F372850

General Info

Members Datasets Scaffolds Average Seq Length
264 209 528 130

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_000161|Ga0495687_000161_48809_49225
Length 138
Sequence VTKPTVNASWVWLEEQVVLAVHEEQLAEHGGAPGIRDEGLLRSALARAHNLAAYGEPDAFDLGAAYGYGIARNHPFVDGNKRTAFVAVELFLVLNGVELRASDADCVLTMLSLAAGELDEATFAGWLRRNGAAQTPER

Samples

Sample ID Description Type Environment
1 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
133 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
136 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
141 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.38
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 0
Rhizoplane 0.38
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495687_000161 3300047443 Bacteria 100635
2 Ga0065704_10292124 3300005289 Bacteria 901
3 Ga0070683_100064483 3300005329 Bacteria 3410
4 Ga0070680_100094493 3300005336 Bacteria 2478
5 Ga0070680_100194612 3300005336 Bacteria 1709
6 Ga0070680_100693925 3300005336 Bacteria 876
7 Ga0070682_100015017 3300005337 Bacteria 4483
8 Ga0070689_100752304 3300005340 Unclassified 854
9 Ga0070687_100020859 3300005343 Bacteria 3071
10 Ga0070673_101101943 3300005364 Unclassified 742
11 Ga0070688_100394135 3300005365 Bacteria 1023
12 Ga0070667_100133199 3300005367 Bacteria 2171
13 Ga0070709_10441577 3300005434 Unclassified 979
14 Ga0070709_10460419 3300005434 Bacteria 960
15 Ga0070714_100115097 3300005435 Bacteria 2386
16 Ga0070713_100007913 3300005436 Bacteria 7504
17 Ga0070713_101072921 3300005436 Bacteria 778
18 Ga0070701_10235296 3300005438 Bacteria 1099
19 Ga0070711_100030185 3300005439 Bacteria 3586
20 Ga0070711_100167537 3300005439 Bacteria 1671
21 Ga0070700_100055763 3300005441 Bacteria 2474
22 Ga0070694_100896695 3300005444 Unclassified 732
23 Ga0070663_100026911 3300005455 Bacteria 3900
24 Ga0070662_100950997 3300005457 Bacteria 734
25 Ga0070681_10173252 3300005458 Bacteria 2079
26 Ga0070685_10147833 3300005466 Bacteria 1486
27 Ga0070707_100287152 3300005468 Bacteria 1599
28 Ga0070699_101583833 3300005518 Bacteria 600
29 Ga0070679_100274597 3300005530 Bacteria 1639
30 Ga0070684_100013835 3300005535 Bacteria 6516
31 Ga0070697_100807415 3300005536 Unclassified 830
32 Ga0068853_100371792 3300005539 Bacteria 1333
33 Ga0070696_101299409 3300005546 Unclassified 617
34 Ga0070704_100250454 3300005549 Unclassified 1454
35 Ga0070664_100027007 3300005564 Bacteria 4768
36 Ga0068857_100621973 3300005577 Bacteria 1022
37 Ga0068854_101408499 3300005578 Bacteria 630
38 Ga0068856_100772750 3300005614 Bacteria 980
39 Ga0068864_101053136 3300005618 Bacteria 808
40 Ga0068866_10075887 3300005718 Bacteria 1791
41 Ga0068858_100070149 3300005842 Bacteria 3248
42 Ga0068858_100685812 3300005842 Unclassified 996
43 Ga0068860_100179776 3300005843 Bacteria 2045
44 Ga0068860_100353214 3300005843 Bacteria 1447
45 Ga0068862_100123537 3300005844 Bacteria 2284
46 Ga0081455_10701878 3300005937 Bacteria 644
47 Ga0070717_10008710 3300006028 Bacteria 7591
48 Ga0070717_10036116 3300006028 Bacteria 4005
49 Ga0075365_10071850 3300006038 Bacteria 2330
50 Ga0075368_10126265 3300006042 Bacteria 1062
51 Ga0075363_100084895 3300006048 Bacteria 1736
52 Ga0075364_10121310 3300006051 Bacteria 1750
53 Ga0070716_100090494 3300006173 Bacteria 1851
54 Ga0070716_100431200 3300006173 Bacteria 956
55 Ga0070712_100043884 3300006175 Bacteria 3080
56 Ga0075362_10019296 3300006177 Bacteria 2833
57 Ga0075362_10121733 3300006177 Bacteria 1235
58 Ga0075367_10109276 3300006178 Bacteria 1696
59 Ga0075367_10511848 3300006178 Bacteria 762
60 Ga0075369_10111105 3300006186 Bacteria 1235
61 Ga0075366_10064480 3300006195 Bacteria 2179
62 Ga0075366_10084704 3300006195 Bacteria 1895
63 Ga0075366_10323467 3300006195 Bacteria 945
64 Ga0075370_10000086 3300006353 Bacteria 28513
65 Ga0075370_10137757 3300006353 Bacteria 1426
66 Ga0075370_10186489 3300006353 Bacteria 1221
67 Ga0075370_10409089 3300006353 Bacteria 814
68 Ga0075428_101392298 3300006844 Bacteria 736
69 Ga0075431_100113687 3300006847 Bacteria 2794
70 Ga0075431_100157820 3300006847 Bacteria 2334
71 Ga0075431_100892426 3300006847 Unclassified 859
72 Ga0075429_101300133 3300006880 Bacteria 634
73 Ga0068865_100464242 3300006881 Unclassified 1049
74 Ga0075436_101171651 3300006914 Bacteria 580
75 Ga0099795_10235285 3300007788 Unclassified 785
76 Ga0105240_10038627 3300009093 Bacteria 6122
77 Ga0111539_10047564 3300009094 Bacteria 5127
78 Ga0105247_10078643 3300009101 Unclassified 2075
79 Ga0114129_10325346 3300009147 Bacteria 2043
80 Ga0114129_11812756 3300009147 Bacteria 742
81 Ga0105241_10009732 3300009174 Bacteria 7064
82 Ga0105238_10029336 3300009551 Bacteria 5604
83 Ga0105249_10002209 3300009553 Bacteria 16853
84 Ga0105249_10162354 3300009553 Bacteria 2160
85 Ga0105249_10351030 3300009553 Bacteria 1494
86 Ga0105239_10808829 3300010375 Bacteria 1074
87 Ga0105246_10057758 3300011119 Bacteria 2686
88 Ga0157373_10407139 3300013100 Bacteria 975
89 Ga0157373_10488778 3300013100 Bacteria 888
90 Ga0157371_10564928 3300013102 Bacteria 844
91 Ga0157370_10243473 3300013104 Bacteria 1664
92 Ga0157370_10627800 3300013104 Bacteria 983
93 Ga0157370_11533469 3300013104 Unclassified 599
94 Ga0157375_10090807 3300013308 Bacteria 3114
95 Ga0163163_10473539 3300014325 Bacteria 1313
96 Ga0157380_10843571 3300014326 Unclassified 937
97 Ga0157379_10001602 3300014968 Bacteria 18664
98 Ga0207688_10309062 3300025901 Bacteria 968
99 Ga0207699_10283791 3300025906 Unclassified 1151
100 Ga0207699_10499759 3300025906 Bacteria 878
101 Ga0207654_10083222 3300025911 Bacteria 1932
102 Ga0207707_10508721 3300025912 Bacteria 1026
103 Ga0207663_10200821 3300025916 Bacteria 1438
104 Ga0207660_10210765 3300025917 Bacteria 1521
105 Ga0207660_10302207 3300025917 Bacteria 1274
106 Ga0207660_10309734 3300025917 Bacteria 1259
107 Ga0207662_10054279 3300025918 Bacteria 2389
108 Ga0207649_10537443 3300025920 Bacteria 893
109 Ga0207652_10313140 3300025921 Bacteria 1417
110 Ga0207694_10405949 3300025924 Bacteria 1133
111 Ga0207650_10149880 3300025925 Unclassified 1840
112 Ga0207700_10014753 3300025928 Bacteria 5130
113 Ga0207700_10384401 3300025928 Bacteria 1228
114 Ga0207700_11763695 3300025928 Bacteria 545
115 Ga0207664_10014614 3300025929 Bacteria 5677
116 Ga0207690_10009632 3300025932 Bacteria 5734
117 Ga0207670_10389029 3300025936 Bacteria 1112
118 Ga0207704_10515485 3300025938 Bacteria 966
119 Ga0207665_10407505 3300025939 Bacteria 1036
120 Ga0207665_10428180 3300025939 Bacteria 1012
121 Ga0207661_10281096 3300025944 Bacteria 1487
122 Ga0207679_10788359 3300025945 Unclassified 866
123 Ga0207667_10022721 3300025949 Bacteria 6919
124 Ga0207712_10003092 3300025961 Bacteria 10620
125 Ga0207668_10386892 3300025972 Bacteria 1179
126 Ga0207668_10459664 3300025972 Bacteria 1088
127 Ga0207658_10314755 3300025986 Bacteria 1353
128 Ga0207703_10017810 3300026035 Bacteria 5547
129 Ga0207703_10351884 3300026035 Bacteria 1356
130 Ga0207639_11307226 3300026041 Bacteria 681
131 Ga0207678_10035068 3300026067 Bacteria 4368
132 Ga0207708_10060462 3300026075 Bacteria 2892
133 Ga0207702_10902378 3300026078 Bacteria 876
134 Ga0207648_11912544 3300026089 Unclassified 555
135 Ga0207674_10549942 3300026116 Bacteria 1115
136 Ga0207675_100149790 3300026118 Bacteria 2220
137 Ga0209971_1049820 3300027682 Bacteria 1012
138 Ga0209813_10098724 3300027866 Bacteria 991
139 Ga0209974_10296820 3300027876 Bacteria 617
140 Ga0268264_10048499 3300028381 Bacteria 3533
141 Ga0268264_11355936 3300028381 Bacteria 722
142 Ga0307515_10000180 3300028794 Bacteria 156173
143 Ga0265328_10037197 3300031239 Bacteria 1798
144 Ga0265331_10002391 3300031250 Bacteria 12732
145 Ga0265327_10000309 3300031251 Bacteria 94387
146 Ga0307513_10001087 3300031456 Bacteria 39457
147 Ga0307408_100468433 3300031548 Bacteria 1096
148 Ga0307516_10031348 3300031730 Bacteria 5359
149 Ga0307516_10417882 3300031730 Bacteria 999
150 Ga0373926_0027589 3300035083 Unclassified 1990
151 Ga0373923_0401247 3300035111 Unclassified 660
152 Ga0373936_0031211 3300035113 Unclassified 2104
153 Ga0373954_0439121 3300035118 Bacteria 646
154 Ga0373943_0405611 3300035170 Unclassified 787
155 Ga0373961_0137596 3300035241 Bacteria 823
156 Ga0316574_0063231 3300035398 Unclassified 2327
157 Ga0373935_0674423 3300035692 Bacteria 759
158 Ga0373927_0240770 3300035695 Bacteria 1189
159 Ga0373947_0021599 3300035725 Bacteria 3726
160 Ga0373947_1173809 3300035725 Unclassified 523
161 Ga0373925_0027284 3300037068 Unclassified 4181
162 Ga0395900_0015154 3300037418 Bacteria 7860
163 Ga0395898_0150219 3300037466 Bacteria 2229
164 Ga0395905_0012686 3300037471 Bacteria 8107
165 Ga0395905_0317989 3300037471 Bacteria 1446
166 Ga0395905_0429743 3300037471 Bacteria 1217
167 Ga0395905_0508030 3300037471 Bacteria 1105
168 Ga0395905_1413970 3300037471 Bacteria 600
169 Ga0395901_0488957 3300038443 Bacteria 1254
170 Ga0395901_0593077 3300038443 Unclassified 1118
171 Ga0395901_0667840 3300038443 Bacteria 1040
172 Ga0439436_0111903 3300041404 Bacteria 762
173 Ga0439439_0025920 3300041406 Bacteria 1476
174 Ga0439461_0103736 3300041410 Bacteria 695
175 Ga0451839_1533998 3300041496 Bacteria 673
176 Ga0451841_0632088 3300041498 Bacteria 565
177 Ga0439437_010572 3300042000 Bacteria 1051
178 Ga0439432_047702 3300042006 Bacteria 1343
179 Ga0439449_0036215 3300042007 Bacteria 1835
180 Ga0439462_0003953 3300042015 Bacteria 3589
181 Ga0450914_024683 3300042118 Bacteria 692
182 Ga0450923_007408 3300042125 Bacteria 1856
183 Ga0439446_0225059 3300042156 Bacteria 640
184 Ga0450893_0031680 3300042532 Bacteria 944
185 Ga0451577_0010994 3300042876 Bacteria 8596
186 Ga0466961_0369234 3300044693 Unclassified 872
187 Ga0466963_0345481 3300044694 Bacteria 1048
188 Ga0466963_0400590 3300044694 Unclassified 968
189 Ga0466964_0382222 3300044706 Bacteria 731
190 Ga0453684_0001181 3300044712 Bacteria 80955
191 Ga0453684_0641939 3300044712 Bacteria 1159
192 Ga0466971_0155161 3300044719 Bacteria 1070
193 Ga0466968_0141834 3300044735 Bacteria 1099
194 Ga0451576_0209949 3300045051 Bacteria 2033
195 Ga0451576_0991931 3300045051 Bacteria 880
196 Ga0466958_0125103 3300045836 Bacteria 1612
197 Ga0466958_0328403 3300045836 Bacteria 983
198 Ga0495638_0027128 3300046460 Bacteria 3709
199 Ga0495650_0005014 3300046471 Bacteria 8800
200 Ga0495650_0067875 3300046471 Bacteria 1408
201 Ga0495582_0171795 3300046473 Bacteria 1234
202 Ga0495664_0324073 3300046477 Bacteria 929
203 Ga0495618_0256221 3300046514 Bacteria 1096
204 Ga0495628_0088305 3300046516 Bacteria 2402
205 Ga0495630_0029266 3300046517 Unclassified 4094
206 Ga0495652_0312508 3300046529 Bacteria 1138
207 Ga0495665_0017720 3300046531 Bacteria 3829
208 Ga0495634_0007710 3300046642 Bacteria 8057
209 Ga0495625_0010346 3300046660 Bacteria 7726
210 Ga0495635_0176112 3300046663 Unclassified 1454
211 Ga0495599_0044242 3300046678 Bacteria 2793
212 Ga0495581_0626541 3300047315 Bacteria 622
213 Ga0495674_0846155 3300047319 Bacteria 709
214 Ga0495684_0030906 3300047471 Bacteria 4112
215 Ga0495593_0292375 3300047673 Bacteria 814
216 Ga0496113_0876927 3300048916 Bacteria 711
217 Ga0496122_0192852 3300048925 Bacteria 1200
218 Ga0496123_0032222 3300048926 Bacteria 3799
219 Ga0496124_0000325 3300048927 Bacteria 88310
220 Ga0496124_0000458 3300048927 Bacteria 70719
221 Ga0496124_0303281 3300048927 Bacteria 1152
222 Ga0496125_0039207 3300048928 Bacteria 4083
223 Ga0501034_0165966 3300049571 Bacteria 2176
224 Ga0501036_0210342 3300049572 Bacteria 1634
225 Ga0501037_0158117 3300049573 Bacteria 1616
226 Ga0501038_0069192 3300049574 Bacteria 2999
227 Ga0501043_0159114 3300049579 Bacteria 1765
228 Ga0501046_0084985 3300049580 Bacteria 2440
229 Ga0501047_0109843 3300049581 Bacteria 2640
230 Ga0501048_0715001 3300049582 Bacteria 719
231 Ga0501068_0376518 3300049584 Bacteria 914
232 Ga0501070_0024839 3300049586 Bacteria 5025
233 Ga0501070_0384040 3300049586 Bacteria 1137
234 Ga0501073_0118081 3300049589 Bacteria 1838
235 Ga0501073_0728297 3300049589 Bacteria 684
236 Ga0501074_0331724 3300049590 Bacteria 1080
237 Ga0501080_0051479 3300049742 Bacteria 3831
238 Ga0501044_0315298 3300049823 Bacteria 1489
239 nmdc:mga03683_1926_c1 3300050489 Bacteria 6340
240 nmdc:mga03n38_44290_c1 3300050490 Bacteria 1954
241 nmdc:mga00v17_154787_c1 3300050491 Bacteria 1474
242 nmdc:mga0yw44_69877_c1 3300050492 Bacteria 2176
243 nmdc:mga0k408_181704_c1 3300050493 Bacteria 1255
244 nmdc:mga0k408_558211_c1 3300050493 Bacteria 677
245 nmdc:mga0k408_6208_c1 3300050493 Bacteria 6375
246 nmdc:mga06z11_551669_c1 3300050494 Unclassified 700
247 nmdc:mga04h51_36076_c1 3300050495 Bacteria 1588
248 nmdc:mga07m45_1264_c1 3300050496 Bacteria 11509
249 nmdc:mga07m45_2330_c1 3300050496 Bacteria 8895
250 nmdc:mga07m45_73783_c1 3300050496 Bacteria 1943
251 nmdc:mga05p37_390057_c1 3300050507 Bacteria 1629
252 nmdc:mga06r32_389118_c1 3300050510 Bacteria 1377
253 nmdc:mga06r32_982641_c1 3300050510 Unclassified 797
254 nmdc:mga08y16_132296_c1 3300050511 Bacteria 2593
255 nmdc:mga0n895_213913_c1 3300050512 Bacteria 1957
256 nmdc:mga08x19_303794_c1 3300050514 Bacteria 1108
257 nmdc:mga0sz30_8493_c1 3300050516 Bacteria 3881
258 Ga0495601_0022847 3300053077 Bacteria 3842
259 Ga0495619_0333248 3300053085 Bacteria 1050
260 Ga0501084_0497639 3300054114 Bacteria 1030
261 Ga0587091_230528 3300059511 Bacteria 511
262 Ga0501082_0424174 3300060353 Bacteria 1162
263 Ga0466962_0242979 3300061719 Bacteria 884
264 2879165782 2879163058 Bacteria 4223965
265 Ga0495687_000161
266 Ga0065704_10292124
267 Ga0070683_100064483
268 Ga0070680_100094493
269 Ga0070680_100194612
270 Ga0070680_100693925
271 Ga0070682_100015017
272 Ga0070689_100752304
273 Ga0070687_100020859
274 Ga0070673_101101943
275 Ga0070688_100394135
276 Ga0070667_100133199
277 Ga0070709_10441577
278 Ga0070709_10460419
279 Ga0070714_100115097
280 Ga0070713_100007913
281 Ga0070713_101072921
282 Ga0070701_10235296
283 Ga0070711_100030185
284 Ga0070711_100167537
285 Ga0070700_100055763
286 Ga0070694_100896695
287 Ga0070663_100026911
288 Ga0070662_100950997
289 Ga0070681_10173252
290 Ga0070685_10147833
291 Ga0070707_100287152
292 Ga0070699_101583833
293 Ga0070679_100274597
294 Ga0070684_100013835
295 Ga0070697_100807415
296 Ga0068853_100371792
297 Ga0070696_101299409
298 Ga0070704_100250454
299 Ga0070664_100027007
300 Ga0068857_100621973
301 Ga0068854_101408499
302 Ga0068856_100772750
303 Ga0068864_101053136
304 Ga0068866_10075887
305 Ga0068858_100070149
306 Ga0068858_100685812
307 Ga0068860_100179776
308 Ga0068860_100353214
309 Ga0068862_100123537
310 Ga0081455_10701878
311 Ga0070717_10008710
312 Ga0070717_10036116
313 Ga0075365_10071850
314 Ga0075368_10126265
315 Ga0075363_100084895
316 Ga0075364_10121310
317 Ga0070716_100090494
318 Ga0070716_100431200
319 Ga0070712_100043884
320 Ga0075362_10019296
321 Ga0075362_10121733
322 Ga0075367_10109276
323 Ga0075367_10511848
324 Ga0075369_10111105
325 Ga0075366_10064480
326 Ga0075366_10084704
327 Ga0075366_10323467
328 Ga0075370_10000086
329 Ga0075370_10137757
330 Ga0075370_10186489
331 Ga0075370_10409089
332 Ga0075428_101392298
333 Ga0075431_100113687
334 Ga0075431_100157820
335 Ga0075431_100892426
336 Ga0075429_101300133
337 Ga0068865_100464242
338 Ga0075436_101171651
339 Ga0099795_10235285
340 Ga0105240_10038627
341 Ga0111539_10047564
342 Ga0105247_10078643
343 Ga0114129_10325346
344 Ga0114129_11812756
345 Ga0105241_10009732
346 Ga0105238_10029336
347 Ga0105249_10002209
348 Ga0105249_10162354
349 Ga0105249_10351030
350 Ga0105239_10808829
351 Ga0105246_10057758
352 Ga0157373_10407139
353 Ga0157373_10488778
354 Ga0157371_10564928
355 Ga0157370_10243473
356 Ga0157370_10627800
357 Ga0157370_11533469
358 Ga0157375_10090807
359 Ga0163163_10473539
360 Ga0157380_10843571
361 Ga0157379_10001602
362 Ga0207688_10309062
363 Ga0207699_10283791
364 Ga0207699_10499759
365 Ga0207654_10083222
366 Ga0207707_10508721
367 Ga0207663_10200821
368 Ga0207660_10210765
369 Ga0207660_10302207
370 Ga0207660_10309734
371 Ga0207662_10054279
372 Ga0207649_10537443
373 Ga0207652_10313140
374 Ga0207694_10405949
375 Ga0207650_10149880
376 Ga0207700_10014753
377 Ga0207700_10384401
378 Ga0207700_11763695
379 Ga0207664_10014614
380 Ga0207690_10009632
381 Ga0207670_10389029
382 Ga0207704_10515485
383 Ga0207665_10407505
384 Ga0207665_10428180
385 Ga0207661_10281096
386 Ga0207679_10788359
387 Ga0207667_10022721
388 Ga0207712_10003092
389 Ga0207668_10386892
390 Ga0207668_10459664
391 Ga0207658_10314755
392 Ga0207703_10017810
393 Ga0207703_10351884
394 Ga0207639_11307226
395 Ga0207678_10035068
396 Ga0207708_10060462
397 Ga0207702_10902378
398 Ga0207648_11912544
399 Ga0207674_10549942
400 Ga0207675_100149790
401 Ga0209971_1049820
402 Ga0209813_10098724
403 Ga0209974_10296820
404 Ga0268264_10048499
405 Ga0268264_11355936
406 Ga0307515_10000180
407 Ga0265328_10037197
408 Ga0265331_10002391
409 Ga0265327_10000309
410 Ga0307513_10001087
411 Ga0307408_100468433
412 Ga0307516_10031348
413 Ga0307516_10417882
414 Ga0373926_0027589
415 Ga0373923_0401247
416 Ga0373936_0031211
417 Ga0373954_0439121
418 Ga0373943_0405611
419 Ga0373961_0137596
420 Ga0316574_0063231
421 Ga0373935_0674423
422 Ga0373927_0240770
423 Ga0373947_0021599
424 Ga0373947_1173809
425 Ga0373925_0027284
426 Ga0395900_0015154
427 Ga0395898_0150219
428 Ga0395905_0012686
429 Ga0395905_0317989
430 Ga0395905_0429743
431 Ga0395905_0508030
432 Ga0395905_1413970
433 Ga0395901_0488957
434 Ga0395901_0593077
435 Ga0395901_0667840
436 Ga0439436_0111903
437 Ga0439439_0025920
438 Ga0439461_0103736
439 Ga0451839_1533998
440 Ga0451841_0632088
441 Ga0439437_010572
442 Ga0439432_047702
443 Ga0439449_0036215
444 Ga0439462_0003953
445 Ga0450914_024683
446 Ga0450923_007408
447 Ga0439446_0225059
448 Ga0450893_0031680
449 Ga0451577_0010994
450 Ga0466961_0369234
451 Ga0466963_0345481
452 Ga0466963_0400590
453 Ga0466964_0382222
454 Ga0453684_0001181
455 Ga0453684_0641939
456 Ga0466971_0155161
457 Ga0466968_0141834
458 Ga0451576_0209949
459 Ga0451576_0991931
460 Ga0466958_0125103
461 Ga0466958_0328403
462 Ga0495638_0027128
463 Ga0495650_0005014
464 Ga0495650_0067875
465 Ga0495582_0171795
466 Ga0495664_0324073
467 Ga0495618_0256221
468 Ga0495628_0088305
469 Ga0495630_0029266
470 Ga0495652_0312508
471 Ga0495665_0017720
472 Ga0495634_0007710
473 Ga0495625_0010346
474 Ga0495635_0176112
475 Ga0495599_0044242
476 Ga0495581_0626541
477 Ga0495674_0846155
478 Ga0495684_0030906
479 Ga0495593_0292375
480 Ga0496113_0876927
481 Ga0496122_0192852
482 Ga0496123_0032222
483 Ga0496124_0000325
484 Ga0496124_0000458
485 Ga0496124_0303281
486 Ga0496125_0039207
487 Ga0501034_0165966
488 Ga0501036_0210342
489 Ga0501037_0158117
490 Ga0501038_0069192
491 Ga0501043_0159114
492 Ga0501046_0084985
493 Ga0501047_0109843
494 Ga0501048_0715001
495 Ga0501068_0376518
496 Ga0501070_0024839
497 Ga0501070_0384040
498 Ga0501073_0118081
499 Ga0501073_0728297
500 Ga0501074_0331724
501 Ga0501080_0051479
502 Ga0501044_0315298
503 nmdc:mga03683_1926_c1
504 nmdc:mga03n38_44290_c1
505 nmdc:mga00v17_154787_c1
506 nmdc:mga0yw44_69877_c1
507 nmdc:mga0k408_181704_c1
508 nmdc:mga0k408_558211_c1
509 nmdc:mga0k408_6208_c1
510 nmdc:mga06z11_551669_c1
511 nmdc:mga04h51_36076_c1
512 nmdc:mga07m45_1264_c1
513 nmdc:mga07m45_2330_c1
514 nmdc:mga07m45_73783_c1
515 nmdc:mga05p37_390057_c1
516 nmdc:mga06r32_389118_c1
517 nmdc:mga06r32_982641_c1
518 nmdc:mga08y16_132296_c1
519 nmdc:mga0n895_213913_c1
520 nmdc:mga08x19_303794_c1
521 nmdc:mga0sz30_8493_c1
522 Ga0495601_0022847
523 Ga0495619_0333248
524 Ga0501084_0497639
525 Ga0587091_230528
526 Ga0501082_0424174
527 Ga0466962_0242979
528 2879165782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02661

Fic

Fic/DOC family

12

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dd7-assembly1.cif.gz_A structure of doch66y in complex with the c-terminal domain of phd 0.9196 9 130
3k33-assembly1.cif.gz_A-2 crystal structure of the phd-doc complex 0.9107 9 129
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.9084 9 130
3dd7-assembly1.cif.gz_A structure of doch66y in complex with the c-terminal domain of phd 0.9055 9 130
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.8946 9 130
ID Description Score Start End Superfamily
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.9084 9 130 1.20.120.1870
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.8946 9 130 1.20.120.1870
5jj6B02 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7394 10 128 1.10.3290.10
af_Q54WZ7_1_134_1.10.3290.10 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7089 37 128 1.10.3290.10
3cucA00 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.6864 10 128 1.10.3290.10
ID Description Score Start End GO Terms
AF-T0HSA2-F1-model_v4 Death-on-curing protein 1.001 34 131 GO:0016301
AF-A0A4Q3M3P8-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 1.001 58 132 GO:0016301
AF-A0A527FUN2-F1-model_v4 deleted 1 7 94
AF-A0A3B1BWW1-F1-model_v4 Death on curing protein, Doc toxin 0.9987 7 131 GO:0016301
AF-A0A3B1BS24-F1-model_v4 Death on curing protein, Doc toxin 0.9986 35 131 GO:0016301

Map