c1 nmdc:mga0n895_1049320_c1_300_620 96
263 3300050512 nmdc:mga0n895_1874283_c1 nmdc:mga0n895_1874283_c1_26_346 96
264 3300050512 nmdc:mga0n895_331573_c1 nmdc:mga0n895_331573_c1_887_1207 96
265 3300050515 nmdc:mga0a205_29594_c1 nmdc:mga0a205_29594_c1_3621_3941 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04365

BrnT_toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

8

85

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vd7-assembly1.cif.gz_A toxin - antitoxin complex from salmonella enterica serovar typhimurium 0.8456 6 89
8x2h-assembly1.cif.gz_A cryo-em structure of the tcsl at ph 5.0 in its closed conformation 0.8049 44 78
7vd7-assembly1.cif.gz_A toxin - antitoxin complex from salmonella enterica serovar typhimurium 0.7546 6 89
3akn-assembly1.cif.gz_A x-ray structure of ifabp from human and rat with bound fluorescent fatty acid analogue 0.6945 33 67
6sth-assembly1.cif.gz_A highly cationic rsl-r8 in complex with sulfonato-calix[8]arene 0.6801 36 70
ID Description Score Start End Superfamily
af_A0A0P0X824_63_333_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7401 36 75 2.120.10.80
af_A8DQW8_64_325_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7106 37 83 2.120.10.80
af_Q9LU90_53_414_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7051 34 81 2.120.10.30
af_O44817_4_131_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.6996 33 70 2.60.210.10
af_Q9NEW7_1_162_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6984 38 78 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A450TLE9-F1-model_v4 Uncharacterized protein 0.9966 3 96
AF-A0A2M7MWX1-F1-model_v4 BrnT family toxin 0.9958 1 77
AF-A0A7C2NSA0-F1-model_v4 BrnT family toxin 0.9921 5 94
AF-A0A2V5VY70-F1-model_v4 BrnT family toxin 0.9905 3 96
AF-A0A849STC1-F1-model_v4 BrnT family toxin 0.985 5 91

Feature Viewer

pLDDT pTM Quality
91.97 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map