F372064
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 263 | 178 | 259 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300044719|Ga0466971_0159732|Ga0466971_0159732_218_1012 |
| Length | 264 |
| Sequence | MVPHGTNQASEGIDPLMTQPKALHAGLAQQAGGDAPVVKLEAVHKIYEDGGLRVTALTDVSLAISPRRFAMIVGPSGSGKTTLLNLVGCIDTPTSGRLSVCGQDIGSLSETELTDFRSKHVAFVFQSFNLMPVLTAYENVEYPLLLLERPVAERKERTLAMLEAVGLADQRQHRPNQLSGGQRQRVAIARALVKGPALVLADEPTANLDSRTGAEIIDLMREVQEQHAASFVFSTHDPQLISHADETFVIRDGQLQDHQLREAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 2 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 50 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 80 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 81 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 84 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 85 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 88 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 90 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 91 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 94 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 95 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 96 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 100 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 102 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 103 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 105 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 115 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 127 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 130 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 131 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 132 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 133 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 134 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 137 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 171 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 172 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 173 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 176 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 177 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 178 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0.38 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.04 |
| Nodule | 0 |
| Rhizoplane | 0.38 |
| Rhizosphere | 91.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1000556 | 3300002741 | Bacteria | 22314 |
| 2 | rootH2_10079561 | 3300003320 | Bacteria | 9769 |
| 3 | rootH1_10236157 | 3300003323 | Bacteria | 2179 |
| 4 | JGI25404J52841_10025911 | 3300003659 | Bacteria | 1263 |
| 5 | Ga0055541_1008265 | 3300003841 | Bacteria | 1666 |
| 6 | Ga0070676_10009900 | 3300005328 | Bacteria | 5161 |
| 7 | Ga0070670_100047107 | 3300005331 | Bacteria | 3708 |
| 8 | Ga0068868_100054190 | 3300005338 | Bacteria | 3160 |
| 9 | Ga0070675_100099001 | 3300005354 | Bacteria | 2453 |
| 10 | Ga0070671_100070078 | 3300005355 | Bacteria | 2925 |
| 11 | Ga0070673_100050157 | 3300005364 | Bacteria | 3262 |
| 12 | Ga0070709_10396753 | 3300005434 | Bacteria | 1029 |
| 13 | Ga0070708_100801490 | 3300005445 | Bacteria | 885 |
| 14 | Ga0070663_100020977 | 3300005455 | Bacteria | 4335 |
| 15 | Ga0070678_100088281 | 3300005456 | Bacteria | 2370 |
| 16 | Ga0070662_100000655 | 3300005457 | Bacteria | 20977 |
| 17 | Ga0070662_100341482 | 3300005457 | Bacteria | 1225 |
| 18 | Ga0068867_100007443 | 3300005459 | Bacteria | 7744 |
| 19 | Ga0070707_100141047 | 3300005468 | Bacteria | 2345 |
| 20 | Ga0070698_100098120 | 3300005471 | Bacteria | 2904 |
| 21 | Ga0070698_100179857 | 3300005471 | Bacteria | 2053 |
| 22 | Ga0070699_100033516 | 3300005518 | Bacteria | 4438 |
| 23 | Ga0070699_100838593 | 3300005518 | Bacteria | 841 |
| 24 | Ga0070672_100237331 | 3300005543 | Bacteria | 1533 |
| 25 | Ga0070665_100033553 | 3300005548 | Bacteria | 5165 |
| 26 | Ga0068855_100035671 | 3300005563 | Bacteria | 5923 |
| 27 | Ga0068857_100106588 | 3300005577 | Bacteria | 2517 |
| 28 | Ga0068857_100239483 | 3300005577 | Bacteria | 1661 |
| 29 | Ga0068854_100109050 | 3300005578 | Bacteria | 2086 |
| 30 | Ga0068856_100003273 | 3300005614 | Bacteria | 16465 |
| 31 | Ga0068856_100144353 | 3300005614 | Bacteria | 2388 |
| 32 | Ga0081540_1000242 | 3300005983 | Bacteria | 57393 |
| 33 | Ga0070717_10379812 | 3300006028 | Bacteria | 1267 |
| 34 | Ga0070715_10004510 | 3300006163 | Bacteria | 4577 |
| 35 | Ga0070716_100023101 | 3300006173 | Bacteria | 3294 |
| 36 | Ga0075428_100084720 | 3300006844 | Bacteria | 3458 |
| 37 | Ga0075428_100098490 | 3300006844 | Bacteria | 3188 |
| 38 | Ga0075428_100391280 | 3300006844 | Bacteria | 1490 |
| 39 | Ga0075428_100942070 | 3300006844 | Bacteria | 915 |
| 40 | Ga0075433_10179051 | 3300006852 | Bacteria | 1886 |
| 41 | Ga0075429_100542436 | 3300006880 | Bacteria | 1019 |
| 42 | Ga0068865_100733748 | 3300006881 | Bacteria | 847 |
| 43 | Ga0075436_100252990 | 3300006914 | Bacteria | 1255 |
| 44 | Ga0105240_10045500 | 3300009093 | Bacteria | 5567 |
| 45 | Ga0105240_10054921 | 3300009093 | Bacteria | 4989 |
| 46 | Ga0114129_10026563 | 3300009147 | Bacteria | 8200 |
| 47 | Ga0114129_10045864 | 3300009147 | Bacteria | 6143 |
| 48 | Ga0105238_10180576 | 3300009551 | Bacteria | 2087 |
| 49 | Ga0157370_10051855 | 3300013104 | Bacteria | 3917 |
| 50 | Ga0157370_10392145 | 3300013104 | Bacteria | 1278 |
| 51 | Ga0157369_10017384 | 3300013105 | Bacteria | 8083 |
| 52 | Ga0157369_10218169 | 3300013105 | Bacteria | 1997 |
| 53 | Ga0157378_10395875 | 3300013297 | Bacteria | 1360 |
| 54 | Ga0163162_10680838 | 3300013306 | Bacteria | 1151 |
| 55 | Ga0157375_10134670 | 3300013308 | Bacteria | 2593 |
| 56 | Ga0182008_10024253 | 3300014497 | Bacteria | 3090 |
| 57 | Ga0157376_10742987 | 3300014969 | Bacteria | 990 |
| 58 | Ga0224712_10001554 | 3300022467 | Bacteria | 5357 |
| 59 | Ga0228598_1023404 | 3300024227 | Bacteria | 1215 |
| 60 | Ga0209566_100508 | 3300025225 | Bacteria | 26972 |
| 61 | Ga0209674_100984 | 3300025226 | Bacteria | 8793 |
| 62 | Ga0209674_101665 | 3300025226 | Bacteria | 5531 |
| 63 | Ga0209026_1000017 | 3300025250 | Bacteria | 385214 |
| 64 | Ga0209759_1006403 | 3300025256 | Bacteria | 3960 |
| 65 | Ga0207685_10026023 | 3300025905 | Bacteria | 2028 |
| 66 | Ga0207645_10001447 | 3300025907 | Bacteria | 19416 |
| 67 | Ga0207705_10010593 | 3300025909 | Bacteria | 6701 |
| 68 | Ga0207695_10083129 | 3300025913 | Bacteria | 3234 |
| 69 | Ga0207695_10459336 | 3300025913 | Bacteria | 1156 |
| 70 | Ga0207681_10224505 | 3300025923 | Bacteria | 1455 |
| 71 | Ga0207694_10104841 | 3300025924 | Bacteria | 2244 |
| 72 | Ga0207650_10216078 | 3300025925 | Bacteria | 1541 |
| 73 | Ga0207659_10436928 | 3300025926 | Bacteria | 1100 |
| 74 | Ga0207700_10098887 | 3300025928 | Bacteria | 2322 |
| 75 | Ga0207644_10062462 | 3300025931 | Bacteria | 2702 |
| 76 | Ga0207706_10002120 | 3300025933 | Bacteria | 19429 |
| 77 | Ga0207704_10197692 | 3300025938 | Bacteria | 1468 |
| 78 | Ga0207665_10049131 | 3300025939 | Bacteria | 2834 |
| 79 | Ga0207691_10055148 | 3300025940 | Bacteria | 3624 |
| 80 | Ga0207689_10029161 | 3300025942 | Bacteria | 4611 |
| 81 | Ga0207667_10024096 | 3300025949 | Bacteria | 6690 |
| 82 | Ga0207677_10149434 | 3300026023 | Bacteria | 1800 |
| 83 | Ga0207703_10376695 | 3300026035 | Bacteria | 1312 |
| 84 | Ga0207639_10000013 | 3300026041 | Bacteria | 293084 |
| 85 | Ga0207702_10013611 | 3300026078 | Bacteria | 6756 |
| 86 | Ga0207702_10237688 | 3300026078 | Bacteria | 1705 |
| 87 | Ga0207648_10020800 | 3300026089 | Bacteria | 5907 |
| 88 | Ga0207674_10057122 | 3300026116 | Bacteria | 3957 |
| 89 | Ga0207674_10136377 | 3300026116 | Bacteria | 2416 |
| 90 | Ga0207683_10265064 | 3300026121 | Bacteria | 1569 |
| 91 | Ga0268266_10035113 | 3300028379 | Bacteria | 4265 |
| 92 | Ga0268264_10426689 | 3300028381 | Bacteria | 1280 |
| 93 | Ga0265337_1000129 | 3300028556 | Bacteria | 38138 |
| 94 | Ga0265337_1023235 | 3300028556 | Bacteria | 1909 |
| 95 | Ga0265337_1038462 | 3300028556 | Bacteria | 1387 |
| 96 | Ga0265326_10000475 | 3300028558 | Bacteria | 15469 |
| 97 | Ga0265326_10003038 | 3300028558 | Bacteria | 5577 |
| 98 | Ga0265319_1000159 | 3300028563 | Bacteria | 51131 |
| 99 | Ga0265319_1000200 | 3300028563 | Bacteria | 45345 |
| 100 | Ga0265319_1037720 | 3300028563 | Unclassified | 1646 |
| 101 | Ga0265334_10000128 | 3300028573 | Bacteria | 48442 |
| 102 | Ga0265334_10001816 | 3300028573 | Bacteria | 10174 |
| 103 | Ga0265334_10068221 | 3300028573 | Bacteria | 1328 |
| 104 | Ga0265318_10000052 | 3300028577 | Bacteria | 116086 |
| 105 | Ga0265318_10000489 | 3300028577 | Bacteria | 29117 |
| 106 | Ga0265318_10002984 | 3300028577 | Bacteria | 8747 |
| 107 | Ga0265323_10001181 | 3300028653 | Bacteria | 13312 |
| 108 | Ga0265322_10000258 | 3300028654 | Bacteria | 22816 |
| 109 | Ga0265336_10000243 | 3300028666 | Bacteria | 38724 |
| 110 | Ga0265336_10042956 | 3300028666 | Bacteria | 1379 |
| 111 | Ga0265336_10055286 | 3300028666 | Bacteria | 1194 |
| 112 | Ga0307515_10079810 | 3300028794 | Bacteria | 4279 |
| 113 | Ga0265338_10000124 | 3300028800 | Bacteria | 141312 |
| 114 | Ga0265338_10001040 | 3300028800 | Bacteria | 46378 |
| 115 | Ga0265338_10010438 | 3300028800 | Bacteria | 10889 |
| 116 | Ga0265338_10014237 | 3300028800 | Bacteria | 8876 |
| 117 | Ga0265338_10070949 | 3300028800 | Bacteria | 2983 |
| 118 | Ga0265324_10001479 | 3300029957 | Bacteria | 13337 |
| 119 | Ga0265324_10001722 | 3300029957 | Bacteria | 12034 |
| 120 | Ga0265324_10032099 | 3300029957 | Bacteria | 1837 |
| 121 | Ga0265324_10053990 | 3300029957 | Bacteria | 1379 |
| 122 | Ga0265324_10086357 | 3300029957 | Bacteria | 1067 |
| 123 | Ga0265330_10000308 | 3300031235 | Bacteria | 35095 |
| 124 | Ga0265330_10001694 | 3300031235 | Bacteria | 12479 |
| 125 | Ga0265330_10077097 | 3300031235 | Bacteria | 1438 |
| 126 | Ga0265332_10000295 | 3300031238 | Bacteria | 39161 |
| 127 | Ga0265332_10060121 | 3300031238 | Bacteria | 1626 |
| 128 | Ga0265332_10113636 | 3300031238 | Bacteria | 1139 |
| 129 | Ga0265328_10000911 | 3300031239 | Bacteria | 13644 |
| 130 | Ga0265320_10002698 | 3300031240 | Bacteria | 12276 |
| 131 | Ga0265320_10002903 | 3300031240 | Bacteria | 11754 |
| 132 | Ga0265325_10000923 | 3300031241 | Bacteria | 21215 |
| 133 | Ga0265325_10004975 | 3300031241 | Bacteria | 8280 |
| 134 | Ga0265325_10008296 | 3300031241 | Bacteria | 6136 |
| 135 | Ga0265325_10145011 | 3300031241 | Bacteria | 1127 |
| 136 | Ga0265329_10001005 | 3300031242 | Bacteria | 14080 |
| 137 | Ga0265340_10000196 | 3300031247 | Bacteria | 30017 |
| 138 | Ga0265340_10000276 | 3300031247 | Bacteria | 26836 |
| 139 | Ga0265340_10002349 | 3300031247 | Bacteria | 10791 |
| 140 | Ga0265340_10006057 | 3300031247 | Bacteria | 6669 |
| 141 | Ga0265340_10023531 | 3300031247 | Bacteria | 3140 |
| 142 | Ga0265340_10105099 | 3300031247 | Bacteria | 1310 |
| 143 | Ga0265339_10000638 | 3300031249 | Bacteria | 27066 |
| 144 | Ga0265339_10034781 | 3300031249 | Bacteria | 2830 |
| 145 | Ga0265339_10104973 | 3300031249 | Bacteria | 1467 |
| 146 | Ga0265331_10002457 | 3300031250 | Bacteria | 12549 |
| 147 | Ga0265331_10007280 | 3300031250 | Bacteria | 6415 |
| 148 | Ga0265327_10086948 | 3300031251 | Bacteria | 1532 |
| 149 | Ga0265316_10002711 | 3300031344 | Bacteria | 18188 |
| 150 | Ga0265316_10003621 | 3300031344 | Bacteria | 15569 |
| 151 | Ga0265316_10004570 | 3300031344 | Bacteria | 13741 |
| 152 | Ga0265316_10005723 | 3300031344 | Bacteria | 12005 |
| 153 | Ga0265316_10069238 | 3300031344 | Bacteria | 2723 |
| 154 | Ga0265316_10126467 | 3300031344 | Bacteria | 1927 |
| 155 | Ga0307513_10003474 | 3300031456 | Bacteria | 21320 |
| 156 | Ga0307509_10305860 | 3300031507 | Bacteria | 1335 |
| 157 | Ga0265313_10000542 | 3300031595 | Bacteria | 39374 |
| 158 | Ga0265313_10022967 | 3300031595 | Bacteria | 3370 |
| 159 | Ga0265313_10033172 | 3300031595 | Bacteria | 2628 |
| 160 | Ga0265313_10134576 | 3300031595 | Bacteria | 1068 |
| 161 | Ga0307508_10125322 | 3300031616 | Bacteria | 2171 |
| 162 | Ga0316579_10001991 | 3300031691 | Bacteria | 7634 |
| 163 | Ga0265314_10000015 | 3300031711 | Bacteria | 397180 |
| 164 | Ga0265314_10000188 | 3300031711 | Bacteria | 92043 |
| 165 | Ga0265314_10007178 | 3300031711 | Bacteria | 9694 |
| 166 | Ga0265314_10024203 | 3300031711 | Bacteria | 4608 |
| 167 | Ga0265314_10088840 | 3300031711 | Bacteria | 2017 |
| 168 | Ga0265342_10000117 | 3300031712 | Bacteria | 87799 |
| 169 | Ga0265342_10001986 | 3300031712 | Bacteria | 18246 |
| 170 | Ga0265342_10009919 | 3300031712 | Bacteria | 6659 |
| 171 | Ga0265342_10038560 | 3300031712 | Bacteria | 2909 |
| 172 | Ga0265342_10040091 | 3300031712 | Bacteria | 2841 |
| 173 | Ga0265342_10071840 | 3300031712 | Bacteria | 2016 |
| 174 | Ga0265342_10142875 | 3300031712 | Bacteria | 1334 |
| 175 | Ga0265342_10154289 | 3300031712 | Bacteria | 1273 |
| 176 | Ga0316576_10068957 | 3300031727 | Bacteria | 2607 |
| 177 | Ga0307516_10019855 | 3300031730 | Bacteria | 6948 |
| 178 | Ga0307516_10099585 | 3300031730 | Bacteria | 2722 |
| 179 | Ga0307410_10408975 | 3300031852 | Bacteria | 1098 |
| 180 | Ga0307416_101030088 | 3300032002 | Bacteria | 927 |
| 181 | Ga0307411_10027558 | 3300032005 | Bacteria | 3440 |
| 182 | Ga0307415_100138985 | 3300032126 | Bacteria | 1852 |
| 183 | Ga0316583_10050199 | 3300032133 | Bacteria | 1468 |
| 184 | Ga0373953_0056182 | 3300035117 | Bacteria | 1600 |
| 185 | Ga0373943_0059953 | 3300035170 | Bacteria | 1898 |
| 186 | Ga0373955_0349296 | 3300035172 | Bacteria | 896 |
| 187 | Ga0373933_0024462 | 3300035724 | Bacteria | 3457 |
| 188 | Ga0373937_0493881 | 3300036401 | Bacteria | 1163 |
| 189 | Ga0316582_0010769 | 3300036647 | Bacteria | 5024 |
| 190 | Ga0373925_0167718 | 3300037068 | Bacteria | 1732 |
| 191 | Ga0395900_0026303 | 3300037418 | Bacteria | 5959 |
| 192 | Ga0395900_0100277 | 3300037418 | Bacteria | 2974 |
| 193 | Ga0395900_0303032 | 3300037418 | Bacteria | 1583 |
| 194 | Ga0395900_0644660 | 3300037418 | Bacteria | 996 |
| 195 | Ga0395898_0000984 | 3300037466 | Bacteria | 44784 |
| 196 | Ga0395898_0092711 | 3300037466 | Bacteria | 2904 |
| 197 | Ga0395901_0025349 | 3300038443 | Bacteria | 6088 |
| 198 | Ga0395901_0088364 | 3300038443 | Bacteria | 3241 |
| 199 | Ga0436365_1626974 | 3300039437 | Bacteria | 1974 |
| 200 | Ga0436361_0592110 | 3300039447 | Bacteria | 3508 |
| 201 | Ga0436361_1164747 | 3300039447 | Bacteria | 1565 |
| 202 | Ga0439431_0062103 | 3300041997 | Bacteria | 984 |
| 203 | Ga0451577_0000592 | 3300042876 | Bacteria | 58165 |
| 204 | Ga0451577_0536802 | 3300042876 | Bacteria | 1062 |
| 205 | Ga0451577_0645921 | 3300042876 | Bacteria | 959 |
| 206 | Ga0466969_0000625 | 3300044656 | Bacteria | 19147 |
| 207 | Ga0466972_0040883 | 3300044658 | Bacteria | 2258 |
| 208 | Ga0453683_0094794 | 3300044673 | Bacteria | 1872 |
| 209 | Ga0466966_0000306 | 3300044684 | Bacteria | 32023 |
| 210 | Ga0466966_0035112 | 3300044684 | Bacteria | 3241 |
| 211 | Ga0466961_0015233 | 3300044693 | Bacteria | 4937 |
| 212 | Ga0466963_0026965 | 3300044694 | Bacteria | 3675 |
| 213 | Ga0453684_0001719 | 3300044712 | Bacteria | 58720 |
| 214 | Ga0453684_0012465 | 3300044712 | Bacteria | 14010 |
| 215 | Ga0453684_0172838 | 3300044712 | Bacteria | 2544 |
| 216 | Ga0466971_0038080 | 3300044719 | Bacteria | 2157 |
| 217 | Ga0466971_0159732 | 3300044719 | Bacteria | 1055 |
| 218 | Ga0466968_0117764 | 3300044735 | Bacteria | 1200 |
| 219 | Ga0466967_0242738 | 3300045976 | Bacteria | 1719 |
| 220 | Ga0495620_0009738 | 3300046515 | Bacteria | 5100 |
| 221 | Ga0495628_0266289 | 3300046516 | Bacteria | 1276 |
| 222 | Ga0495602_0090895 | 3300048088 | Bacteria | 2534 |
| 223 | Ga0496114_0245789 | 3300048917 | Bacteria | 1574 |
| 224 | Ga0501031_0209278 | 3300049568 | Bacteria | 1271 |
| 225 | Ga0501033_0290186 | 3300049570 | Bacteria | 1153 |
| 226 | Ga0501036_0070967 | 3300049572 | Bacteria | 2945 |
| 227 | Ga0501037_0109834 | 3300049573 | Bacteria | 1987 |
| 228 | Ga0501038_0039965 | 3300049574 | Bacteria | 4100 |
| 229 | Ga0501039_0055525 | 3300049575 | Bacteria | 3067 |
| 230 | Ga0501040_0022461 | 3300049576 | Bacteria | 4221 |
| 231 | Ga0501041_0028789 | 3300049577 | Bacteria | 3351 |
| 232 | Ga0501042_0040295 | 3300049578 | Bacteria | 3321 |
| 233 | Ga0501043_0056912 | 3300049579 | Bacteria | 3071 |
| 234 | Ga0501046_0028670 | 3300049580 | Bacteria | 4532 |
| 235 | Ga0501048_0320289 | 3300049582 | Bacteria | 1104 |
| 236 | Ga0501068_0045224 | 3300049584 | Bacteria | 2652 |
| 237 | Ga0501071_0054628 | 3300049587 | Bacteria | 2881 |
| 238 | Ga0501072_0051624 | 3300049588 | Bacteria | 3237 |
| 239 | Ga0501074_0021991 | 3300049590 | Bacteria | 4632 |
| 240 | Ga0501076_0086151 | 3300049592 | Bacteria | 2524 |
| 241 | Ga0501077_0029349 | 3300049593 | Bacteria | 3496 |
| 242 | Ga0501079_0023985 | 3300049741 | Bacteria | 4679 |
| 243 | Ga0501081_0014391 | 3300049743 | Bacteria | 5218 |
| 244 | Ga0501035_0055384 | 3300049822 | Bacteria | 3541 |
| 245 | Ga0501044_0386967 | 3300049823 | Bacteria | 1313 |
| 246 | Ga0501045_0055296 | 3300049824 | Bacteria | 2902 |
| 247 | nmdc:mga07m45_409611_c1 | 3300050496 | Bacteria | 787 |
| 248 | nmdc:mga05p37_175335_c1 | 3300050507 | Bacteria | 2612 |
| 249 | nmdc:mga05p37_21635_c1 | 3300050507 | Bacteria | 7792 |
| 250 | nmdc:mga05p37_35523_c1 | 3300050507 | Bacteria | 6111 |
| 251 | nmdc:mga06r32_654736_c1 | 3300050510 | Bacteria | 1018 |
| 252 | nmdc:mga0rr50_252354_c1 | 3300050513 | Bacteria | 1465 |
| 253 | Ga0500635_0058794 | 3300053080 | Bacteria | 1336 |
| 254 | Ga0500566_0001238 | 3300053094 | Bacteria | 14946 |
| 255 | Ga0500603_004827 | 3300053150 | Bacteria | 2887 |
| 256 | Ga0501084_0110818 | 3300054114 | Bacteria | 2306 |
| 257 | Ga0501082_0189874 | 3300060353 | Bacteria | 1787 |
| 258 | Ga0466962_0004164 | 3300061719 | Bacteria | 6931 |
| 259 | Ga0530510_0063276 | 3300061734 | Bacteria | 2678 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050496 | nmdc:mga07m45_409611_c1 | nmdc:mga07m45_409611_c1_24_662 | 189 |
| 2 | 3300042876 | Ga0451577_0645921 | Ga0451577_0645921_304_948 | 193 |
| 3 | 3300032002 | Ga0307416_101030088 | Ga0307416_1010300882 | 199 |
| 4 | 3300049568 | Ga0501031_0209278 | Ga0501031_0209278_485_1183 | 204 |
| 5 | 3300049570 | Ga0501033_0290186 | Ga0501033_0290186_390_1088 | 204 |
| 6 | 3300049572 | Ga0501036_0070967 | Ga0501036_0070967_2014_2712 | 204 |
| 7 | 3300049573 | Ga0501037_0109834 | Ga0501037_0109834_1071_1769 | 204 |
| 8 | 3300049574 | Ga0501038_0039965 | Ga0501038_0039965_166_864 | 204 |
| 9 | 3300049575 | Ga0501039_0055525 | Ga0501039_0055525_2088_2786 | 204 |
| 10 | 3300049576 | Ga0501040_0022461 | Ga0501040_0022461_3210_3908 | 204 |
| 11 | 3300049577 | Ga0501041_0028789 | Ga0501041_0028789_2415_3113 | 204 |
| 12 | 3300049578 | Ga0501042_0040295 | Ga0501042_0040295_2381_3079 | 204 |
| 13 | 3300049579 | Ga0501043_0056912 | Ga0501043_0056912_191_889 | 204 |
| 14 | 3300049580 | Ga0501046_0028670 | Ga0501046_0028670_241_939 | 204 |
| 15 | 3300049582 | Ga0501048_0320289 | Ga0501048_0320289_114_812 | 204 |
| 16 | 3300049584 | Ga0501068_0045224 | Ga0501068_0045224_1500_2198 | 204 |
| 17 | 3300049587 | Ga0501071_0054628 | Ga0501071_0054628_1872_2570 | 204 |
| 18 | 3300049588 | Ga0501072_0051624 | Ga0501072_0051624_334_1032 | 204 |
| 19 | 3300049590 | Ga0501074_0021991 | Ga0501074_0021991_432_1130 | 204 |
| 20 | 3300049592 | Ga0501076_0086151 | Ga0501076_0086151_1764_2462 | 204 |
| 21 | 3300049593 | Ga0501077_0029349 | Ga0501077_0029349_2115_2813 | 204 |
| 22 | 3300049741 | Ga0501079_0023985 | Ga0501079_0023985_288_986 | 204 |
| 23 | 3300049743 | Ga0501081_0014391 | Ga0501081_0014391_3657_4355 | 204 |
| 24 | 3300049822 | Ga0501035_0055384 | Ga0501035_0055384_2378_3076 | 204 |
| 25 | 3300049824 | Ga0501045_0055296 | Ga0501045_0055296_335_1033 | 204 |
| 26 | 3300054114 | Ga0501084_0110818 | Ga0501084_0110818_443_1141 | 204 |
| 27 | 3300060353 | Ga0501082_0189874 | Ga0501082_0189874_787_1485 | 204 |
| 28 | 3300061734 | Ga0530510_0063276 | Ga0530510_0063276_95_793 | 204 |
| 29 | 3300039447 | Ga0436361_0592110 | Ga0436361_0592110_1934_2611 | 205 |
| 30 | iso_pu_bacteria | 2846037992 | 2846041249 | 206 |
| 31 | iso_pu_bacteria | 8020953355 | 8020955818 | 206 |
| 32 | iso_pu_bacteria | 8039098773 | 8039104085 | 206 |
| 33 | 3300042876 | Ga0451577_0000592 | Ga0451577_0000592_36341_37009 | 207 |
| 34 | iso_pu_bacteria | 2791355137 | 2792833780 | 207 |
| 35 | 3300024227 | Ga0228598_1023404 | Ga0228598_10234041 | 208 |
| 36 | 3300025928 | Ga0207700_10098887 | Ga0207700_100988872 | 208 |
| 37 | 3300028666 | Ga0265336_10055286 | Ga0265336_100552862 | 208 |
| 38 | 3300031344 | Ga0265316_10002711 | Ga0265316_1000271116 | 208 |
| 39 | 3300036647 | Ga0316582_0010769 | Ga0316582_0010769_905_1588 | 208 |
| 40 | 3300044712 | Ga0453684_0172838 | Ga0453684_0172838_914_1591 | 208 |
| 41 | 3300003841 | Ga0055541_1008265 | Ga0055541_10082651 | 210 |
| 42 | 3300005455 | Ga0070663_100020977 | Ga0070663_1000209772 | 210 |
| 43 | 3300005457 | Ga0070662_100000655 | Ga0070662_1000006554 | 210 |
| 44 | 3300005563 | Ga0068855_100035671 | Ga0068855_1000356715 | 210 |
| 45 | 3300005578 | Ga0068854_100109050 | Ga0068854_1001090502 | 210 |
| 46 | 3300006163 | Ga0070715_10004510 | Ga0070715_100045104 | 210 |
| 47 | 3300006173 | Ga0070716_100023101 | Ga0070716_1000231012 | 210 |
| 48 | 3300006844 | Ga0075428_100391280 | Ga0075428_1003912802 | 210 |
| 49 | 3300009551 | Ga0105238_10180576 | Ga0105238_101805762 | 210 |
| 50 | 3300013104 | Ga0157370_10051855 | Ga0157370_100518552 | 210 |
| 51 | 3300013104 | Ga0157370_10392145 | Ga0157370_103921452 | 210 |
| 52 | 3300013105 | Ga0157369_10017384 | Ga0157369_100173843 | 210 |
| 53 | 3300022467 | Ga0224712_10001554 | Ga0224712_100015542 | 210 |
| 54 | 3300025225 | Ga0209566_100508 | Ga0209566_10050816 | 210 |
| 55 | 3300025226 | Ga0209674_101665 | Ga0209674_1016652 | 210 |
| 56 | 3300025905 | Ga0207685_10026023 | Ga0207685_100260232 | 210 |
| 57 | 3300025909 | Ga0207705_10010593 | Ga0207705_100105932 | 210 |
| 58 | 3300025924 | Ga0207694_10104841 | Ga0207694_101048412 | 210 |
| 59 | 3300025933 | Ga0207706_10002120 | Ga0207706_100021206 | 210 |
| 60 | 3300025939 | Ga0207665_10049131 | Ga0207665_100491313 | 210 |
| 61 | 3300025949 | Ga0207667_10024096 | Ga0207667_100240964 | 210 |
| 62 | 3300032005 | Ga0307411_10027558 | Ga0307411_100275582 | 210 |
| 63 | 3300032126 | Ga0307415_100138985 | Ga0307415_1001389852 | 210 |
| 64 | 3300037418 | Ga0395900_0026303 | Ga0395900_0026303_3968_4675 | 210 |
| 65 | 3300037418 | Ga0395900_0100277 | Ga0395900_0100277_2126_2836 | 210 |
| 66 | 3300037418 | Ga0395900_0303032 | Ga0395900_0303032_139_849 | 210 |
| 67 | 3300037418 | Ga0395900_0644660 | Ga0395900_0644660_224_934 | 210 |
| 68 | 3300037466 | Ga0395898_0000984 | Ga0395898_0000984_41378_42085 | 210 |
| 69 | 3300037466 | Ga0395898_0092711 | Ga0395898_0092711_102_812 | 210 |
| 70 | 3300038443 | Ga0395901_0025349 | Ga0395901_0025349_854_1561 | 210 |
| 71 | 3300038443 | Ga0395901_0088364 | Ga0395901_0088364_1647_2357 | 210 |
| 72 | 3300044658 | Ga0466972_0040883 | Ga0466972_0040883_941_1648 | 210 |
| 73 | 3300044684 | Ga0466966_0000306 | Ga0466966_0000306_9346_10053 | 210 |
| 74 | 3300044694 | Ga0466963_0026965 | Ga0466963_0026965_1649_2356 | 210 |
| 75 | 3300044719 | Ga0466971_0038080 | Ga0466971_0038080_503_1210 | 210 |
| 76 | 3300049823 | Ga0501044_0386967 | Ga0501044_0386967_204_911 | 210 |
| 77 | 3300061719 | Ga0466962_0004164 | Ga0466962_0004164_5449_6156 | 210 |
| 78 | 3300005471 | Ga0070698_100179857 | Ga0070698_1001798572 | 211 |
| 79 | 3300005518 | Ga0070699_100033516 | Ga0070699_1000335163 | 211 |
| 80 | 3300006844 | Ga0075428_100098490 | Ga0075428_1000984902 | 211 |
| 81 | 3300006880 | Ga0075429_100542436 | Ga0075429_1005424362 | 211 |
| 82 | 3300009093 | Ga0105240_10045500 | Ga0105240_100455005 | 211 |
| 83 | 3300014969 | Ga0157376_10742987 | Ga0157376_107429872 | 211 |
| 84 | 3300025913 | Ga0207695_10083129 | Ga0207695_100831293 | 211 |
| 85 | 3300026035 | Ga0207703_10376695 | Ga0207703_103766951 | 211 |
| 86 | 3300026041 | Ga0207639_10000013 | Ga0207639_1000001392 | 211 |
| 87 | 3300028381 | Ga0268264_10426689 | Ga0268264_104266891 | 211 |
| 88 | 3300028556 | Ga0265337_1000129 | Ga0265337_10001299 | 211 |
| 89 | 3300028556 | Ga0265337_1023235 | Ga0265337_10232352 | 211 |
| 90 | 3300028558 | Ga0265326_10000475 | Ga0265326_1000047510 | 211 |
| 91 | 3300028558 | Ga0265326_10003038 | Ga0265326_100030383 | 211 |
| 92 | 3300028563 | Ga0265319_1000159 | Ga0265319_100015928 | 211 |
| 93 | 3300028563 | Ga0265319_1000200 | Ga0265319_100020016 | 211 |
| 94 | 3300028563 | Ga0265319_1037720 | Ga0265319_10377202 | 211 |
| 95 | 3300028573 | Ga0265334_10001816 | Ga0265334_100018163 | 211 |
| 96 | 3300028573 | Ga0265334_10068221 | Ga0265334_100682211 | 211 |
| 97 | 3300028577 | Ga0265318_10000489 | Ga0265318_100004899 | 211 |
| 98 | 3300028577 | Ga0265318_10002984 | Ga0265318_100029845 | 211 |
| 99 | 3300028653 | Ga0265323_10001181 | Ga0265323_100011818 | 211 |
| 100 | 3300028654 | Ga0265322_10000258 | Ga0265322_100002585 | 211 |
| 101 | 3300028666 | Ga0265336_10000243 | Ga0265336_1000024320 | 211 |
| 102 | 3300028666 | Ga0265336_10042956 | Ga0265336_100429562 | 211 |
| 103 | 3300028800 | Ga0265338_10000124 | Ga0265338_1000012411 | 211 |
| 104 | 3300028800 | Ga0265338_10001040 | Ga0265338_1000104027 | 211 |
| 105 | 3300028800 | Ga0265338_10010438 | Ga0265338_100104386 | 211 |
| 106 | 3300028800 | Ga0265338_10070949 | Ga0265338_100709493 | 211 |
| 107 | 3300029957 | Ga0265324_10001479 | Ga0265324_100014795 | 211 |
| 108 | 3300029957 | Ga0265324_10001722 | Ga0265324_1000172211 | 211 |
| 109 | 3300029957 | Ga0265324_10032099 | Ga0265324_100320992 | 211 |
| 110 | 3300029957 | Ga0265324_10053990 | Ga0265324_100539901 | 211 |
| 111 | 3300031235 | Ga0265330_10000308 | Ga0265330_100003087 | 211 |
| 112 | 3300031238 | Ga0265332_10000295 | Ga0265332_1000029522 | 211 |
| 113 | 3300031238 | Ga0265332_10060121 | Ga0265332_100601211 | 211 |
| 114 | 3300031239 | Ga0265328_10000911 | Ga0265328_100009118 | 211 |
| 115 | 3300031240 | Ga0265320_10002698 | Ga0265320_100026987 | 211 |
| 116 | 3300031240 | Ga0265320_10002903 | Ga0265320_100029038 | 211 |
| 117 | 3300031241 | Ga0265325_10000923 | Ga0265325_100009238 | 211 |
| 118 | 3300031242 | Ga0265329_10001005 | Ga0265329_100010055 | 211 |
| 119 | 3300031247 | Ga0265340_10000196 | Ga0265340_1000019616 | 211 |
| 120 | 3300031249 | Ga0265339_10000638 | Ga0265339_100006388 | 211 |
| 121 | 3300031249 | Ga0265339_10104973 | Ga0265339_101049732 | 211 |
| 122 | 3300031250 | Ga0265331_10002457 | Ga0265331_100024575 | 211 |
| 123 | 3300031251 | Ga0265327_10086948 | Ga0265327_100869482 | 211 |
| 124 | 3300031344 | Ga0265316_10003621 | Ga0265316_100036217 | 211 |
| 125 | 3300031344 | Ga0265316_10004570 | Ga0265316_100045703 | 211 |
| 126 | 3300031595 | Ga0265313_10000542 | Ga0265313_1000054217 | 211 |
| 127 | 3300031595 | Ga0265313_10022967 | Ga0265313_100229672 | 211 |
| 128 | 3300031595 | Ga0265313_10033172 | Ga0265313_100331722 | 211 |
| 129 | 3300031711 | Ga0265314_10007178 | Ga0265314_100071785 | 211 |
| 130 | 3300031711 | Ga0265314_10024203 | Ga0265314_100242035 | 211 |
| 131 | 3300031711 | Ga0265314_10088840 | Ga0265314_100888402 | 211 |
| 132 | 3300031712 | Ga0265342_10001986 | Ga0265342_100019868 | 211 |
| 133 | 3300031712 | Ga0265342_10009919 | Ga0265342_100099194 | 211 |
| 134 | 3300035170 | Ga0373943_0059953 | Ga0373943_0059953_366_1121 | 211 |
| 135 | 3300044712 | Ga0453684_0001719 | Ga0453684_0001719_43017_43724 | 211 |
| 136 | 3300044735 | Ga0466968_0117764 | Ga0466968_0117764_491_1177 | 211 |
| 137 | 3300050507 | nmdc:mga05p37_175335_c1 | nmdc:mga05p37_175335_c1_276_968 | 211 |
| 138 | 3300003320 | rootH2_10079561 | rootH2_100795616 | 212 |
| 139 | 3300006852 | Ga0075433_10179051 | Ga0075433_101790512 | 212 |
| 140 | 3300009147 | Ga0114129_10026563 | Ga0114129_100265633 | 212 |
| 141 | 3300039447 | Ga0436361_1164747 | Ga0436361_1164747_283_1020 | 212 |
| 142 | 3300050507 | nmdc:mga05p37_35523_c1 | nmdc:mga05p37_35523_c1_3777_4475 | 212 |
| 143 | 3300005434 | Ga0070709_10396753 | Ga0070709_103967531 | 213 |
| 144 | 3300005445 | Ga0070708_100801490 | Ga0070708_1008014901 | 213 |
| 145 | 3300005577 | Ga0068857_100106588 | Ga0068857_1001065883 | 213 |
| 146 | 3300006844 | Ga0075428_100084720 | Ga0075428_1000847202 | 213 |
| 147 | 3300026116 | Ga0207674_10136377 | Ga0207674_101363771 | 213 |
| 148 | 3300028800 | Ga0265338_10014237 | Ga0265338_100142372 | 213 |
| 149 | 3300031595 | Ga0265313_10134576 | Ga0265313_101345762 | 213 |
| 150 | 3300031616 | Ga0307508_10125322 | Ga0307508_101253222 | 213 |
| 151 | 3300039437 | Ga0436365_1626974 | Ga0436365_1626974_319_1020 | 213 |
| 152 | 3300042876 | Ga0451577_0536802 | Ga0451577_0536802_280_993 | 213 |
| 153 | 3300044673 | Ga0453683_0094794 | Ga0453683_0094794_24_737 | 213 |
| 154 | 3300044712 | Ga0453684_0012465 | Ga0453684_0012465_12489_13202 | 213 |
| 155 | 3300046515 | Ga0495620_0009738 | Ga0495620_0009738_379_1089 | 213 |
| 156 | 3300005614 | Ga0068856_100003273 | Ga0068856_1000032734 | 214 |
| 157 | 3300005614 | Ga0068856_100144353 | Ga0068856_1001443533 | 214 |
| 158 | 3300013105 | Ga0157369_10218169 | Ga0157369_102181692 | 214 |
| 159 | 3300026078 | Ga0207702_10013611 | Ga0207702_100136113 | 214 |
| 160 | 3300026078 | Ga0207702_10237688 | Ga0207702_102376882 | 214 |
| 161 | 3300031727 | Ga0316576_10068957 | Ga0316576_100689572 | 214 |
| 162 | 3300044684 | Ga0466966_0035112 | Ga0466966_0035112_850_1575 | 214 |
| 163 | 3300005328 | Ga0070676_10009900 | Ga0070676_100099006 | 215 |
| 164 | 3300005331 | Ga0070670_100047107 | Ga0070670_1000471073 | 215 |
| 165 | 3300005338 | Ga0068868_100054190 | Ga0068868_1000541903 | 215 |
| 166 | 3300005354 | Ga0070675_100099001 | Ga0070675_1000990011 | 215 |
| 167 | 3300005355 | Ga0070671_100070078 | Ga0070671_1000700782 | 215 |
| 168 | 3300005364 | Ga0070673_100050157 | Ga0070673_1000501573 | 215 |
| 169 | 3300005456 | Ga0070678_100088281 | Ga0070678_1000882812 | 215 |
| 170 | 3300005457 | Ga0070662_100341482 | Ga0070662_1003414822 | 215 |
| 171 | 3300005459 | Ga0068867_100007443 | Ga0068867_1000074433 | 215 |
| 172 | 3300005543 | Ga0070672_100237331 | Ga0070672_1002373312 | 215 |
| 173 | 3300005577 | Ga0068857_100239483 | Ga0068857_1002394832 | 215 |
| 174 | 3300006844 | Ga0075428_100942070 | Ga0075428_1009420701 | 215 |
| 175 | 3300006881 | Ga0068865_100733748 | Ga0068865_1007337481 | 215 |
| 176 | 3300013297 | Ga0157378_10395875 | Ga0157378_103958752 | 215 |
| 177 | 3300013306 | Ga0163162_10680838 | Ga0163162_106808382 | 215 |
| 178 | 3300013308 | Ga0157375_10134670 | Ga0157375_101346702 | 215 |
| 179 | 3300025907 | Ga0207645_10001447 | Ga0207645_100014476 | 215 |
| 180 | 3300025923 | Ga0207681_10224505 | Ga0207681_102245052 | 215 |
| 181 | 3300025925 | Ga0207650_10216078 | Ga0207650_102160782 | 215 |
| 182 | 3300025926 | Ga0207659_10436928 | Ga0207659_104369282 | 215 |
| 183 | 3300025931 | Ga0207644_10062462 | Ga0207644_100624622 | 215 |
| 184 | 3300025938 | Ga0207704_10197692 | Ga0207704_101976921 | 215 |
| 185 | 3300025940 | Ga0207691_10055148 | Ga0207691_100551483 | 215 |
| 186 | 3300025942 | Ga0207689_10029161 | Ga0207689_100291613 | 215 |
| 187 | 3300026023 | Ga0207677_10149434 | Ga0207677_101494342 | 215 |
| 188 | 3300026089 | Ga0207648_10020800 | Ga0207648_100208005 | 215 |
| 189 | 3300026116 | Ga0207674_10057122 | Ga0207674_100571222 | 215 |
| 190 | 3300026121 | Ga0207683_10265064 | Ga0207683_102650642 | 215 |
| 191 | 3300028794 | Ga0307515_10079810 | Ga0307515_100798103 | 215 |
| 192 | 3300031456 | Ga0307513_10003474 | Ga0307513_1000347410 | 215 |
| 193 | 3300045976 | Ga0466967_0242738 | Ga0466967_0242738_526_1233 | 215 |
| 194 | 3300050510 | nmdc:mga06r32_654736_c1 | nmdc:mga06r32_654736_c1_255_947 | 215 |
| 195 | 3300003323 | rootH1_10236157 | rootH1_102361572 | 216 |
| 196 | 3300003659 | JGI25404J52841_10025911 | JGI25404J52841_100259112 | 216 |
| 197 | 3300005471 | Ga0070698_100098120 | Ga0070698_1000981202 | 216 |
| 198 | 3300005983 | Ga0081540_1000242 | Ga0081540_100024224 | 216 |
| 199 | 3300006028 | Ga0070717_10379812 | Ga0070717_103798121 | 216 |
| 200 | 3300006914 | Ga0075436_100252990 | Ga0075436_1002529902 | 216 |
| 201 | 3300009093 | Ga0105240_10054921 | Ga0105240_100549211 | 216 |
| 202 | 3300025913 | Ga0207695_10459336 | Ga0207695_104593361 | 216 |
| 203 | 3300028577 | Ga0265318_10000052 | Ga0265318_100000523 | 216 |
| 204 | 3300031691 | Ga0316579_10001991 | Ga0316579_100019914 | 216 |
| 205 | 3300032133 | Ga0316583_10050199 | Ga0316583_100501992 | 216 |
| 206 | 3300035172 | Ga0373955_0349296 | Ga0373955_0349296_57_743 | 216 |
| 207 | 3300037068 | Ga0373925_0167718 | Ga0373925_0167718_869_1579 | 216 |
| 208 | 3300044656 | Ga0466969_0000625 | Ga0466969_0000625_885_1598 | 216 |
| 209 | 3300044693 | Ga0466961_0015233 | Ga0466961_0015233_4164_4877 | 216 |
| 210 | 3300046516 | Ga0495628_0266289 | Ga0495628_0266289_543_1232 | 216 |
| 211 | 3300048088 | Ga0495602_0090895 | Ga0495602_0090895_1835_2524 | 216 |
| 212 | 3300050513 | nmdc:mga0rr50_252354_c1 | nmdc:mga0rr50_252354_c1_288_998 | 216 |
| 213 | 3300031235 | Ga0265330_10077097 | Ga0265330_100770972 | 217 |
| 214 | 3300031238 | Ga0265332_10113636 | Ga0265332_101136362 | 217 |
| 215 | 3300031241 | Ga0265325_10008296 | Ga0265325_100082962 | 217 |
| 216 | 3300031247 | Ga0265340_10002349 | Ga0265340_100023493 | 217 |
| 217 | 3300031247 | Ga0265340_10105099 | Ga0265340_101050991 | 217 |
| 218 | 3300031344 | Ga0265316_10126467 | Ga0265316_101264673 | 217 |
| 219 | 3300031711 | Ga0265314_10000188 | Ga0265314_1000018874 | 217 |
| 220 | 3300031712 | Ga0265342_10040091 | Ga0265342_100400911 | 217 |
| 221 | 3300031712 | Ga0265342_10154289 | Ga0265342_101542892 | 217 |
| 222 | 3300031730 | Ga0307516_10019855 | Ga0307516_100198553 | 217 |
| 223 | 3300031247 | Ga0265340_10000276 | Ga0265340_100002764 | 218 |
| 224 | 3300031247 | Ga0265340_10023531 | Ga0265340_100235313 | 218 |
| 225 | 3300031344 | Ga0265316_10005723 | Ga0265316_1000572312 | 218 |
| 226 | 3300031344 | Ga0265316_10069238 | Ga0265316_100692382 | 218 |
| 227 | 3300031712 | Ga0265342_10038560 | Ga0265342_100385601 | 218 |
| 228 | 3300031712 | Ga0265342_10142875 | Ga0265342_101428751 | 218 |
| 229 | 3300044719 | Ga0466971_0159732 | Ga0466971_0159732_218_1012 | 218 |
| 230 | 3300005548 | Ga0070665_100033553 | Ga0070665_1000335532 | 219 |
| 231 | 3300028379 | Ga0268266_10035113 | Ga0268266_100351132 | 219 |
| 232 | 3300031241 | Ga0265325_10145011 | Ga0265325_101450111 | 219 |
| 233 | 3300031730 | Ga0307516_10099585 | Ga0307516_100995853 | 219 |
| 234 | 3300031235 | Ga0265330_10001694 | Ga0265330_100016949 | 220 |
| 235 | 3300031507 | Ga0307509_10305860 | Ga0307509_103058602 | 222 |
| 236 | 3300036401 | Ga0373937_0493881 | Ga0373937_0493881_153_899 | 222 |
| 237 | 3300053080 | Ga0500635_0058794 | Ga0500635_0058794_63_794 | 222 |
| 238 | 3300053094 | Ga0500566_0001238 | Ga0500566_0001238_13385_14116 | 222 |
| 239 | 3300053150 | Ga0500603_004827 | Ga0500603_004827_672_1403 | 222 |
| 240 | 3300005468 | Ga0070707_100141047 | Ga0070707_1001410473 | 223 |
| 241 | 3300005518 | Ga0070699_100838593 | Ga0070699_1008385931 | 223 |
| 242 | 3300009147 | Ga0114129_10045864 | Ga0114129_100458646 | 223 |
| 243 | 3300028556 | Ga0265337_1038462 | Ga0265337_10384622 | 223 |
| 244 | 3300029957 | Ga0265324_10086357 | Ga0265324_100863571 | 223 |
| 245 | 3300031241 | Ga0265325_10004975 | Ga0265325_100049753 | 223 |
| 246 | 3300031247 | Ga0265340_10006057 | Ga0265340_100060572 | 223 |
| 247 | 3300031249 | Ga0265339_10034781 | Ga0265339_100347812 | 223 |
| 248 | 3300031250 | Ga0265331_10007280 | Ga0265331_100072804 | 223 |
| 249 | 3300031711 | Ga0265314_10000015 | Ga0265314_1000001576 | 223 |
| 250 | 3300031712 | Ga0265342_10000117 | Ga0265342_1000011722 | 223 |
| 251 | 3300031712 | Ga0265342_10071840 | Ga0265342_100718403 | 223 |
| 252 | 3300048917 | Ga0496114_0245789 | Ga0496114_0245789_631_1377 | 223 |
| 253 | 3300050507 | nmdc:mga05p37_21635_c1 | nmdc:mga05p37_21635_c1_3137_3883 | 223 |
| 254 | 3300028573 | Ga0265334_10000128 | Ga0265334_1000012840 | 224 |
| 255 | 3300031852 | Ga0307410_10408975 | Ga0307410_104089752 | 224 |
| 256 | 3300035117 | Ga0373953_0056182 | Ga0373953_0056182_77_808 | 224 |
| 257 | 3300035724 | Ga0373933_0024462 | Ga0373933_0024462_116_847 | 224 |
| 258 | 3300041997 | Ga0439431_0062103 | Ga0439431_0062103_90_914 | 224 |
| 259 | 3300002741 | JGI25157J39369_1000556 | JGI25157J39369_10005565 | 227 |
| 260 | 3300014497 | Ga0182008_10024253 | Ga0182008_100242534 | 227 |
| 261 | 3300025226 | Ga0209674_100984 | Ga0209674_1009844 | 227 |
| 262 | 3300025250 | Ga0209026_1000017 | Ga0209026_1000017261 | 227 |
| 263 | 3300025256 | Ga0209759_1006403 | Ga0209759_10064034 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9754 | 16 | 221 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9668 | 18 | 217 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9649 | 16 | 222 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9644 | 16 | 221 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9634 | 16 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8T665_1_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9745 | 15 | 221 | 3.40.50.300 |
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9714 | 17 | 217 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9664 | 44 | 218 | 3.40.50.300 |
| af_Q8T664_36_360_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9661 | 16 | 218 | 3.40.50.300 |
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9649 | 16 | 222 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9TM51-F1-model_v4 | ABC transporter ATP-binding protein | 0.9793 | 36 | 222 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7X9B9P8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9712 | 16 | 120 |
GO:0005524
GO:0016887 |
| AF-A0A1F8CYG4-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9702 | 53 | 218 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7C0XLY7-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9696 | 101 | 221 |
GO:0005524
GO:0016887 GO:0022857 GO:0043190 |
| AF-A0A538BD68-F1-model_v4 | ABC transporter ATP-binding protein | 0.9681 | 18 | 223 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar