F371708

General Info

Members Datasets Scaffolds Average Seq Length
263 186 526 126

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100167340|Ga0070693_1001673402
Length 154
Sequence MLITLVVLGSLSFRQFAGPSPNFIIMEVKTNTKEKFHVITLPGPSLSASMTEDLAGCLMPYLQNDVKNVVLNLKDIRDIDNAAAEKLVWVQQRFYENSASFVVCELQNSVEVFLDQGELLEIMNVTPTESEAWDIVQMEEIERELLDDGEDSIS

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
136 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
158 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
163 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
164 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
165 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
166 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
167 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
168 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
169 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
172 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
173 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
174 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
175 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
176 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
177 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
186 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 1.52
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100167340 3300005547 Unclassified 1405
2 Ga0065712_10019297 3300005290 Bacteria 1700
3 Ga0065715_10372251 3300005293 Bacteria 911
4 Ga0065707_10148978 3300005295 Bacteria 1680
5 Ga0065707_10285946 3300005295 Bacteria 995
6 Ga0070658_11321940 3300005327 Bacteria 626
7 Ga0070676_11061445 3300005328 Bacteria 610
8 Ga0070683_100000768 3300005329 Bacteria 23596
9 Ga0070690_100515715 3300005330 Bacteria 896
10 Ga0070670_100590122 3300005331 Bacteria 993
11 Ga0068869_100239328 3300005334 Bacteria 1445
12 Ga0070682_100086492 3300005337 Bacteria 2042
13 Ga0070682_100341972 3300005337 Bacteria 1112
14 Ga0070682_101491404 3300005337 Bacteria 581
15 Ga0068868_100571556 3300005338 Bacteria 998
16 Ga0070689_100328168 3300005340 Bacteria 1279
17 Ga0070687_100291553 3300005343 Bacteria 1031
18 Ga0070687_100299324 3300005343 Bacteria 1020
19 Ga0070687_100346749 3300005343 Bacteria 957
20 Ga0070661_100001800 3300005344 Bacteria 14871
21 Ga0070692_10309812 3300005345 Bacteria 967
22 Ga0070669_100085032 3300005353 Bacteria 2362
23 Ga0070669_100133470 3300005353 Bacteria 1907
24 Ga0070675_100352424 3300005354 Bacteria 1305
25 Ga0070671_100410867 3300005355 Bacteria 1158
26 Ga0070674_100612200 3300005356 Bacteria 922
27 Ga0070673_100097257 3300005364 Bacteria 2417
28 Ga0070667_100245592 3300005367 Bacteria 1599
29 Ga0070700_100429951 3300005441 Bacteria 1000
30 Ga0070700_100756351 3300005441 Bacteria 778
31 Ga0070694_101139746 3300005444 Bacteria 652
32 Ga0070662_101324922 3300005457 Bacteria 620
33 Ga0068867_100873585 3300005459 Unclassified 807
34 Ga0070685_10231071 3300005466 Bacteria 1216
35 Ga0070706_101122075 3300005467 Bacteria 724
36 Ga0070707_101345512 3300005468 Bacteria 680
37 Ga0070698_100001350 3300005471 Bacteria 27279
38 Ga0070698_100031910 3300005471 Bacteria 5459
39 Ga0070698_100069971 3300005471 Bacteria 3522
40 Ga0070684_100000722 3300005535 Bacteria 22897
41 Ga0070697_100180514 3300005536 Bacteria 1789
42 Ga0068853_100011075 3300005539 Bacteria 7313
43 Ga0068853_100499113 3300005539 Bacteria 1149
44 Ga0070672_100432576 3300005543 Bacteria 1131
45 Ga0070672_100863534 3300005543 Bacteria 798
46 Ga0070693_100234252 3300005547 Bacteria 1209
47 Ga0070693_101525411 3300005547 Bacteria 523
48 Ga0070665_100844587 3300005548 Bacteria 929
49 Ga0070704_101013124 3300005549 Bacteria 751
50 Ga0070664_100003443 3300005564 Bacteria 12791
51 Ga0068857_100003827 3300005577 Bacteria 12663
52 Ga0068857_101510736 3300005577 Bacteria 654
53 Ga0068854_101128334 3300005578 Bacteria 700
54 Ga0068856_100475011 3300005614 Bacteria 1271
55 Ga0068856_100656101 3300005614 Bacteria 1070
56 Ga0070702_100678731 3300005615 Bacteria 782
57 Ga0068852_100431323 3300005616 Bacteria 1302
58 Ga0068852_100532019 3300005616 Bacteria 1174
59 Ga0068859_100240264 3300005617 Bacteria 1900
60 Ga0068864_100581147 3300005618 Bacteria 1085
61 Ga0068861_100272544 3300005719 Bacteria 1454
62 Ga0068861_100851697 3300005719 Bacteria 859
63 Ga0068861_101679712 3300005719 Bacteria 627
64 Ga0068870_10412583 3300005840 Unclassified 881
65 Ga0068870_10440877 3300005840 Bacteria 856
66 Ga0068863_100084991 3300005841 Bacteria 2999
67 Ga0068860_100607398 3300005843 Bacteria 1099
68 Ga0075432_10130989 3300006058 Bacteria 950
69 Ga0068871_100460316 3300006358 Bacteria 1141
70 Ga0068871_100712130 3300006358 Bacteria 920
71 Ga0075428_100219479 3300006844 Bacteria 2053
72 Ga0075428_100228840 3300006844 Bacteria 2006
73 Ga0075428_100386757 3300006844 Bacteria 1500
74 Ga0075430_100016950 3300006846 Bacteria 6203
75 Ga0075431_100081381 3300006847 Bacteria 3344
76 Ga0075429_100115499 3300006880 Bacteria 2346
77 Ga0075429_100796654 3300006880 Unclassified 827
78 Ga0097620_100240273 3300006931 Bacteria 1900
79 Ga0097620_100411687 3300006931 Bacteria 1448
80 Ga0097620_101664237 3300006931 Bacteria 705
81 Ga0105251_10606157 3300009011 Bacteria 520
82 Ga0105244_10292572 3300009036 Bacteria 754
83 Ga0111539_10711315 3300009094 Bacteria 1169
84 Ga0111539_10751604 3300009094 Bacteria 1135
85 Ga0111539_11445791 3300009094 Bacteria 797
86 Ga0105247_11464954 3300009101 Unclassified 555
87 Ga0114129_10761857 3300009147 Bacteria 1238
88 Ga0114129_10992623 3300009147 Bacteria 1058
89 Ga0105243_10921310 3300009148 Bacteria 871
90 Ga0105242_12213628 3300009176 Bacteria 595
91 Ga0105248_10463534 3300009177 Bacteria 1428
92 Ga0105237_12027020 3300009545 Unclassified 584
93 Ga0105238_12587994 3300009551 Bacteria 544
94 Ga0105249_10096802 3300009553 Bacteria 2770
95 Ga0157373_10058987 3300013100 Unclassified 2720
96 Ga0157371_10062497 3300013102 Bacteria 2640
97 Ga0157371_10288005 3300013102 Bacteria 1187
98 Ga0157370_10054492 3300013104 Bacteria 3812
99 Ga0157370_10250125 3300013104 Bacteria 1639
100 Ga0157370_10837144 3300013104 Bacteria 836
101 Ga0157369_11093640 3300013105 Bacteria 815
102 Ga0157369_12328740 3300013105 Unclassified 543
103 Ga0157374_10796350 3300013296 Bacteria 961
104 Ga0163162_10859337 3300013306 Bacteria 1022
105 Ga0157372_10336658 3300013307 Bacteria 1758
106 Ga0157372_10342942 3300013307 Bacteria 1740
107 Ga0157372_10346490 3300013307 Bacteria 1731
108 Ga0157372_10942467 3300013307 Bacteria 1001
109 Ga0157372_11265748 3300013307 Unclassified 852
110 Ga0157372_11665057 3300013307 Bacteria 734
111 Ga0157372_12158783 3300013307 Bacteria 640
112 Ga0157372_12365646 3300013307 Bacteria 610
113 Ga0157372_13107735 3300013307 Bacteria 530
114 Ga0157375_13475978 3300013308 Unclassified 524
115 Ga0163163_10201391 3300014325 Bacteria 2039
116 Ga0163163_12218848 3300014325 Bacteria 608
117 Ga0157380_10160927 3300014326 Bacteria 1951
118 Ga0157380_10469866 3300014326 Bacteria 1213
119 Ga0157380_10503908 3300014326 Bacteria 1177
120 Ga0157380_10746538 3300014326 Bacteria 989
121 Ga0157379_10811921 3300014968 Bacteria 883
122 Ga0157376_12471093 3300014969 Bacteria 559
123 Ga0157376_13014068 3300014969 Bacteria 510
124 Ga0207653_10163669 3300025885 Bacteria 825
125 Ga0207682_10055271 3300025893 Bacteria 1650
126 Ga0207688_10695557 3300025901 Bacteria 643
127 Ga0207685_10214370 3300025905 Bacteria 912
128 Ga0207643_10017230 3300025908 Bacteria 3947
129 Ga0207705_10154974 3300025909 Bacteria 1718
130 Ga0207662_10089787 3300025918 Bacteria 1888
131 Ga0207662_10349919 3300025918 Bacteria 992
132 Ga0207662_10462625 3300025918 Bacteria 869
133 Ga0207649_10003318 3300025920 Bacteria 8812
134 Ga0207652_10572692 3300025921 Bacteria 1014
135 Ga0207681_10094940 3300025923 Bacteria 2138
136 Ga0207650_10396132 3300025925 Bacteria 1142
137 Ga0207659_10110862 3300025926 Bacteria 2086
138 Ga0207644_10208651 3300025931 Bacteria 1544
139 Ga0207706_10378128 3300025933 Bacteria 1229
140 Ga0207686_10000502 3300025934 Bacteria 25653
141 Ga0207670_10112684 3300025936 Bacteria 1963
142 Ga0207670_10593431 3300025936 Bacteria 909
143 Ga0207691_10047545 3300025940 Bacteria 3937
144 Ga0207711_11216146 3300025941 Bacteria 695
145 Ga0207689_10036355 3300025942 Bacteria 4089
146 Ga0207689_10200843 3300025942 Unclassified 1645
147 Ga0207661_10019629 3300025944 Bacteria 5043
148 Ga0207679_10004004 3300025945 Bacteria 9150
149 Ga0207651_10157010 3300025960 Bacteria 1778
150 Ga0207712_10049957 3300025961 Bacteria 2918
151 Ga0207640_10170222 3300025981 Bacteria 1622
152 Ga0207658_10066648 3300025986 Bacteria 2709
153 Ga0207639_10039963 3300026041 Bacteria 3498
154 Ga0207639_10053575 3300026041 Bacteria 3079
155 Ga0207639_10564224 3300026041 Bacteria 1046
156 Ga0207708_10249569 3300026075 Bacteria 1430
157 Ga0207708_10655185 3300026075 Bacteria 894
158 Ga0207708_11018453 3300026075 Bacteria 720
159 Ga0207702_10321659 3300026078 Bacteria 1473
160 Ga0207641_10000699 3300026088 Bacteria 36129
161 Ga0207641_10087846 3300026088 Bacteria 2713
162 Ga0207648_10759966 3300026089 Bacteria 901
163 Ga0207648_11269594 3300026089 Unclassified 692
164 Ga0207674_10004173 3300026116 Bacteria 17465
165 Ga0207674_10185986 3300026116 Unclassified 2028
166 Ga0207674_11118063 3300026116 Bacteria 757
167 Ga0207675_100243018 3300026118 Bacteria 1740
168 Ga0207675_100294134 3300026118 Bacteria 1580
169 Ga0207675_100377464 3300026118 Unclassified 1393
170 Ga0207683_10297052 3300026121 Bacteria 1478
171 Ga0207698_10335470 3300026142 Bacteria 1422
172 Ga0210000_1061663 3300027462 Bacteria 607
173 Ga0207428_10575412 3300027907 Unclassified 813
174 Ga0268266_10919479 3300028379 Bacteria 846
175 Ga0268265_10063260 3300028380 Bacteria 2846
176 Ga0268265_10513715 3300028380 Bacteria 1131
177 Ga0268264_10642881 3300028381 Bacteria 1049
178 Ga0265340_10127502 3300031247 Unclassified 1168
179 Ga0265327_10447643 3300031251 Bacteria 558
180 Ga0307513_10394420 3300031456 Bacteria 1120
181 Ga0265313_10104939 3300031595 Unclassified 1249
182 Ga0307405_10142222 3300031731 Bacteria 1675
183 Ga0307406_10100538 3300031901 Bacteria 1969
184 Ga0307407_10162112 3300031903 Bacteria 1464
185 Ga0307412_10708407 3300031911 Bacteria 865
186 Ga0307409_100651732 3300031995 Bacteria 1047
187 Ga0307409_101309328 3300031995 Bacteria 750
188 Ga0307416_100406721 3300032002 Bacteria 1400
189 Ga0307415_100423168 3300032126 Bacteria 1144
190 Ga0373945_0395123 3300035116 Bacteria 605
191 Ga0373937_0433323 3300036401 Bacteria 1248
192 Ga0373937_1522458 3300036401 Unclassified 616
193 Ga0395905_0009979 3300037471 Bacteria 9254
194 Ga0395905_1037101 3300037471 Bacteria 723
195 Ga0395905_1526327 3300037471 Bacteria 572
196 Ga0395901_1228528 3300038443 Bacteria 714
197 Ga0436365_0324365 3300039437 Bacteria 756
198 Ga0436365_0858395 3300039437 Unclassified 958
199 Ga0451793_1845966 3300041452 Bacteria 679
200 Ga0451798_0334891 3300041458 Bacteria 1282
201 Ga0451804_0672648 3300041463 Unclassified 899
202 Ga0451807_1663025 3300041486 Bacteria 1952
203 Ga0451833_0435634 3300041491 Bacteria 687
204 Ga0451845_0618472 3300041501 Unclassified 751
205 Ga0451853_3355516 3300041512 Bacteria 540
206 Ga0439455_0111260 3300042012 Bacteria 762
207 Ga0439460_0184629 3300042461 Unclassified 706
208 Ga0466965_0620118 3300044683 Bacteria 616
209 Ga0453684_0199463 3300044712 Bacteria 2334
210 Ga0453684_0802416 3300044712 Bacteria 1015
211 Ga0466957_1234812 3300044842 Bacteria 541
212 Ga0495603_0235680 3300046455 Bacteria 1055
213 Ga0495650_0239652 3300046471 Unclassified 620
214 Ga0495644_0115179 3300046523 Unclassified 1021
215 Ga0495663_0175046 3300046525 Bacteria 741
216 Ga0495642_0530362 3300046528 Bacteria 522
217 Ga0495586_0574780 3300046535 Bacteria 651
218 Ga0495598_0014265 3300046537 Bacteria 1985
219 Ga0495598_0114629 3300046537 Bacteria 907
220 Ga0495621_0162001 3300046539 Bacteria 885
221 Ga0495670_0112966 3300046691 Bacteria 1407
222 Ga0495672_0028875 3300047320 Bacteria 3502
223 Ga0495676_0627199 3300047321 Bacteria 699
224 Ga0501291_059977 3300049514 Unclassified 714
225 Ga0501291_084317 3300049514 Bacteria 638
226 Ga0501201_022883 3300049651 Bacteria 672
227 Ga0501202_010732 3300049652 Bacteria 1705
228 Ga0501206_077952 3300049653 Bacteria 571
229 Ga0501217_007656 3300049661 Bacteria 2320
230 Ga0501217_061948 3300049661 Bacteria 1001
231 Ga0501233_113746 3300049668 Bacteria 726
232 Ga0501242_012786 3300049674 Bacteria 1025
233 Ga0501250_018023 3300049680 Bacteria 891
234 Ga0501252_039437 3300049682 Bacteria 680
235 Ga0501253_107594 3300049683 Bacteria 661
236 Ga0501253_220073 3300049683 Bacteria 508
237 Ga0501256_007240 3300049685 Bacteria 1016
238 Ga0501257_026708 3300049686 Bacteria 1379
239 Ga0501257_038575 3300049686 Bacteria 1168
240 Ga0501257_183114 3300049686 Unclassified 594
241 Ga0501221_008752 3300049704 Bacteria 1765
242 Ga0501225_0030163 3300049705 Bacteria 1491
243 Ga0501234_009216 3300049707 Bacteria 1539
244 Ga0501234_053907 3300049707 Bacteria 673
245 Ga0501264_015856 3300049761 Bacteria 763
246 Ga0501266_003258 3300049763 Bacteria 2020
247 Ga0501270_017048 3300049767 Bacteria 1059
248 Ga0501274_010646 3300049771 Bacteria 850
249 Ga0501275_087129 3300049772 Bacteria 514
250 Ga0501279_102119 3300049775 Unclassified 518
251 nmdc:mga05p37_212925_c1 3300050507 Bacteria 2335
252 nmdc:mga05p37_660069_c1 3300050507 Bacteria 1169
253 nmdc:mga09592_175111_c1 3300050508 Bacteria 1856
254 nmdc:mga09592_340598_c1 3300050508 Bacteria 1298
255 nmdc:mga09592_546801_c1 3300050508 Unclassified 995
256 nmdc:mga0qj67_52627_c1 3300050509 Bacteria 3223
257 nmdc:mga06r32_201712_c1 3300050510 Bacteria 1977
258 nmdc:mga08y16_1386491_c1 3300050511 Bacteria 667
259 nmdc:mga08y16_65982_c1 3300050511 Bacteria 3777
260 Ga0500583_0038983 3300053092 Bacteria 2143
261 Ga0500595_160177 3300053119 Bacteria 627
262 Ga0500611_000074 3300053727 Bacteria 39951
263 2929157706 2929154850 Bacteria 6753285
264 Ga0070693_100167340
265 Ga0065712_10019297
266 Ga0065715_10372251
267 Ga0065707_10148978
268 Ga0065707_10285946
269 Ga0070658_11321940
270 Ga0070676_11061445
271 Ga0070683_100000768
272 Ga0070690_100515715
273 Ga0070670_100590122
274 Ga0068869_100239328
275 Ga0070682_100086492
276 Ga0070682_100341972
277 Ga0070682_101491404
278 Ga0068868_100571556
279 Ga0070689_100328168
280 Ga0070687_100291553
281 Ga0070687_100299324
282 Ga0070687_100346749
283 Ga0070661_100001800
284 Ga0070692_10309812
285 Ga0070669_100085032
286 Ga0070669_100133470
287 Ga0070675_100352424
288 Ga0070671_100410867
289 Ga0070674_100612200
290 Ga0070673_100097257
291 Ga0070667_100245592
292 Ga0070700_100429951
293 Ga0070700_100756351
294 Ga0070694_101139746
295 Ga0070662_101324922
296 Ga0068867_100873585
297 Ga0070685_10231071
298 Ga0070706_101122075
299 Ga0070707_101345512
300 Ga0070698_100001350
301 Ga0070698_100031910
302 Ga0070698_100069971
303 Ga0070684_100000722
304 Ga0070697_100180514
305 Ga0068853_100011075
306 Ga0068853_100499113
307 Ga0070672_100432576
308 Ga0070672_100863534
309 Ga0070693_100234252
310 Ga0070693_101525411
311 Ga0070665_100844587
312 Ga0070704_101013124
313 Ga0070664_100003443
314 Ga0068857_100003827
315 Ga0068857_101510736
316 Ga0068854_101128334
317 Ga0068856_100475011
318 Ga0068856_100656101
319 Ga0070702_100678731
320 Ga0068852_100431323
321 Ga0068852_100532019
322 Ga0068859_100240264
323 Ga0068864_100581147
324 Ga0068861_100272544
325 Ga0068861_100851697
326 Ga0068861_101679712
327 Ga0068870_10412583
328 Ga0068870_10440877
329 Ga0068863_100084991
330 Ga0068860_100607398
331 Ga0075432_10130989
332 Ga0068871_100460316
333 Ga0068871_100712130
334 Ga0075428_100219479
335 Ga0075428_100228840
336 Ga0075428_100386757
337 Ga0075430_100016950
338 Ga0075431_100081381
339 Ga0075429_100115499
340 Ga0075429_100796654
341 Ga0097620_100240273
342 Ga0097620_100411687
343 Ga0097620_101664237
344 Ga0105251_10606157
345 Ga0105244_10292572
346 Ga0111539_10711315
347 Ga0111539_10751604
348 Ga0111539_11445791
349 Ga0105247_11464954
350 Ga0114129_10761857
351 Ga0114129_10992623
352 Ga0105243_10921310
353 Ga0105242_12213628
354 Ga0105248_10463534
355 Ga0105237_12027020
356 Ga0105238_12587994
357 Ga0105249_10096802
358 Ga0157373_10058987
359 Ga0157371_10062497
360 Ga0157371_10288005
361 Ga0157370_10054492
362 Ga0157370_10250125
363 Ga0157370_10837144
364 Ga0157369_11093640
365 Ga0157369_12328740
366 Ga0157374_10796350
367 Ga0163162_10859337
368 Ga0157372_10336658
369 Ga0157372_10342942
370 Ga0157372_10346490
371 Ga0157372_10942467
372 Ga0157372_11265748
373 Ga0157372_11665057
374 Ga0157372_12158783
375 Ga0157372_12365646
376 Ga0157372_13107735
377 Ga0157375_13475978
378 Ga0163163_10201391
379 Ga0163163_12218848
380 Ga0157380_10160927
381 Ga0157380_10469866
382 Ga0157380_10503908
383 Ga0157380_10746538
384 Ga0157379_10811921
385 Ga0157376_12471093
386 Ga0157376_13014068
387 Ga0207653_10163669
388 Ga0207682_10055271
389 Ga0207688_10695557
390 Ga0207685_10214370
391 Ga0207643_10017230
392 Ga0207705_10154974
393 Ga0207662_10089787
394 Ga0207662_10349919
395 Ga0207662_10462625
396 Ga0207649_10003318
397 Ga0207652_10572692
398 Ga0207681_10094940
399 Ga0207650_10396132
400 Ga0207659_10110862
401 Ga0207644_10208651
402 Ga0207706_10378128
403 Ga0207686_10000502
404 Ga0207670_10112684
405 Ga0207670_10593431
406 Ga0207691_10047545
407 Ga0207711_11216146
408 Ga0207689_10036355
409 Ga0207689_10200843
410 Ga0207661_10019629
411 Ga0207679_10004004
412 Ga0207651_10157010
413 Ga0207712_10049957
414 Ga0207640_10170222
415 Ga0207658_10066648
416 Ga0207639_10039963
417 Ga0207639_10053575
418 Ga0207639_10564224
419 Ga0207708_10249569
420 Ga0207708_10655185
421 Ga0207708_11018453
422 Ga0207702_10321659
423 Ga0207641_10000699
424 Ga0207641_10087846
425 Ga0207648_10759966
426 Ga0207648_11269594
427 Ga0207674_10004173
428 Ga0207674_10185986
429 Ga0207674_11118063
430 Ga0207675_100243018
431 Ga0207675_100294134
432 Ga0207675_100377464
433 Ga0207683_10297052
434 Ga0207698_10335470
435 Ga0210000_1061663
436 Ga0207428_10575412
437 Ga0268266_10919479
438 Ga0268265_10063260
439 Ga0268265_10513715
440 Ga0268264_10642881
441 Ga0265340_10127502
442 Ga0265327_10447643
443 Ga0307513_10394420
444 Ga0265313_10104939
445 Ga0307405_10142222
446 Ga0307406_10100538
447 Ga0307407_10162112
448 Ga0307412_10708407
449 Ga0307409_100651732
450 Ga0307409_101309328
451 Ga0307416_100406721
452 Ga0307415_100423168
453 Ga0373945_0395123
454 Ga0373937_0433323
455 Ga0373937_1522458
456 Ga0395905_0009979
457 Ga0395905_1037101
458 Ga0395905_1526327
459 Ga0395901_1228528
460 Ga0436365_0324365
461 Ga0436365_0858395
462 Ga0451793_1845966
463 Ga0451798_0334891
464 Ga0451804_0672648
465 Ga0451807_1663025
466 Ga0451833_0435634
467 Ga0451845_0618472
468 Ga0451853_3355516
469 Ga0439455_0111260
470 Ga0439460_0184629
471 Ga0466965_0620118
472 Ga0453684_0199463
473 Ga0453684_0802416
474 Ga0466957_1234812
475 Ga0495603_0235680
476 Ga0495650_0239652
477 Ga0495644_0115179
478 Ga0495663_0175046
479 Ga0495642_0530362
480 Ga0495586_0574780
481 Ga0495598_0014265
482 Ga0495598_0114629
483 Ga0495621_0162001
484 Ga0495670_0112966
485 Ga0495672_0028875
486 Ga0495676_0627199
487 Ga0501291_059977
488 Ga0501291_084317
489 Ga0501201_022883
490 Ga0501202_010732
491 Ga0501206_077952
492 Ga0501217_007656
493 Ga0501217_061948
494 Ga0501233_113746
495 Ga0501242_012786
496 Ga0501250_018023
497 Ga0501252_039437
498 Ga0501253_107594
499 Ga0501253_220073
500 Ga0501256_007240
501 Ga0501257_026708
502 Ga0501257_038575
503 Ga0501257_183114
504 Ga0501221_008752
505 Ga0501225_0030163
506 Ga0501234_009216
507 Ga0501234_053907
508 Ga0501264_015856
509 Ga0501266_003258
510 Ga0501270_017048
511 Ga0501274_010646
512 Ga0501275_087129
513 Ga0501279_102119
514 nmdc:mga05p37_212925_c1
515 nmdc:mga05p37_660069_c1
516 nmdc:mga09592_175111_c1
517 nmdc:mga09592_340598_c1
518 nmdc:mga09592_546801_c1
519 nmdc:mga0qj67_52627_c1
520 nmdc:mga06r32_201712_c1
521 nmdc:mga08y16_1386491_c1
522 nmdc:mga08y16_65982_c1
523 Ga0500583_0038983
524 Ga0500595_160177
525 Ga0500611_000074
526 2929157706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

27

132

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.8946 2 106
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8778 2 100
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8713 2 99
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.8682 2 111
1sbo-assembly1.cif.gz_A solution structure of putative anti sigma factor antagonist from thermotoga maritima (tm1442) 0.868 2 106
ID Description Score Start End Superfamily
af_I1KA21_504_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8942 7 110 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8889 6 113 3.30.750.24
af_B0V3V8_450_565_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8703 2 113 3.30.750.24
af_Q9I7H4_525_631_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.87 13 105 3.30.750.24
af_P9WGF7_437_560_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8595 6 109 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A838TPI4-F1-model_v4 STAS domain-containing protein 0.9809 1 120
AF-A0A5J5IDV9-F1-model_v4 STAS domain-containing protein 0.977 1 120
AF-A0A1J5RLB5-F1-model_v4 STAS domain protein 0.976 1 124
AF-A0A3D4TA84-F1-model_v4 Anti-anti-sigma factor 0.9757 1 124
AF-A0A5P2GG43-F1-model_v4 STAS domain-containing protein 0.9728 3 124

Map