F372064

General Info

Members Datasets Scaffolds Average Seq Length
263 178 259 234

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0159732|Ga0466971_0159732_218_1012
Length 264
Sequence MVPHGTNQASEGIDPLMTQPKALHAGLAQQAGGDAPVVKLEAVHKIYEDGGLRVTALTDVSLAISPRRFAMIVGPSGSGKTTLLNLVGCIDTPTSGRLSVCGQDIGSLSETELTDFRSKHVAFVFQSFNLMPVLTAYENVEYPLLLLERPVAERKERTLAMLEAVGLADQRQHRPNQLSGGQRQRVAIARALVKGPALVLADEPTANLDSRTGAEIIDLMREVQEQHAASFVFSTHDPQLISHADETFVIRDGQLQDHQLREAR

Samples

Sample ID Description Type Environment
1 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
2 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
50 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
178 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.38
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.04
Nodule 0
Rhizoplane 0.38
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 5.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000556 3300002741 Bacteria 22314
2 rootH2_10079561 3300003320 Bacteria 9769
3 rootH1_10236157 3300003323 Bacteria 2179
4 JGI25404J52841_10025911 3300003659 Bacteria 1263
5 Ga0055541_1008265 3300003841 Bacteria 1666
6 Ga0070676_10009900 3300005328 Bacteria 5161
7 Ga0070670_100047107 3300005331 Bacteria 3708
8 Ga0068868_100054190 3300005338 Bacteria 3160
9 Ga0070675_100099001 3300005354 Bacteria 2453
10 Ga0070671_100070078 3300005355 Bacteria 2925
11 Ga0070673_100050157 3300005364 Bacteria 3262
12 Ga0070709_10396753 3300005434 Bacteria 1029
13 Ga0070708_100801490 3300005445 Bacteria 885
14 Ga0070663_100020977 3300005455 Bacteria 4335
15 Ga0070678_100088281 3300005456 Bacteria 2370
16 Ga0070662_100000655 3300005457 Bacteria 20977
17 Ga0070662_100341482 3300005457 Bacteria 1225
18 Ga0068867_100007443 3300005459 Bacteria 7744
19 Ga0070707_100141047 3300005468 Bacteria 2345
20 Ga0070698_100098120 3300005471 Bacteria 2904
21 Ga0070698_100179857 3300005471 Bacteria 2053
22 Ga0070699_100033516 3300005518 Bacteria 4438
23 Ga0070699_100838593 3300005518 Bacteria 841
24 Ga0070672_100237331 3300005543 Bacteria 1533
25 Ga0070665_100033553 3300005548 Bacteria 5165
26 Ga0068855_100035671 3300005563 Bacteria 5923
27 Ga0068857_100106588 3300005577 Bacteria 2517
28 Ga0068857_100239483 3300005577 Bacteria 1661
29 Ga0068854_100109050 3300005578 Bacteria 2086
30 Ga0068856_100003273 3300005614 Bacteria 16465
31 Ga0068856_100144353 3300005614 Bacteria 2388
32 Ga0081540_1000242 3300005983 Bacteria 57393
33 Ga0070717_10379812 3300006028 Bacteria 1267
34 Ga0070715_10004510 3300006163 Bacteria 4577
35 Ga0070716_100023101 3300006173 Bacteria 3294
36 Ga0075428_100084720 3300006844 Bacteria 3458
37 Ga0075428_100098490 3300006844 Bacteria 3188
38 Ga0075428_100391280 3300006844 Bacteria 1490
39 Ga0075428_100942070 3300006844 Bacteria 915
40 Ga0075433_10179051 3300006852 Bacteria 1886
41 Ga0075429_100542436 3300006880 Bacteria 1019
42 Ga0068865_100733748 3300006881 Bacteria 847
43 Ga0075436_100252990 3300006914 Bacteria 1255
44 Ga0105240_10045500 3300009093 Bacteria 5567
45 Ga0105240_10054921 3300009093 Bacteria 4989
46 Ga0114129_10026563 3300009147 Bacteria 8200
47 Ga0114129_10045864 3300009147 Bacteria 6143
48 Ga0105238_10180576 3300009551 Bacteria 2087
49 Ga0157370_10051855 3300013104 Bacteria 3917
50 Ga0157370_10392145 3300013104 Bacteria 1278
51 Ga0157369_10017384 3300013105 Bacteria 8083
52 Ga0157369_10218169 3300013105 Bacteria 1997
53 Ga0157378_10395875 3300013297 Bacteria 1360
54 Ga0163162_10680838 3300013306 Bacteria 1151
55 Ga0157375_10134670 3300013308 Bacteria 2593
56 Ga0182008_10024253 3300014497 Bacteria 3090
57 Ga0157376_10742987 3300014969 Bacteria 990
58 Ga0224712_10001554 3300022467 Bacteria 5357
59 Ga0228598_1023404 3300024227 Bacteria 1215
60 Ga0209566_100508 3300025225 Bacteria 26972
61 Ga0209674_100984 3300025226 Bacteria 8793
62 Ga0209674_101665 3300025226 Bacteria 5531
63 Ga0209026_1000017 3300025250 Bacteria 385214
64 Ga0209759_1006403 3300025256 Bacteria 3960
65 Ga0207685_10026023 3300025905 Bacteria 2028
66 Ga0207645_10001447 3300025907 Bacteria 19416
67 Ga0207705_10010593 3300025909 Bacteria 6701
68 Ga0207695_10083129 3300025913 Bacteria 3234
69 Ga0207695_10459336 3300025913 Bacteria 1156
70 Ga0207681_10224505 3300025923 Bacteria 1455
71 Ga0207694_10104841 3300025924 Bacteria 2244
72 Ga0207650_10216078 3300025925 Bacteria 1541
73 Ga0207659_10436928 3300025926 Bacteria 1100
74 Ga0207700_10098887 3300025928 Bacteria 2322
75 Ga0207644_10062462 3300025931 Bacteria 2702
76 Ga0207706_10002120 3300025933 Bacteria 19429
77 Ga0207704_10197692 3300025938 Bacteria 1468
78 Ga0207665_10049131 3300025939 Bacteria 2834
79 Ga0207691_10055148 3300025940 Bacteria 3624
80 Ga0207689_10029161 3300025942 Bacteria 4611
81 Ga0207667_10024096 3300025949 Bacteria 6690
82 Ga0207677_10149434 3300026023 Bacteria 1800
83 Ga0207703_10376695 3300026035 Bacteria 1312
84 Ga0207639_10000013 3300026041 Bacteria 293084
85 Ga0207702_10013611 3300026078 Bacteria 6756
86 Ga0207702_10237688 3300026078 Bacteria 1705
87 Ga0207648_10020800 3300026089 Bacteria 5907
88 Ga0207674_10057122 3300026116 Bacteria 3957
89 Ga0207674_10136377 3300026116 Bacteria 2416
90 Ga0207683_10265064 3300026121 Bacteria 1569
91 Ga0268266_10035113 3300028379 Bacteria 4265
92 Ga0268264_10426689 3300028381 Bacteria 1280
93 Ga0265337_1000129 3300028556 Bacteria 38138
94 Ga0265337_1023235 3300028556 Bacteria 1909
95 Ga0265337_1038462 3300028556 Bacteria 1387
96 Ga0265326_10000475 3300028558 Bacteria 15469
97 Ga0265326_10003038 3300028558 Bacteria 5577
98 Ga0265319_1000159 3300028563 Bacteria 51131
99 Ga0265319_1000200 3300028563 Bacteria 45345
100 Ga0265319_1037720 3300028563 Unclassified 1646
101 Ga0265334_10000128 3300028573 Bacteria 48442
102 Ga0265334_10001816 3300028573 Bacteria 10174
103 Ga0265334_10068221 3300028573 Bacteria 1328
104 Ga0265318_10000052 3300028577 Bacteria 116086
105 Ga0265318_10000489 3300028577 Bacteria 29117
106 Ga0265318_10002984 3300028577 Bacteria 8747
107 Ga0265323_10001181 3300028653 Bacteria 13312
108 Ga0265322_10000258 3300028654 Bacteria 22816
109 Ga0265336_10000243 3300028666 Bacteria 38724
110 Ga0265336_10042956 3300028666 Bacteria 1379
111 Ga0265336_10055286 3300028666 Bacteria 1194
112 Ga0307515_10079810 3300028794 Bacteria 4279
113 Ga0265338_10000124 3300028800 Bacteria 141312
114 Ga0265338_10001040 3300028800 Bacteria 46378
115 Ga0265338_10010438 3300028800 Bacteria 10889
116 Ga0265338_10014237 3300028800 Bacteria 8876
117 Ga0265338_10070949 3300028800 Bacteria 2983
118 Ga0265324_10001479 3300029957 Bacteria 13337
119 Ga0265324_10001722 3300029957 Bacteria 12034
120 Ga0265324_10032099 3300029957 Bacteria 1837
121 Ga0265324_10053990 3300029957 Bacteria 1379
122 Ga0265324_10086357 3300029957 Bacteria 1067
123 Ga0265330_10000308 3300031235 Bacteria 35095
124 Ga0265330_10001694 3300031235 Bacteria 12479
125 Ga0265330_10077097 3300031235 Bacteria 1438
126 Ga0265332_10000295 3300031238 Bacteria 39161
127 Ga0265332_10060121 3300031238 Bacteria 1626
128 Ga0265332_10113636 3300031238 Bacteria 1139
129 Ga0265328_10000911 3300031239 Bacteria 13644
130 Ga0265320_10002698 3300031240 Bacteria 12276
131 Ga0265320_10002903 3300031240 Bacteria 11754
132 Ga0265325_10000923 3300031241 Bacteria 21215
133 Ga0265325_10004975 3300031241 Bacteria 8280
134 Ga0265325_10008296 3300031241 Bacteria 6136
135 Ga0265325_10145011 3300031241 Bacteria 1127
136 Ga0265329_10001005 3300031242 Bacteria 14080
137 Ga0265340_10000196 3300031247 Bacteria 30017
138 Ga0265340_10000276 3300031247 Bacteria 26836
139 Ga0265340_10002349 3300031247 Bacteria 10791
140 Ga0265340_10006057 3300031247 Bacteria 6669
141 Ga0265340_10023531 3300031247 Bacteria 3140
142 Ga0265340_10105099 3300031247 Bacteria 1310
143 Ga0265339_10000638 3300031249 Bacteria 27066
144 Ga0265339_10034781 3300031249 Bacteria 2830
145 Ga0265339_10104973 3300031249 Bacteria 1467
146 Ga0265331_10002457 3300031250 Bacteria 12549
147 Ga0265331_10007280 3300031250 Bacteria 6415
148 Ga0265327_10086948 3300031251 Bacteria 1532
149 Ga0265316_10002711 3300031344 Bacteria 18188
150 Ga0265316_10003621 3300031344 Bacteria 15569
151 Ga0265316_10004570 3300031344 Bacteria 13741
152 Ga0265316_10005723 3300031344 Bacteria 12005
153 Ga0265316_10069238 3300031344 Bacteria 2723
154 Ga0265316_10126467 3300031344 Bacteria 1927
155 Ga0307513_10003474 3300031456 Bacteria 21320
156 Ga0307509_10305860 3300031507 Bacteria 1335
157 Ga0265313_10000542 3300031595 Bacteria 39374
158 Ga0265313_10022967 3300031595 Bacteria 3370
159 Ga0265313_10033172 3300031595 Bacteria 2628
160 Ga0265313_10134576 3300031595 Bacteria 1068
161 Ga0307508_10125322 3300031616 Bacteria 2171
162 Ga0316579_10001991 3300031691 Bacteria 7634
163 Ga0265314_10000015 3300031711 Bacteria 397180
164 Ga0265314_10000188 3300031711 Bacteria 92043
165 Ga0265314_10007178 3300031711 Bacteria 9694
166 Ga0265314_10024203 3300031711 Bacteria 4608
167 Ga0265314_10088840 3300031711 Bacteria 2017
168 Ga0265342_10000117 3300031712 Bacteria 87799
169 Ga0265342_10001986 3300031712 Bacteria 18246
170 Ga0265342_10009919 3300031712 Bacteria 6659
171 Ga0265342_10038560 3300031712 Bacteria 2909
172 Ga0265342_10040091 3300031712 Bacteria 2841
173 Ga0265342_10071840 3300031712 Bacteria 2016
174 Ga0265342_10142875 3300031712 Bacteria 1334
175 Ga0265342_10154289 3300031712 Bacteria 1273
176 Ga0316576_10068957 3300031727 Bacteria 2607
177 Ga0307516_10019855 3300031730 Bacteria 6948
178 Ga0307516_10099585 3300031730 Bacteria 2722
179 Ga0307410_10408975 3300031852 Bacteria 1098
180 Ga0307416_101030088 3300032002 Bacteria 927
181 Ga0307411_10027558 3300032005 Bacteria 3440
182 Ga0307415_100138985 3300032126 Bacteria 1852
183 Ga0316583_10050199 3300032133 Bacteria 1468
184 Ga0373953_0056182 3300035117 Bacteria 1600
185 Ga0373943_0059953 3300035170 Bacteria 1898
186 Ga0373955_0349296 3300035172 Bacteria 896
187 Ga0373933_0024462 3300035724 Bacteria 3457
188 Ga0373937_0493881 3300036401 Bacteria 1163
189 Ga0316582_0010769 3300036647 Bacteria 5024
190 Ga0373925_0167718 3300037068 Bacteria 1732
191 Ga0395900_0026303 3300037418 Bacteria 5959
192 Ga0395900_0100277 3300037418 Bacteria 2974
193 Ga0395900_0303032 3300037418 Bacteria 1583
194 Ga0395900_0644660 3300037418 Bacteria 996
195 Ga0395898_0000984 3300037466 Bacteria 44784
196 Ga0395898_0092711 3300037466 Bacteria 2904
197 Ga0395901_0025349 3300038443 Bacteria 6088
198 Ga0395901_0088364 3300038443 Bacteria 3241
199 Ga0436365_1626974 3300039437 Bacteria 1974
200 Ga0436361_0592110 3300039447 Bacteria 3508
201 Ga0436361_1164747 3300039447 Bacteria 1565
202 Ga0439431_0062103 3300041997 Bacteria 984
203 Ga0451577_0000592 3300042876 Bacteria 58165
204 Ga0451577_0536802 3300042876 Bacteria 1062
205 Ga0451577_0645921 3300042876 Bacteria 959
206 Ga0466969_0000625 3300044656 Bacteria 19147
207 Ga0466972_0040883 3300044658 Bacteria 2258
208 Ga0453683_0094794 3300044673 Bacteria 1872
209 Ga0466966_0000306 3300044684 Bacteria 32023
210 Ga0466966_0035112 3300044684 Bacteria 3241
211 Ga0466961_0015233 3300044693 Bacteria 4937
212 Ga0466963_0026965 3300044694 Bacteria 3675
213 Ga0453684_0001719 3300044712 Bacteria 58720
214 Ga0453684_0012465 3300044712 Bacteria 14010
215 Ga0453684_0172838 3300044712 Bacteria 2544
216 Ga0466971_0038080 3300044719 Bacteria 2157
217 Ga0466971_0159732 3300044719 Bacteria 1055
218 Ga0466968_0117764 3300044735 Bacteria 1200
219 Ga0466967_0242738 3300045976 Bacteria 1719
220 Ga0495620_0009738 3300046515 Bacteria 5100
221 Ga0495628_0266289 3300046516 Bacteria 1276
222 Ga0495602_0090895 3300048088 Bacteria 2534
223 Ga0496114_0245789 3300048917 Bacteria 1574
224 Ga0501031_0209278 3300049568 Bacteria 1271
225 Ga0501033_0290186 3300049570 Bacteria 1153
226 Ga0501036_0070967 3300049572 Bacteria 2945
227 Ga0501037_0109834 3300049573 Bacteria 1987
228 Ga0501038_0039965 3300049574 Bacteria 4100
229 Ga0501039_0055525 3300049575 Bacteria 3067
230 Ga0501040_0022461 3300049576 Bacteria 4221
231 Ga0501041_0028789 3300049577 Bacteria 3351
232 Ga0501042_0040295 3300049578 Bacteria 3321
233 Ga0501043_0056912 3300049579 Bacteria 3071
234 Ga0501046_0028670 3300049580 Bacteria 4532
235 Ga0501048_0320289 3300049582 Bacteria 1104
236 Ga0501068_0045224 3300049584 Bacteria 2652
237 Ga0501071_0054628 3300049587 Bacteria 2881
238 Ga0501072_0051624 3300049588 Bacteria 3237
239 Ga0501074_0021991 3300049590 Bacteria 4632
240 Ga0501076_0086151 3300049592 Bacteria 2524
241 Ga0501077_0029349 3300049593 Bacteria 3496
242 Ga0501079_0023985 3300049741 Bacteria 4679
243 Ga0501081_0014391 3300049743 Bacteria 5218
244 Ga0501035_0055384 3300049822 Bacteria 3541
245 Ga0501044_0386967 3300049823 Bacteria 1313
246 Ga0501045_0055296 3300049824 Bacteria 2902
247 nmdc:mga07m45_409611_c1 3300050496 Bacteria 787
248 nmdc:mga05p37_175335_c1 3300050507 Bacteria 2612
249 nmdc:mga05p37_21635_c1 3300050507 Bacteria 7792
250 nmdc:mga05p37_35523_c1 3300050507 Bacteria 6111
251 nmdc:mga06r32_654736_c1 3300050510 Bacteria 1018
252 nmdc:mga0rr50_252354_c1 3300050513 Bacteria 1465
253 Ga0500635_0058794 3300053080 Bacteria 1336
254 Ga0500566_0001238 3300053094 Bacteria 14946
255 Ga0500603_004827 3300053150 Bacteria 2887
256 Ga0501084_0110818 3300054114 Bacteria 2306
257 Ga0501082_0189874 3300060353 Bacteria 1787
258 Ga0466962_0004164 3300061719 Bacteria 6931
259 Ga0530510_0063276 3300061734 Bacteria 2678

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_409611_c1 nmdc:mga07m45_409611_c1_24_662 189
2 3300042876 Ga0451577_0645921 Ga0451577_0645921_304_948 193
3 3300032002 Ga0307416_101030088 Ga0307416_1010300882 199
4 3300049568 Ga0501031_0209278 Ga0501031_0209278_485_1183 204
5 3300049570 Ga0501033_0290186 Ga0501033_0290186_390_1088 204
6 3300049572 Ga0501036_0070967 Ga0501036_0070967_2014_2712 204
7 3300049573 Ga0501037_0109834 Ga0501037_0109834_1071_1769 204
8 3300049574 Ga0501038_0039965 Ga0501038_0039965_166_864 204
9 3300049575 Ga0501039_0055525 Ga0501039_0055525_2088_2786 204
10 3300049576 Ga0501040_0022461 Ga0501040_0022461_3210_3908 204
11 3300049577 Ga0501041_0028789 Ga0501041_0028789_2415_3113 204
12 3300049578 Ga0501042_0040295 Ga0501042_0040295_2381_3079 204
13 3300049579 Ga0501043_0056912 Ga0501043_0056912_191_889 204
14 3300049580 Ga0501046_0028670 Ga0501046_0028670_241_939 204
15 3300049582 Ga0501048_0320289 Ga0501048_0320289_114_812 204
16 3300049584 Ga0501068_0045224 Ga0501068_0045224_1500_2198 204
17 3300049587 Ga0501071_0054628 Ga0501071_0054628_1872_2570 204
18 3300049588 Ga0501072_0051624 Ga0501072_0051624_334_1032 204
19 3300049590 Ga0501074_0021991 Ga0501074_0021991_432_1130 204
20 3300049592 Ga0501076_0086151 Ga0501076_0086151_1764_2462 204
21 3300049593 Ga0501077_0029349 Ga0501077_0029349_2115_2813 204
22 3300049741 Ga0501079_0023985 Ga0501079_0023985_288_986 204
23 3300049743 Ga0501081_0014391 Ga0501081_0014391_3657_4355 204
24 3300049822 Ga0501035_0055384 Ga0501035_0055384_2378_3076 204
25 3300049824 Ga0501045_0055296 Ga0501045_0055296_335_1033 204
26 3300054114 Ga0501084_0110818 Ga0501084_0110818_443_1141 204
27 3300060353 Ga0501082_0189874 Ga0501082_0189874_787_1485 204
28 3300061734 Ga0530510_0063276 Ga0530510_0063276_95_793 204
29 3300039447 Ga0436361_0592110 Ga0436361_0592110_1934_2611 205
30 iso_pu_bacteria 2846037992 2846041249 206
31 iso_pu_bacteria 8020953355 8020955818 206
32 iso_pu_bacteria 8039098773 8039104085 206
33 3300042876 Ga0451577_0000592 Ga0451577_0000592_36341_37009 207
34 iso_pu_bacteria 2791355137 2792833780 207
35 3300024227 Ga0228598_1023404 Ga0228598_10234041 208
36 3300025928 Ga0207700_10098887 Ga0207700_100988872 208
37 3300028666 Ga0265336_10055286 Ga0265336_100552862 208
38 3300031344 Ga0265316_10002711 Ga0265316_1000271116 208
39 3300036647 Ga0316582_0010769 Ga0316582_0010769_905_1588 208
40 3300044712 Ga0453684_0172838 Ga0453684_0172838_914_1591 208
41 3300003841 Ga0055541_1008265 Ga0055541_10082651 210
42 3300005455 Ga0070663_100020977 Ga0070663_1000209772 210
43 3300005457 Ga0070662_100000655 Ga0070662_1000006554 210
44 3300005563 Ga0068855_100035671 Ga0068855_1000356715 210
45 3300005578 Ga0068854_100109050 Ga0068854_1001090502 210
46 3300006163 Ga0070715_10004510 Ga0070715_100045104 210
47 3300006173 Ga0070716_100023101 Ga0070716_1000231012 210
48 3300006844 Ga0075428_100391280 Ga0075428_1003912802 210
49 3300009551 Ga0105238_10180576 Ga0105238_101805762 210
50 3300013104 Ga0157370_10051855 Ga0157370_100518552 210
51 3300013104 Ga0157370_10392145 Ga0157370_103921452 210
52 3300013105 Ga0157369_10017384 Ga0157369_100173843 210
53 3300022467 Ga0224712_10001554 Ga0224712_100015542 210
54 3300025225 Ga0209566_100508 Ga0209566_10050816 210
55 3300025226 Ga0209674_101665 Ga0209674_1016652 210
56 3300025905 Ga0207685_10026023 Ga0207685_100260232 210
57 3300025909 Ga0207705_10010593 Ga0207705_100105932 210
58 3300025924 Ga0207694_10104841 Ga0207694_101048412 210
59 3300025933 Ga0207706_10002120 Ga0207706_100021206 210
60 3300025939 Ga0207665_10049131 Ga0207665_100491313 210
61 3300025949 Ga0207667_10024096 Ga0207667_100240964 210
62 3300032005 Ga0307411_10027558 Ga0307411_100275582 210
63 3300032126 Ga0307415_100138985 Ga0307415_1001389852 210
64 3300037418 Ga0395900_0026303 Ga0395900_0026303_3968_4675 210
65 3300037418 Ga0395900_0100277 Ga0395900_0100277_2126_2836 210
66 3300037418 Ga0395900_0303032 Ga0395900_0303032_139_849 210
67 3300037418 Ga0395900_0644660 Ga0395900_0644660_224_934 210
68 3300037466 Ga0395898_0000984 Ga0395898_0000984_41378_42085 210
69 3300037466 Ga0395898_0092711 Ga0395898_0092711_102_812 210
70 3300038443 Ga0395901_0025349 Ga0395901_0025349_854_1561 210
71 3300038443 Ga0395901_0088364 Ga0395901_0088364_1647_2357 210
72 3300044658 Ga0466972_0040883 Ga0466972_0040883_941_1648 210
73 3300044684 Ga0466966_0000306 Ga0466966_0000306_9346_10053 210
74 3300044694 Ga0466963_0026965 Ga0466963_0026965_1649_2356 210
75 3300044719 Ga0466971_0038080 Ga0466971_0038080_503_1210 210
76 3300049823 Ga0501044_0386967 Ga0501044_0386967_204_911 210
77 3300061719 Ga0466962_0004164 Ga0466962_0004164_5449_6156 210
78 3300005471 Ga0070698_100179857 Ga0070698_1001798572 211
79 3300005518 Ga0070699_100033516 Ga0070699_1000335163 211
80 3300006844 Ga0075428_100098490 Ga0075428_1000984902 211
81 3300006880 Ga0075429_100542436 Ga0075429_1005424362 211
82 3300009093 Ga0105240_10045500 Ga0105240_100455005 211
83 3300014969 Ga0157376_10742987 Ga0157376_107429872 211
84 3300025913 Ga0207695_10083129 Ga0207695_100831293 211
85 3300026035 Ga0207703_10376695 Ga0207703_103766951 211
86 3300026041 Ga0207639_10000013 Ga0207639_1000001392 211
87 3300028381 Ga0268264_10426689 Ga0268264_104266891 211
88 3300028556 Ga0265337_1000129 Ga0265337_10001299 211
89 3300028556 Ga0265337_1023235 Ga0265337_10232352 211
90 3300028558 Ga0265326_10000475 Ga0265326_1000047510 211
91 3300028558 Ga0265326_10003038 Ga0265326_100030383 211
92 3300028563 Ga0265319_1000159 Ga0265319_100015928 211
93 3300028563 Ga0265319_1000200 Ga0265319_100020016 211
94 3300028563 Ga0265319_1037720 Ga0265319_10377202 211
95 3300028573 Ga0265334_10001816 Ga0265334_100018163 211
96 3300028573 Ga0265334_10068221 Ga0265334_100682211 211
97 3300028577 Ga0265318_10000489 Ga0265318_100004899 211
98 3300028577 Ga0265318_10002984 Ga0265318_100029845 211
99 3300028653 Ga0265323_10001181 Ga0265323_100011818 211
100 3300028654 Ga0265322_10000258 Ga0265322_100002585 211
101 3300028666 Ga0265336_10000243 Ga0265336_1000024320 211
102 3300028666 Ga0265336_10042956 Ga0265336_100429562 211
103 3300028800 Ga0265338_10000124 Ga0265338_1000012411 211
104 3300028800 Ga0265338_10001040 Ga0265338_1000104027 211
105 3300028800 Ga0265338_10010438 Ga0265338_100104386 211
106 3300028800 Ga0265338_10070949 Ga0265338_100709493 211
107 3300029957 Ga0265324_10001479 Ga0265324_100014795 211
108 3300029957 Ga0265324_10001722 Ga0265324_1000172211 211
109 3300029957 Ga0265324_10032099 Ga0265324_100320992 211
110 3300029957 Ga0265324_10053990 Ga0265324_100539901 211
111 3300031235 Ga0265330_10000308 Ga0265330_100003087 211
112 3300031238 Ga0265332_10000295 Ga0265332_1000029522 211
113 3300031238 Ga0265332_10060121 Ga0265332_100601211 211
114 3300031239 Ga0265328_10000911 Ga0265328_100009118 211
115 3300031240 Ga0265320_10002698 Ga0265320_100026987 211
116 3300031240 Ga0265320_10002903 Ga0265320_100029038 211
117 3300031241 Ga0265325_10000923 Ga0265325_100009238 211
118 3300031242 Ga0265329_10001005 Ga0265329_100010055 211
119 3300031247 Ga0265340_10000196 Ga0265340_1000019616 211
120 3300031249 Ga0265339_10000638 Ga0265339_100006388 211
121 3300031249 Ga0265339_10104973 Ga0265339_101049732 211
122 3300031250 Ga0265331_10002457 Ga0265331_100024575 211
123 3300031251 Ga0265327_10086948 Ga0265327_100869482 211
124 3300031344 Ga0265316_10003621 Ga0265316_100036217 211
125 3300031344 Ga0265316_10004570 Ga0265316_100045703 211
126 3300031595 Ga0265313_10000542 Ga0265313_1000054217 211
127 3300031595 Ga0265313_10022967 Ga0265313_100229672 211
128 3300031595 Ga0265313_10033172 Ga0265313_100331722 211
129 3300031711 Ga0265314_10007178 Ga0265314_100071785 211
130 3300031711 Ga0265314_10024203 Ga0265314_100242035 211
131 3300031711 Ga0265314_10088840 Ga0265314_100888402 211
132 3300031712 Ga0265342_10001986 Ga0265342_100019868 211
133 3300031712 Ga0265342_10009919 Ga0265342_100099194 211
134 3300035170 Ga0373943_0059953 Ga0373943_0059953_366_1121 211
135 3300044712 Ga0453684_0001719 Ga0453684_0001719_43017_43724 211
136 3300044735 Ga0466968_0117764 Ga0466968_0117764_491_1177 211
137 3300050507 nmdc:mga05p37_175335_c1 nmdc:mga05p37_175335_c1_276_968 211
138 3300003320 rootH2_10079561 rootH2_100795616 212
139 3300006852 Ga0075433_10179051 Ga0075433_101790512 212
140 3300009147 Ga0114129_10026563 Ga0114129_100265633 212
141 3300039447 Ga0436361_1164747 Ga0436361_1164747_283_1020 212
142 3300050507 nmdc:mga05p37_35523_c1 nmdc:mga05p37_35523_c1_3777_4475 212
143 3300005434 Ga0070709_10396753 Ga0070709_103967531 213
144 3300005445 Ga0070708_100801490 Ga0070708_1008014901 213
145 3300005577 Ga0068857_100106588 Ga0068857_1001065883 213
146 3300006844 Ga0075428_100084720 Ga0075428_1000847202 213
147 3300026116 Ga0207674_10136377 Ga0207674_101363771 213
148 3300028800 Ga0265338_10014237 Ga0265338_100142372 213
149 3300031595 Ga0265313_10134576 Ga0265313_101345762 213
150 3300031616 Ga0307508_10125322 Ga0307508_101253222 213
151 3300039437 Ga0436365_1626974 Ga0436365_1626974_319_1020 213
152 3300042876 Ga0451577_0536802 Ga0451577_0536802_280_993 213
153 3300044673 Ga0453683_0094794 Ga0453683_0094794_24_737 213
154 3300044712 Ga0453684_0012465 Ga0453684_0012465_12489_13202 213
155 3300046515 Ga0495620_0009738 Ga0495620_0009738_379_1089 213
156 3300005614 Ga0068856_100003273 Ga0068856_1000032734 214
157 3300005614 Ga0068856_100144353 Ga0068856_1001443533 214
158 3300013105 Ga0157369_10218169 Ga0157369_102181692 214
159 3300026078 Ga0207702_10013611 Ga0207702_100136113 214
160 3300026078 Ga0207702_10237688 Ga0207702_102376882 214
161 3300031727 Ga0316576_10068957 Ga0316576_100689572 214
162 3300044684 Ga0466966_0035112 Ga0466966_0035112_850_1575 214
163 3300005328 Ga0070676_10009900 Ga0070676_100099006 215
164 3300005331 Ga0070670_100047107 Ga0070670_1000471073 215
165 3300005338 Ga0068868_100054190 Ga0068868_1000541903 215
166 3300005354 Ga0070675_100099001 Ga0070675_1000990011 215
167 3300005355 Ga0070671_100070078 Ga0070671_1000700782 215
168 3300005364 Ga0070673_100050157 Ga0070673_1000501573 215
169 3300005456 Ga0070678_100088281 Ga0070678_1000882812 215
170 3300005457 Ga0070662_100341482 Ga0070662_1003414822 215
171 3300005459 Ga0068867_100007443 Ga0068867_1000074433 215
172 3300005543 Ga0070672_100237331 Ga0070672_1002373312 215
173 3300005577 Ga0068857_100239483 Ga0068857_1002394832 215
174 3300006844 Ga0075428_100942070 Ga0075428_1009420701 215
175 3300006881 Ga0068865_100733748 Ga0068865_1007337481 215
176 3300013297 Ga0157378_10395875 Ga0157378_103958752 215
177 3300013306 Ga0163162_10680838 Ga0163162_106808382 215
178 3300013308 Ga0157375_10134670 Ga0157375_101346702 215
179 3300025907 Ga0207645_10001447 Ga0207645_100014476 215
180 3300025923 Ga0207681_10224505 Ga0207681_102245052 215
181 3300025925 Ga0207650_10216078 Ga0207650_102160782 215
182 3300025926 Ga0207659_10436928 Ga0207659_104369282 215
183 3300025931 Ga0207644_10062462 Ga0207644_100624622 215
184 3300025938 Ga0207704_10197692 Ga0207704_101976921 215
185 3300025940 Ga0207691_10055148 Ga0207691_100551483 215
186 3300025942 Ga0207689_10029161 Ga0207689_100291613 215
187 3300026023 Ga0207677_10149434 Ga0207677_101494342 215
188 3300026089 Ga0207648_10020800 Ga0207648_100208005 215
189 3300026116 Ga0207674_10057122 Ga0207674_100571222 215
190 3300026121 Ga0207683_10265064 Ga0207683_102650642 215
191 3300028794 Ga0307515_10079810 Ga0307515_100798103 215
192 3300031456 Ga0307513_10003474 Ga0307513_1000347410 215
193 3300045976 Ga0466967_0242738 Ga0466967_0242738_526_1233 215
194 3300050510 nmdc:mga06r32_654736_c1 nmdc:mga06r32_654736_c1_255_947 215
195 3300003323 rootH1_10236157 rootH1_102361572 216
196 3300003659 JGI25404J52841_10025911 JGI25404J52841_100259112 216
197 3300005471 Ga0070698_100098120 Ga0070698_1000981202 216
198 3300005983 Ga0081540_1000242 Ga0081540_100024224 216
199 3300006028 Ga0070717_10379812 Ga0070717_103798121 216
200 3300006914 Ga0075436_100252990 Ga0075436_1002529902 216
201 3300009093 Ga0105240_10054921 Ga0105240_100549211 216
202 3300025913 Ga0207695_10459336 Ga0207695_104593361 216
203 3300028577 Ga0265318_10000052 Ga0265318_100000523 216
204 3300031691 Ga0316579_10001991 Ga0316579_100019914 216
205 3300032133 Ga0316583_10050199 Ga0316583_100501992 216
206 3300035172 Ga0373955_0349296 Ga0373955_0349296_57_743 216
207 3300037068 Ga0373925_0167718 Ga0373925_0167718_869_1579 216
208 3300044656 Ga0466969_0000625 Ga0466969_0000625_885_1598 216
209 3300044693 Ga0466961_0015233 Ga0466961_0015233_4164_4877 216
210 3300046516 Ga0495628_0266289 Ga0495628_0266289_543_1232 216
211 3300048088 Ga0495602_0090895 Ga0495602_0090895_1835_2524 216
212 3300050513 nmdc:mga0rr50_252354_c1 nmdc:mga0rr50_252354_c1_288_998 216
213 3300031235 Ga0265330_10077097 Ga0265330_100770972 217
214 3300031238 Ga0265332_10113636 Ga0265332_101136362 217
215 3300031241 Ga0265325_10008296 Ga0265325_100082962 217
216 3300031247 Ga0265340_10002349 Ga0265340_100023493 217
217 3300031247 Ga0265340_10105099 Ga0265340_101050991 217
218 3300031344 Ga0265316_10126467 Ga0265316_101264673 217
219 3300031711 Ga0265314_10000188 Ga0265314_1000018874 217
220 3300031712 Ga0265342_10040091 Ga0265342_100400911 217
221 3300031712 Ga0265342_10154289 Ga0265342_101542892 217
222 3300031730 Ga0307516_10019855 Ga0307516_100198553 217
223 3300031247 Ga0265340_10000276 Ga0265340_100002764 218
224 3300031247 Ga0265340_10023531 Ga0265340_100235313 218
225 3300031344 Ga0265316_10005723 Ga0265316_1000572312 218
226 3300031344 Ga0265316_10069238 Ga0265316_100692382 218
227 3300031712 Ga0265342_10038560 Ga0265342_100385601 218
228 3300031712 Ga0265342_10142875 Ga0265342_101428751 218
229 3300044719 Ga0466971_0159732 Ga0466971_0159732_218_1012 218
230 3300005548 Ga0070665_100033553 Ga0070665_1000335532 219
231 3300028379 Ga0268266_10035113 Ga0268266_100351132 219
232 3300031241 Ga0265325_10145011 Ga0265325_101450111 219
233 3300031730 Ga0307516_10099585 Ga0307516_100995853 219
234 3300031235 Ga0265330_10001694 Ga0265330_100016949 220
235 3300031507 Ga0307509_10305860 Ga0307509_103058602 222
236 3300036401 Ga0373937_0493881 Ga0373937_0493881_153_899 222
237 3300053080 Ga0500635_0058794 Ga0500635_0058794_63_794 222
238 3300053094 Ga0500566_0001238 Ga0500566_0001238_13385_14116 222
239 3300053150 Ga0500603_004827 Ga0500603_004827_672_1403 222
240 3300005468 Ga0070707_100141047 Ga0070707_1001410473 223
241 3300005518 Ga0070699_100838593 Ga0070699_1008385931 223
242 3300009147 Ga0114129_10045864 Ga0114129_100458646 223
243 3300028556 Ga0265337_1038462 Ga0265337_10384622 223
244 3300029957 Ga0265324_10086357 Ga0265324_100863571 223
245 3300031241 Ga0265325_10004975 Ga0265325_100049753 223
246 3300031247 Ga0265340_10006057 Ga0265340_100060572 223
247 3300031249 Ga0265339_10034781 Ga0265339_100347812 223
248 3300031250 Ga0265331_10007280 Ga0265331_100072804 223
249 3300031711 Ga0265314_10000015 Ga0265314_1000001576 223
250 3300031712 Ga0265342_10000117 Ga0265342_1000011722 223
251 3300031712 Ga0265342_10071840 Ga0265342_100718403 223
252 3300048917 Ga0496114_0245789 Ga0496114_0245789_631_1377 223
253 3300050507 nmdc:mga05p37_21635_c1 nmdc:mga05p37_21635_c1_3137_3883 223
254 3300028573 Ga0265334_10000128 Ga0265334_1000012840 224
255 3300031852 Ga0307410_10408975 Ga0307410_104089752 224
256 3300035117 Ga0373953_0056182 Ga0373953_0056182_77_808 224
257 3300035724 Ga0373933_0024462 Ga0373933_0024462_116_847 224
258 3300041997 Ga0439431_0062103 Ga0439431_0062103_90_914 224
259 3300002741 JGI25157J39369_1000556 JGI25157J39369_10005565 227
260 3300014497 Ga0182008_10024253 Ga0182008_100242534 227
261 3300025226 Ga0209674_100984 Ga0209674_1009844 227
262 3300025250 Ga0209026_1000017 Ga0209026_1000017261 227
263 3300025256 Ga0209759_1006403 Ga0209759_10064034 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

57

206

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9754 16 221
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9668 18 217
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9649 16 222
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9644 16 221
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9634 16 224
ID Description Score Start End Superfamily
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9745 15 221 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9714 17 217 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 44 218 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9661 16 218 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9649 16 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.9793 36 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7X9B9P8-F1-model_v4 ABC transporter ATP-binding protein 0.9712 16 120 GO:0005524
GO:0016887
AF-A0A1F8CYG4-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9702 53 218 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7C0XLY7-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9696 101 221 GO:0005524
GO:0016887
GO:0022857
GO:0043190
AF-A0A538BD68-F1-model_v4 ABC transporter ATP-binding protein 0.9681 18 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.89 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map