F372169

General Info

Members Datasets Scaffolds Average Seq Length
263 184 526 281

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0148643|Ga0501038_0148643_873_1790
Length 305
Sequence VFHPGRRLRPGPPGDPIVFKLLISASQLQDRLTRPGCLVFDVRHSLADHQAGRRAYEQAHIPGALYLDHEQQLCAPRTGRNGRHPLPDLADFSALMCFQGLASDSQVVAYDESGGMFAAHLWWMLRWLGHEAVAVLDGGWAAWQAAGGAVESGSNSPSVSEARAVQSLSPARRPAMPTVDARAVLDNLDAKAFVVVDARAGDRFRGETEPMDPVAGHIPGALNRPFQQNLRADGRFKEPAELRAEFDAVTGGRPASQVVHQCGSGITACHNLFAMELAGLGGSALYPGSWSEWCSDPSRPTAKGA

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
176 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
177 2643221621 Achromobacter sp. Root83 Isolate Unclassified
178 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
179 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
180 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
181 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
182 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
183 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
184 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.55
Nodule 1.14
Rhizoplane 2.28
Rhizosphere 78.33
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0148643 3300049574 Bacteria 1911
2 JGI25151J46595_10006126 3300003187 Bacteria 6104
3 Ga0055529_1001152 3300003763 Bacteria 11088
4 Ga0070658_10073840 3300005327 Bacteria 2797
5 Ga0070658_10084569 3300005327 Bacteria 2608
6 Ga0070677_10023162 3300005333 Bacteria 2297
7 Ga0070666_10053173 3300005335 Bacteria 2731
8 Ga0070680_100026729 3300005336 Bacteria 4616
9 Ga0070668_100026269 3300005347 Bacteria 4417
10 Ga0070669_100015492 3300005353 Bacteria 5434
11 Ga0070675_100128131 3300005354 Bacteria 2161
12 Ga0070675_100256685 3300005354 Bacteria 1531
13 Ga0070671_100032256 3300005355 Bacteria 4332
14 Ga0070671_100056238 3300005355 Bacteria 3274
15 Ga0070671_100126591 3300005355 Bacteria 2151
16 Ga0070674_100086511 3300005356 Bacteria 2252
17 Ga0070673_100053309 3300005364 Bacteria 3176
18 Ga0070714_100146310 3300005435 Bacteria 2126
19 Ga0070663_100011791 3300005455 Bacteria 5503
20 Ga0070663_100371526 3300005455 Bacteria 1162
21 Ga0070678_100078081 3300005456 Bacteria 2500
22 Ga0070681_10007777 3300005458 Bacteria 10479
23 Ga0068867_100031663 3300005459 Bacteria 3821
24 Ga0070672_100011665 3300005543 Bacteria 6135
25 Ga0070672_100043114 3300005543 Bacteria 3477
26 Ga0070704_100042902 3300005549 Bacteria 3132
27 Ga0070704_100396754 3300005549 Bacteria 1176
28 Ga0068855_100639267 3300005563 Bacteria 1144
29 Ga0068857_100080061 3300005577 Bacteria 2917
30 Ga0068854_100055897 3300005578 Bacteria 2843
31 Ga0068856_100279132 3300005614 Bacteria 1687
32 Ga0068852_100000432 3300005616 Bacteria 27854
33 Ga0068852_100001134 3300005616 Bacteria 17618
34 Ga0068864_100215344 3300005618 Bacteria 1770
35 Ga0068851_10006161 3300005834 Bacteria 5471
36 Ga0068858_100002876 3300005842 Bacteria 17308
37 Ga0075365_10072803 3300006038 Bacteria 2315
38 Ga0075364_10004686 3300006051 Bacteria 7890
39 Ga0075364_10017765 3300006051 Bacteria 4447
40 Ga0075364_10298829 3300006051 Bacteria 1096
41 Ga0070712_100360467 3300006175 Bacteria 1192
42 Ga0075362_10003465 3300006177 Bacteria 5521
43 Ga0075367_10037403 3300006178 Bacteria 2820
44 Ga0075367_10040663 3300006178 Bacteria 2715
45 Ga0075366_10000618 3300006195 Bacteria 16716
46 Ga0075366_10026479 3300006195 Bacteria 3397
47 Ga0075366_10162426 3300006195 Bacteria 1354
48 Ga0097621_100042701 3300006237 Bacteria 3653
49 Ga0097621_100191784 3300006237 Bacteria 1770
50 Ga0075370_10000087 3300006353 Bacteria 28459
51 Ga0075370_10002533 3300006353 Bacteria 8490
52 Ga0075434_100024757 3300006871 Bacteria 5870
53 Ga0075434_100112318 3300006871 Bacteria 2736
54 Ga0068865_100192976 3300006881 Bacteria 1577
55 Ga0105240_10166433 3300009093 Bacteria 2614
56 Ga0105245_10200521 3300009098 Bacteria 1916
57 Ga0105245_10524918 3300009098 Bacteria 1203
58 Ga0105243_10142623 3300009148 Bacteria 2046
59 Ga0105242_10073931 3300009176 Bacteria 2835
60 Ga0105239_10010208 3300010375 Bacteria 10520
61 Ga0157373_10156675 3300013100 Bacteria 1602
62 Ga0157378_10056600 3300013297 Bacteria 3495
63 Ga0157375_10168463 3300013308 Bacteria 2337
64 Ga0157380_10264551 3300014326 Bacteria 1564
65 Ga0213872_10011869 3300021361 Bacteria 4114
66 Ga0209677_104848 3300025253 Bacteria 3708
67 Ga0209025_1001428 3300025294 Bacteria 31518
68 Ga0209051_1005529 3300025303 Bacteria 7365
69 Ga0209051_1018846 3300025303 Bacteria 3037
70 Ga0207656_10001144 3300025321 Bacteria 8731
71 Ga0207680_10069061 3300025903 Bacteria 2182
72 Ga0207643_10083092 3300025908 Bacteria 1858
73 Ga0207695_10050268 3300025913 Bacteria 4387
74 Ga0207671_10056108 3300025914 Bacteria 2918
75 Ga0207693_10102428 3300025915 Bacteria 2245
76 Ga0207660_10046426 3300025917 Bacteria 3065
77 Ga0207681_10011935 3300025923 Bacteria 5351
78 Ga0207681_10126102 3300025923 Bacteria 1885
79 Ga0207650_10060640 3300025925 Bacteria 2823
80 Ga0207650_10298690 3300025925 Bacteria 1315
81 Ga0207659_10073367 3300025926 Bacteria 2505
82 Ga0207644_10020211 3300025931 Bacteria 4525
83 Ga0207706_10031371 3300025933 Bacteria 4735
84 Ga0207706_10359866 3300025933 Bacteria 1264
85 Ga0207709_10201626 3300025935 Bacteria 1421
86 Ga0207669_10010106 3300025937 Bacteria 4530
87 Ga0207691_10033900 3300025940 Bacteria 4753
88 Ga0207667_10078403 3300025949 Bacteria 3424
89 Ga0207667_10258223 3300025949 Bacteria 1782
90 Ga0207667_10367939 3300025949 Bacteria 1465
91 Ga0207651_10165034 3300025960 Bacteria 1740
92 Ga0207640_10148296 3300025981 Bacteria 1720
93 Ga0207677_10008163 3300026023 Bacteria 5831
94 Ga0207677_10034054 3300026023 Bacteria 3294
95 Ga0207703_10019651 3300026035 Bacteria 5280
96 Ga0207678_10155497 3300026067 Bacteria 1952
97 Ga0207702_10788354 3300026078 Bacteria 939
98 Ga0207641_10678384 3300026088 Bacteria 1014
99 Ga0207648_10027880 3300026089 Bacteria 5011
100 Ga0207648_10342500 3300026089 Bacteria 1346
101 Ga0207675_100211907 3300026118 Bacteria 1864
102 Ga0207683_10199641 3300026121 Bacteria 1817
103 Ga0207698_10000173 3300026142 Bacteria 40043
104 Ga0207698_10012143 3300026142 Bacteria 5621
105 Ga0209974_10006416 3300027876 Bacteria 4107
106 Ga0268266_10200840 3300028379 Bacteria 1825
107 Ga0268264_10088749 3300028381 Bacteria 2662
108 Ga0268264_10191766 3300028381 Bacteria 1864
109 Ga0307517_10038624 3300028786 Bacteria 5276
110 Ga0307515_10000014 3300028794 Bacteria 562358
111 Ga0307515_10000188 3300028794 Bacteria 151439
112 Ga0265327_10000114 3300031251 Bacteria 174833
113 Ga0265327_10014524 3300031251 Bacteria 5145
114 Ga0307513_10001437 3300031456 Bacteria 34257
115 Ga0307509_10150884 3300031507 Bacteria 2240
116 Ga0316575_10016544 3300031665 Bacteria 2794
117 Ga0265314_10124985 3300031711 Bacteria 1613
118 Ga0316576_10123623 3300031727 Bacteria 1944
119 Ga0316576_10137059 3300031727 Bacteria 1842
120 Ga0316576_10242787 3300031727 Bacteria 1353
121 Ga0307516_10003708 3300031730 Bacteria 19431
122 Ga0307516_10006807 3300031730 Bacteria 13337
123 Ga0307516_10107920 3300031730 Bacteria 2592
124 Ga0307416_100117181 3300032002 Bacteria 2363
125 Ga0307416_100302398 3300032002 Bacteria 1591
126 Ga0307416_100856683 3300032002 Bacteria 1007
127 Ga0307414_10066103 3300032004 Bacteria 2583
128 Ga0316574_0005207 3300035398 Bacteria 6915
129 Ga0316574_0029373 3300035398 Bacteria 3321
130 Ga0316574_0072265 3300035398 Bacteria 2180
131 Ga0373925_0121025 3300037068 Bacteria 2032
132 Ga0373925_0149397 3300037068 Bacteria 1834
133 Ga0395900_0007285 3300037418 Bacteria 11448
134 Ga0395900_0052960 3300037418 Bacteria 4177
135 Ga0395898_0241976 3300037466 Bacteria 1721
136 Ga0395898_0460459 3300037466 Bacteria 1211
137 Ga0395905_0004070 3300037471 Bacteria 15324
138 Ga0395905_0125291 3300037471 Bacteria 2416
139 Ga0395905_0126977 3300037471 Bacteria 2398
140 Ga0395901_0437802 3300038443 Bacteria 1338
141 Ga0436361_0625477 3300039447 Bacteria 2450
142 Ga0436361_0997946 3300039447 Bacteria 2156
143 Ga0439449_0038472 3300042007 Bacteria 1779
144 Ga0466969_0000056 3300044656 Bacteria 59381
145 Ga0466972_0003227 3300044658 Bacteria 8092
146 Ga0466965_0230337 3300044683 Bacteria 989
147 Ga0466961_0161786 3300044693 Bacteria 1395
148 Ga0466964_0009223 3300044706 Bacteria 3710
149 Ga0453684_0493357 3300044712 Bacteria 1357
150 Ga0466968_0049070 3300044735 Bacteria 1797
151 Ga0466970_0054290 3300044765 Bacteria 2140
152 Ga0466959_0056199 3300045049 Bacteria 2872
153 Ga0466959_0117465 3300045049 Bacteria 1893
154 Ga0495650_0005641 3300046471 Bacteria 8048
155 Ga0495639_0029297 3300046475 Bacteria 2443
156 Ga0495583_0000866 3300046506 Bacteria 36795
157 Ga0495606_0005178 3300046507 Bacteria 12612
158 Ga0495620_0027605 3300046515 Bacteria 2654
159 Ga0495632_0004622 3300046519 Bacteria 9321
160 Ga0495643_0135437 3300046522 Bacteria 1233
161 Ga0495621_0014826 3300046539 Bacteria 2475
162 Ga0495597_0037536 3300046542 Bacteria 2175
163 Ga0495633_0090692 3300046558 Bacteria 1421
164 Ga0495668_0046043 3300046616 Bacteria 2424
165 Ga0495625_0008404 3300046660 Bacteria 8813
166 Ga0495670_0086033 3300046691 Unclassified 1605
167 Ga0495649_0004080 3300046694 Bacteria 9608
168 Ga0495649_0006191 3300046694 Bacteria 7471
169 Ga0495660_0012670 3300046810 Bacteria 4893
170 Ga0495636_0021788 3300047318 Bacteria 2588
171 Ga0495687_000500 3300047443 Bacteria 47248
172 Ga0495687_004213 3300047443 Bacteria 9863
173 Ga0495686_0029621 3300047472 Bacteria 3560
174 Ga0496100_0030976 3300048903 Bacteria 3322
175 Ga0496101_0158471 3300048904 Bacteria 1735
176 Ga0496104_0070925 3300048907 Bacteria 3313
177 Ga0496108_0258814 3300048911 Bacteria 1514
178 Ga0496110_0008129 3300048913 Bacteria 8428
179 Ga0496114_0011066 3300048917 Bacteria 7198
180 Ga0496121_0128802 3300048924 Bacteria 1898
181 Ga0496124_0000123 3300048927 Bacteria 161106
182 Ga0496125_0004092 3300048928 Bacteria 17061
183 Ga0501031_0324054 3300049568 Bacteria 998
184 Ga0501033_0017468 3300049570 Bacteria 5420
185 Ga0501033_0045531 3300049570 Bacteria 3265
186 Ga0501034_0000188 3300049571 Bacteria 115935
187 Ga0501034_0075702 3300049571 Bacteria 3372
188 Ga0501034_0211950 3300049571 Bacteria 1892
189 Ga0501036_0059633 3300049572 Bacteria 3233
190 Ga0501036_0499356 3300049572 Bacteria 1012
191 Ga0501037_0001437 3300049573 Bacteria 17483
192 Ga0501038_0092427 3300049574 Bacteria 2533
193 Ga0501038_0099846 3300049574 Bacteria 2419
194 Ga0501039_0212962 3300049575 Bacteria 1519
195 Ga0501041_0018896 3300049577 Bacteria 4105
196 Ga0501042_0004940 3300049578 Bacteria 8538
197 Ga0501042_0234110 3300049578 Bacteria 1325
198 Ga0501043_0000149 3300049579 Bacteria 65122
199 Ga0501043_0117445 3300049579 Bacteria 2087
200 Ga0501046_0000092 3300049580 Bacteria 97456
201 Ga0501047_0000028 3300049581 Bacteria 220279
202 Ga0501047_0003646 3300049581 Bacteria 14511
203 Ga0501047_0075277 3300049581 Bacteria 3248
204 Ga0501048_0009579 3300049582 Bacteria 7271
205 Ga0501048_0049330 3300049582 Bacteria 3000
206 Ga0501048_0204166 3300049582 Bacteria 1401
207 Ga0501070_0000609 3300049586 Bacteria 32789
208 Ga0501071_0005029 3300049587 Bacteria 8454
209 Ga0501072_0013286 3300049588 Bacteria 6304
210 Ga0501072_0336367 3300049588 Bacteria 1199
211 Ga0501074_0022525 3300049590 Bacteria 4577
212 Ga0501074_0098993 3300049590 Bacteria 2087
213 Ga0501075_0001026 3300049591 Bacteria 17906
214 Ga0501075_0054876 3300049591 Bacteria 2998
215 Ga0501076_0000823 3300049592 Bacteria 20155
216 Ga0501076_0016260 3300049592 Bacteria 5638
217 Ga0501077_0083629 3300049593 Bacteria 2023
218 Ga0501079_0001634 3300049741 Bacteria 15962
219 Ga0501079_0002741 3300049741 Bacteria 12841
220 Ga0501080_0007919 3300049742 Bacteria 9625
221 Ga0501080_0029929 3300049742 Bacteria 5069
222 Ga0501080_0079226 3300049742 Bacteria 3054
223 Ga0501080_0130318 3300049742 Bacteria 2328
224 Ga0501081_0027047 3300049743 Bacteria 3871
225 Ga0501083_0004566 3300049744 Bacteria 9778
226 Ga0501083_0124825 3300049744 Bacteria 1688
227 Ga0501035_0003371 3300049822 Bacteria 15293
228 Ga0501035_0011429 3300049822 Bacteria 8231
229 Ga0501035_0013582 3300049822 Bacteria 7514
230 Ga0501044_0000126 3300049823 Bacteria 92879
231 Ga0501044_0002292 3300049823 Bacteria 21797
232 Ga0501044_0012843 3300049823 Bacteria 9067
233 Ga0501045_0000170 3300049824 Bacteria 35617
234 Ga0501045_0003259 3300049824 Bacteria 11087
235 nmdc:mga0k408_194166_c1 3300050493 Bacteria 1212
236 nmdc:mga0k408_4604_c1 3300050493 Bacteria 7314
237 nmdc:mga0k408_5230_c1 3300050493 Bacteria 6888
238 nmdc:mga0k408_62092_c2 3300050493 Bacteria 1385
239 nmdc:mga06z11_101535_c1 3300050494 Bacteria 1579
240 nmdc:mga06z11_104977_c1 3300050494 Bacteria 1556
241 nmdc:mga07m45_51857_c1 3300050496 Bacteria 2315
242 nmdc:mga07m45_67_c1 3300050496 Bacteria 40608
243 nmdc:mga07m45_77535_c1 3300050496 Bacteria 1896
244 Ga0500643_000094 3300053087 Bacteria 93181
245 Ga0500559_0002842 3300053136 Bacteria 8747
246 Ga0500564_095216 3300053138 Bacteria 1322
247 Ga0500568_0011155 3300053139 Bacteria 4184
248 Ga0500589_042417 3300053147 Bacteria 2122
249 Ga0500636_0014675 3300053177 Bacteria 4608
250 Ga0501084_0013512 3300054114 Bacteria 6757
251 Ga0501082_0001772 3300060353 Bacteria 18993
252 Ga0501082_0106916 3300060353 Bacteria 2420
253 Ga0530510_0001520 3300061734 Bacteria 15616
254 2513955883 2513237150 Bacteria 6553639
255 2514045638 2513237165 Bacteria 6771773
256 2644119963 2643221621 Bacteria 6212786
257 2739611001 2739367655 Bacteria 4051151
258 2857547234 2857542790 Bacteria 5326616
259 2881929353 2881927736 Bacteria 3993927
260 2887380346 2887375801 Bacteria 5334027
261 644748556 644736347 Bacteria 6476522
262 8002393438 8002392321 Bacteria 4159911
263 8048748892 8048746797 Bacteria 3557226
264 Ga0501038_0148643
265 JGI25151J46595_10006126
266 Ga0055529_1001152
267 Ga0070658_10073840
268 Ga0070658_10084569
269 Ga0070677_10023162
270 Ga0070666_10053173
271 Ga0070680_100026729
272 Ga0070668_100026269
273 Ga0070669_100015492
274 Ga0070675_100128131
275 Ga0070675_100256685
276 Ga0070671_100032256
277 Ga0070671_100056238
278 Ga0070671_100126591
279 Ga0070674_100086511
280 Ga0070673_100053309
281 Ga0070714_100146310
282 Ga0070663_100011791
283 Ga0070663_100371526
284 Ga0070678_100078081
285 Ga0070681_10007777
286 Ga0068867_100031663
287 Ga0070672_100011665
288 Ga0070672_100043114
289 Ga0070704_100042902
290 Ga0070704_100396754
291 Ga0068855_100639267
292 Ga0068857_100080061
293 Ga0068854_100055897
294 Ga0068856_100279132
295 Ga0068852_100000432
296 Ga0068852_100001134
297 Ga0068864_100215344
298 Ga0068851_10006161
299 Ga0068858_100002876
300 Ga0075365_10072803
301 Ga0075364_10004686
302 Ga0075364_10017765
303 Ga0075364_10298829
304 Ga0070712_100360467
305 Ga0075362_10003465
306 Ga0075367_10037403
307 Ga0075367_10040663
308 Ga0075366_10000618
309 Ga0075366_10026479
310 Ga0075366_10162426
311 Ga0097621_100042701
312 Ga0097621_100191784
313 Ga0075370_10000087
314 Ga0075370_10002533
315 Ga0075434_100024757
316 Ga0075434_100112318
317 Ga0068865_100192976
318 Ga0105240_10166433
319 Ga0105245_10200521
320 Ga0105245_10524918
321 Ga0105243_10142623
322 Ga0105242_10073931
323 Ga0105239_10010208
324 Ga0157373_10156675
325 Ga0157378_10056600
326 Ga0157375_10168463
327 Ga0157380_10264551
328 Ga0213872_10011869
329 Ga0209677_104848
330 Ga0209025_1001428
331 Ga0209051_1005529
332 Ga0209051_1018846
333 Ga0207656_10001144
334 Ga0207680_10069061
335 Ga0207643_10083092
336 Ga0207695_10050268
337 Ga0207671_10056108
338 Ga0207693_10102428
339 Ga0207660_10046426
340 Ga0207681_10011935
341 Ga0207681_10126102
342 Ga0207650_10060640
343 Ga0207650_10298690
344 Ga0207659_10073367
345 Ga0207644_10020211
346 Ga0207706_10031371
347 Ga0207706_10359866
348 Ga0207709_10201626
349 Ga0207669_10010106
350 Ga0207691_10033900
351 Ga0207667_10078403
352 Ga0207667_10258223
353 Ga0207667_10367939
354 Ga0207651_10165034
355 Ga0207640_10148296
356 Ga0207677_10008163
357 Ga0207677_10034054
358 Ga0207703_10019651
359 Ga0207678_10155497
360 Ga0207702_10788354
361 Ga0207641_10678384
362 Ga0207648_10027880
363 Ga0207648_10342500
364 Ga0207675_100211907
365 Ga0207683_10199641
366 Ga0207698_10000173
367 Ga0207698_10012143
368 Ga0209974_10006416
369 Ga0268266_10200840
370 Ga0268264_10088749
371 Ga0268264_10191766
372 Ga0307517_10038624
373 Ga0307515_10000014
374 Ga0307515_10000188
375 Ga0265327_10000114
376 Ga0265327_10014524
377 Ga0307513_10001437
378 Ga0307509_10150884
379 Ga0316575_10016544
380 Ga0265314_10124985
381 Ga0316576_10123623
382 Ga0316576_10137059
383 Ga0316576_10242787
384 Ga0307516_10003708
385 Ga0307516_10006807
386 Ga0307516_10107920
387 Ga0307416_100117181
388 Ga0307416_100302398
389 Ga0307416_100856683
390 Ga0307414_10066103
391 Ga0316574_0005207
392 Ga0316574_0029373
393 Ga0316574_0072265
394 Ga0373925_0121025
395 Ga0373925_0149397
396 Ga0395900_0007285
397 Ga0395900_0052960
398 Ga0395898_0241976
399 Ga0395898_0460459
400 Ga0395905_0004070
401 Ga0395905_0125291
402 Ga0395905_0126977
403 Ga0395901_0437802
404 Ga0436361_0625477
405 Ga0436361_0997946
406 Ga0439449_0038472
407 Ga0466969_0000056
408 Ga0466972_0003227
409 Ga0466965_0230337
410 Ga0466961_0161786
411 Ga0466964_0009223
412 Ga0453684_0493357
413 Ga0466968_0049070
414 Ga0466970_0054290
415 Ga0466959_0056199
416 Ga0466959_0117465
417 Ga0495650_0005641
418 Ga0495639_0029297
419 Ga0495583_0000866
420 Ga0495606_0005178
421 Ga0495620_0027605
422 Ga0495632_0004622
423 Ga0495643_0135437
424 Ga0495621_0014826
425 Ga0495597_0037536
426 Ga0495633_0090692
427 Ga0495668_0046043
428 Ga0495625_0008404
429 Ga0495670_0086033
430 Ga0495649_0004080
431 Ga0495649_0006191
432 Ga0495660_0012670
433 Ga0495636_0021788
434 Ga0495687_000500
435 Ga0495687_004213
436 Ga0495686_0029621
437 Ga0496100_0030976
438 Ga0496101_0158471
439 Ga0496104_0070925
440 Ga0496108_0258814
441 Ga0496110_0008129
442 Ga0496114_0011066
443 Ga0496121_0128802
444 Ga0496124_0000123
445 Ga0496125_0004092
446 Ga0501031_0324054
447 Ga0501033_0017468
448 Ga0501033_0045531
449 Ga0501034_0000188
450 Ga0501034_0075702
451 Ga0501034_0211950
452 Ga0501036_0059633
453 Ga0501036_0499356
454 Ga0501037_0001437
455 Ga0501038_0092427
456 Ga0501038_0099846
457 Ga0501039_0212962
458 Ga0501041_0018896
459 Ga0501042_0004940
460 Ga0501042_0234110
461 Ga0501043_0000149
462 Ga0501043_0117445
463 Ga0501046_0000092
464 Ga0501047_0000028
465 Ga0501047_0003646
466 Ga0501047_0075277
467 Ga0501048_0009579
468 Ga0501048_0049330
469 Ga0501048_0204166
470 Ga0501070_0000609
471 Ga0501071_0005029
472 Ga0501072_0013286
473 Ga0501072_0336367
474 Ga0501074_0022525
475 Ga0501074_0098993
476 Ga0501075_0001026
477 Ga0501075_0054876
478 Ga0501076_0000823
479 Ga0501076_0016260
480 Ga0501077_0083629
481 Ga0501079_0001634
482 Ga0501079_0002741
483 Ga0501080_0007919
484 Ga0501080_0029929
485 Ga0501080_0079226
486 Ga0501080_0130318
487 Ga0501081_0027047
488 Ga0501083_0004566
489 Ga0501083_0124825
490 Ga0501035_0003371
491 Ga0501035_0011429
492 Ga0501035_0013582
493 Ga0501044_0000126
494 Ga0501044_0002292
495 Ga0501044_0012843
496 Ga0501045_0000170
497 Ga0501045_0003259
498 nmdc:mga0k408_194166_c1
499 nmdc:mga0k408_4604_c1
500 nmdc:mga0k408_5230_c1
501 nmdc:mga0k408_62092_c2
502 nmdc:mga06z11_101535_c1
503 nmdc:mga06z11_104977_c1
504 nmdc:mga07m45_51857_c1
505 nmdc:mga07m45_67_c1
506 nmdc:mga07m45_77535_c1
507 Ga0500643_000094
508 Ga0500559_0002842
509 Ga0500564_095216
510 Ga0500568_0011155
511 Ga0500589_042417
512 Ga0500636_0014675
513 Ga0501084_0013512
514 Ga0501082_0001772
515 Ga0501082_0106916
516 Ga0530510_0001520
517 2513955883
518 2514045638
519 2644119963
520 2739611001
521 2857547234
522 2881929353
523 2887380346
524 644748556
525 8002393438
526 8048748892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

24

146

0.93

PF00581

Rhodanese

Rhodanese-like domain

180

296

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jgt-assembly2.cif.gz_B structure and kinetic analysis of h2s production by human mercaptopyruvate sulfurtransferase 0.901 5 272
1okg-assembly1.cif.gz_A 3-mercaptopyruvate sulfurtransferase from leishmania major 0.8971 3 272
8q5z-assembly1.cif.gz_A crystal structure of bovine thiosulfate sulfurtransferase 0.8957 1 272
3aay-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: orthorhombic form 0.8951 3 284
3olh-assembly1.cif.gz_A human 3-mercaptopyruvate sulfurtransferase 0.8936 2 272
ID Description Score Start End Superfamily
af_P9WHF5_161_279_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9216 157 280 3.40.250.10
af_Q4DV84_20_177_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9164 1 147 3.40.250.10
af_P9WHF5_161_279_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.907 157 280 3.40.250.10
af_Q24JL3_210_336_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9067 157 279 3.40.250.10
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9045 2 138 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A1J5PV04-F1-model_v4 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2) 0.9951 165 283 GO:0004792
GO:0016784
AF-A0A4U8V4H5-F1-model_v4 Sulfurtransferase 0.9928 1 284 GO:0004792
AF-A0A2Z6EUJ7-F1-model_v4 Thiosulfate sulfurtransferase protein 0.9903 165 284 GO:0004792
AF-A0A4U8V4H5-F1-model_v4 Sulfurtransferase 0.9894 1 284 GO:0004792
AF-C1D9V5-F1-model_v4 Thiosulfate sulfurtransferase (EC 2.8.1.1) 0.9863 158 284 GO:0004792

Map