F370684

General Info

Members Datasets Scaffolds Average Seq Length
261 196 261 161

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_164297_c1|nmdc:mga07m45_164297_c1_323_916
Length 197
Sequence MQRDPPCEEDPALPGLFTLIERLQEIALAISWSQGAFAMDLPAHQLTMTVLMTPDTANFAGNVHGGHLLKWLDQVAYACASRYAARYVVTVSVDQVTFREPIFVGELVTFLSSVNHTGTSSMEIGIKVLAQDIRSQKVRHVNSCFFTMVAVDDERKPVPVPPLRPFTPDEKRRFEEAQLRKTLRKETEARFAALRGA

Samples

Sample ID Description Type Environment
1 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
2 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
3 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.41
Nodule 0
Rhizoplane 3.07
Rhizosphere 80.08
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000020 3300003751 Bacteria 264193
2 Ga0055539_1000025 3300003752 Bacteria 264193
3 Ga0055533_1000034 3300003756 Bacteria 264193
4 Ga0055525_1000044 3300003759 Bacteria 264193
5 Ga0055540_1004327 3300003792 Bacteria 6456
6 Ga0055531_10000282 3300003794 Bacteria 51863
7 Ga0055541_1000019 3300003841 Bacteria 264193
8 Ga0070658_10091268 3300005327 Bacteria 2510
9 Ga0070670_100134830 3300005331 Bacteria 2133
10 Ga0068869_100263992 3300005334 Bacteria 1379
11 Ga0070666_10158642 3300005335 Bacteria 1581
12 Ga0068868_100290727 3300005338 Bacteria 1385
13 Ga0070675_100227877 3300005354 Bacteria 1625
14 Ga0070671_100033194 3300005355 Bacteria 4268
15 Ga0070673_100017355 3300005364 Bacteria 5116
16 Ga0070673_100245826 3300005364 Bacteria 1557
17 Ga0070659_100077925 3300005366 Bacteria 2644
18 Ga0070667_101211169 3300005367 Bacteria 707
19 Ga0070663_100066415 3300005455 Bacteria 2614
20 Ga0070663_100172354 3300005455 Bacteria 1673
21 Ga0070678_100304336 3300005456 Bacteria 1356
22 Ga0070678_100334338 3300005456 Bacteria 1297
23 Ga0070706_100001360 3300005467 Bacteria 25993
24 Ga0070707_100968378 3300005468 Bacteria 816
25 Ga0070707_101470738 3300005468 Bacteria 648
26 Ga0070698_100253855 3300005471 Bacteria 1691
27 Ga0070672_100092342 3300005543 Bacteria 2443
28 Ga0070672_100135695 3300005543 Bacteria 2026
29 Ga0070664_100402212 3300005564 Bacteria 1252
30 Ga0068854_100607218 3300005578 Bacteria 935
31 Ga0070702_100182053 3300005615 Bacteria 1376
32 Ga0068852_100033762 3300005616 Bacteria 4252
33 Ga0068851_10004702 3300005834 Bacteria 6175
34 Ga0068851_10026563 3300005834 Bacteria 2846
35 Ga0068863_100050726 3300005841 Bacteria 3932
36 Ga0070717_10645499 3300006028 Bacteria 961
37 Ga0075365_10287120 3300006038 Bacteria 1158
38 Ga0075368_10045672 3300006042 Bacteria 1731
39 Ga0075363_100212735 3300006048 Bacteria 1107
40 Ga0075364_10468591 3300006051 Bacteria 861
41 Ga0075362_10360127 3300006177 Bacteria 729
42 Ga0075367_10018827 3300006178 Bacteria 3817
43 Ga0075366_10019493 3300006195 Bacteria 3926
44 Ga0075366_10172208 3300006195 Bacteria 1314
45 Ga0075370_10002635 3300006353 Bacteria 8377
46 Ga0075370_10025547 3300006353 Bacteria 3269
47 Ga0075370_10078943 3300006353 Bacteria 1890
48 Ga0068871_100113022 3300006358 Bacteria 2287
49 Ga0068871_100352661 3300006358 Bacteria 1302
50 Ga0075430_100016785 3300006846 Bacteria 6235
51 Ga0075429_100000180 3300006880 Bacteria 41123
52 Ga0111539_10154144 3300009094 Bacteria 2689
53 Ga0105243_10001937 3300009148 Bacteria 17629
54 Ga0105248_10166585 3300009177 Bacteria 2484
55 Ga0105248_10174828 3300009177 Bacteria 2420
56 Ga0105248_10562672 3300009177 Bacteria 1286
57 Ga0157378_10194956 3300013297 Bacteria 1913
58 Ga0157375_10414698 3300013308 Bacteria 1513
59 Ga0157375_10524459 3300013308 Bacteria 1347
60 Ga0157380_11606005 3300014326 Bacteria 706
61 Ga0182008_10180774 3300014497 Bacteria 1067
62 Ga0157377_11142926 3300014745 Bacteria 599
63 Ga0182006_1015796 3300015261 Bacteria 3230
64 Ga0182007_10035163 3300015262 Bacteria 1689
65 Ga0182007_10373544 3300015262 Bacteria 540
66 Ga0163161_10421394 3300017792 Bacteria 1074
67 Ga0213872_10000861 3300021361 Bacteria 21979
68 Ga0213872_10003870 3300021361 Bacteria 8125
69 Ga0213872_10006035 3300021361 Bacteria 6133
70 Ga0209784_100002 3300025224 Bacteria 1753105
71 Ga0209566_100003 3300025225 Bacteria 1753105
72 Ga0209674_100004 3300025226 Bacteria 1753105
73 Ga0209563_100006 3300025230 Bacteria 1753105
74 Ga0209677_100003 3300025253 Bacteria 1753105
75 Ga0209673_1014257 3300025273 Bacteria 3082
76 Ga0209675_1001754 3300025291 Bacteria 11902
77 Ga0209051_1000861 3300025303 Bacteria 30871
78 Ga0209257_1000022 3300025304 Bacteria 765258
79 Ga0207656_10004537 3300025321 Bacteria 4860
80 Ga0207656_10010104 3300025321 Bacteria 3522
81 Ga0207680_10011262 3300025903 Bacteria 4513
82 Ga0207645_10322898 3300025907 Bacteria 1030
83 Ga0207643_10078532 3300025908 Bacteria 1910
84 Ga0207705_10161027 3300025909 Bacteria 1686
85 Ga0207705_10209982 3300025909 Bacteria 1477
86 Ga0207684_10011407 3300025910 Bacteria 7776
87 Ga0207657_10237876 3300025919 Bacteria 1455
88 Ga0207646_10085988 3300025922 Bacteria 2813
89 Ga0207659_10821811 3300025926 Bacteria 798
90 Ga0207644_10015839 3300025931 Bacteria 5069
91 Ga0207644_10032757 3300025931 Bacteria 3628
92 Ga0207690_10084704 3300025932 Bacteria 2223
93 Ga0207686_10007713 3300025934 Bacteria 5800
94 Ga0207669_11126028 3300025937 Bacteria 663
95 Ga0207691_10312622 3300025940 Bacteria 1348
96 Ga0207711_10047793 3300025941 Bacteria 3660
97 Ga0207711_10061911 3300025941 Bacteria 3227
98 Ga0207651_10088435 3300025960 Bacteria 2258
99 Ga0207651_10880965 3300025960 Bacteria 796
100 Ga0207640_10321524 3300025981 Bacteria 1232
101 Ga0207658_10557740 3300025986 Bacteria 1026
102 Ga0207677_10455645 3300026023 Bacteria 1097
103 Ga0207678_10029428 3300026067 Bacteria 4794
104 Ga0207678_10485393 3300026067 Bacteria 1076
105 Ga0207702_11962158 3300026078 Bacteria 576
106 Ga0207641_10016281 3300026088 Bacteria 6089
107 Ga0207648_11580539 3300026089 Bacteria 616
108 Ga0207676_10317671 3300026095 Bacteria 1428
109 Ga0207683_10343938 3300026121 Bacteria 1368
110 Ga0207698_10016534 3300026142 Bacteria 4977
111 Ga0209813_10012966 3300027866 Bacteria 2215
112 Ga0209974_10007232 3300027876 Bacteria 3832
113 Ga0207428_10170502 3300027907 Bacteria 1649
114 Ga0268264_10404620 3300028381 Bacteria 1312
115 Ga0307515_10335057 3300028794 Bacteria 1169
116 Ga0265328_10013421 3300031239 Bacteria 3244
117 Ga0265331_10001807 3300031250 Bacteria 15200
118 Ga0265327_10000042 3300031251 Bacteria 287487
119 Ga0307516_10210902 3300031730 Bacteria 1657
120 Ga0307410_10595338 3300031852 Bacteria 922
121 Ga0307412_10880643 3300031911 Bacteria 783
122 Ga0307412_11170015 3300031911 Bacteria 687
123 Ga0307416_100397619 3300032002 Bacteria 1414
124 Ga0373947_0447840 3300035725 Bacteria 874
125 Ga0395899_0433547 3300037312 Bacteria 864
126 Ga0395898_0351686 3300037466 Bacteria 1405
127 Ga0395898_0369460 3300037466 Bacteria 1368
128 Ga0395898_0553389 3300037466 Bacteria 1093
129 Ga0395905_0000330 3300037471 Bacteria 67978
130 Ga0395905_0001286 3300037471 Bacteria 30908
131 Ga0395905_0006945 3300037471 Bacteria 11315
132 Ga0395905_0017509 3300037471 Bacteria 6803
133 Ga0395905_0027233 3300037471 Bacteria 5390
134 Ga0395901_0090933 3300038443 Bacteria 3195
135 Ga0395901_0094639 3300038443 Bacteria 3130
136 Ga0436361_0455065 3300039447 Bacteria 73475
137 Ga0436361_0516261 3300039447 Bacteria 5785
138 Ga0436361_0968600 3300039447 Bacteria 8144
139 Ga0451853_0976526 3300041512 Bacteria 1953
140 Ga0439449_0098743 3300042007 Bacteria 1079
141 Ga0450894_032158 3300042131 Bacteria 735
142 Ga0439458_0050483 3300042157 Bacteria 1026
143 Ga0451577_0007618 3300042876 Bacteria 10619
144 Ga0451577_0140588 3300042876 Bacteria 2169
145 Ga0451577_0176390 3300042876 Bacteria 1926
146 Ga0466969_0023680 3300044656 Bacteria 3162
147 Ga0466969_0147817 3300044656 Bacteria 1083
148 Ga0466972_0041539 3300044658 Bacteria 2239
149 Ga0453683_0246681 3300044673 Bacteria 1138
150 Ga0466965_0066840 3300044683 Bacteria 1803
151 Ga0466965_0072609 3300044683 Bacteria 1731
152 Ga0466965_0165496 3300044683 Bacteria 1161
153 Ga0466966_0161455 3300044684 Bacteria 1364
154 Ga0466966_0272989 3300044684 Bacteria 1017
155 Ga0466961_0018099 3300044693 Bacteria 4530
156 Ga0466964_0111652 3300044706 Bacteria 1220
157 Ga0466964_0133258 3300044706 Bacteria 1134
158 Ga0453684_0005959 3300044712 Bacteria 23631
159 Ga0453684_0065914 3300044712 Bacteria 4614
160 Ga0453684_0147612 3300044712 Bacteria 2799
161 Ga0466971_0060181 3300044719 Bacteria 1716
162 Ga0466971_0068326 3300044719 Bacteria 1611
163 Ga0466970_0238434 3300044765 Bacteria 1017
164 Ga0466957_0028532 3300044842 Bacteria 3324
165 Ga0466960_0449845 3300044901 Bacteria 748
166 Ga0466959_0005179 3300045049 Bacteria 8886
167 Ga0466959_0094413 3300045049 Bacteria 2146
168 Ga0451576_0012728 3300045051 Bacteria 9445
169 Ga0451576_0043153 3300045051 Bacteria 4758
170 Ga0466958_0146812 3300045836 Bacteria 1486
171 Ga0466958_0362383 3300045836 Bacteria 934
172 Ga0466967_0345952 3300045976 Bacteria 1438
173 Ga0495651_0002400 3300046462 Bacteria 14464
174 Ga0495650_0000387 3300046471 Bacteria 75577
175 Ga0495580_0084662 3300046472 Bacteria 2208
176 Ga0495605_0024267 3300046474 Bacteria 3175
177 Ga0495584_0001153 3300046491 Bacteria 16284
178 Ga0495585_0279540 3300046492 Bacteria 825
179 Ga0495596_0031172 3300046500 Bacteria 2131
180 Ga0495596_0075603 3300046500 Bacteria 1308
181 Ga0495607_0005362 3300046501 Bacteria 9208
182 Ga0495607_0013739 3300046501 Bacteria 5293
183 Ga0495583_0000074 3300046506 Bacteria 177273
184 Ga0495608_0001403 3300046511 Bacteria 17129
185 Ga0495616_0055156 3300046513 Bacteria 1968
186 Ga0495620_0189668 3300046515 Bacteria 793
187 Ga0495628_0000474 3300046516 Bacteria 36662
188 Ga0495630_0008028 3300046517 Bacteria 7585
189 Ga0495643_0007384 3300046522 Bacteria 7099
190 Ga0495644_0004506 3300046523 Bacteria 5473
191 Ga0495648_0075227 3300046524 Bacteria 1943
192 Ga0495642_0176008 3300046528 Bacteria 930
193 Ga0495642_0405452 3300046528 Bacteria 601
194 Ga0495652_0002709 3300046529 Bacteria 17989
195 Ga0495652_0007737 3300046529 Bacteria 9883
196 Ga0495586_0145725 3300046535 Bacteria 1330
197 Ga0495587_0106609 3300046536 Bacteria 1611
198 Ga0495587_0317959 3300046536 Bacteria 869
199 Ga0495609_0000403 3300046538 Bacteria 36436
200 Ga0495597_0234741 3300046542 Bacteria 725
201 Ga0495645_0706803 3300046543 Bacteria 611
202 Ga0495633_0126597 3300046558 Bacteria 1182
203 Ga0495633_0270008 3300046558 Bacteria 774
204 Ga0495656_0003519 3300046615 Bacteria 5299
205 Ga0495611_0035412 3300046648 Bacteria 2211
206 Ga0495661_0001725 3300046665 Bacteria 17691
207 Ga0495588_0206978 3300046674 Bacteria 1036
208 Ga0495623_0018754 3300046679 Bacteria 4467
209 Ga0495669_0015823 3300046684 Bacteria 3229
210 Ga0495649_0000697 3300046694 Bacteria 27422
211 Ga0495589_0012565 3300046794 Bacteria 4382
212 Ga0495589_0089350 3300046794 Bacteria 1496
213 Ga0495600_0157241 3300046809 Bacteria 1470
214 Ga0495604_0018697 3300047317 Bacteria 5549
215 Ga0495636_0452804 3300047318 Bacteria 616
216 Ga0495672_0000101 3300047320 Bacteria 139193
217 Ga0495672_0068087 3300047320 Bacteria 2025
218 Ga0495676_0256388 3300047321 Bacteria 1191
219 Ga0495680_0108841 3300047322 Bacteria 2056
220 Ga0495683_0005007 3300047323 Bacteria 7420
221 Ga0495677_0000863 3300047445 Bacteria 12273
222 Ga0495677_0006091 3300047445 Bacteria 4560
223 Ga0495679_003393 3300047446 Bacteria 7675
224 Ga0495686_0000109 3300047472 Bacteria 171482
225 Ga0495686_0007449 3300047472 Bacteria 8204
226 Ga0495593_0296409 3300047673 Bacteria 808
227 Ga0495602_0006681 3300048088 Bacteria 12088
228 Ga0495602_0080600 3300048088 Bacteria 2741
229 Ga0495626_0000048 3300048091 Bacteria 161634
230 Ga0495626_0016606 3300048091 Bacteria 3735
231 Ga0495626_0088004 3300048091 Bacteria 1369
232 Ga0496104_0130891 3300048907 Bacteria 2410
233 Ga0496104_0238833 3300048907 Bacteria 1729
234 Ga0496104_0533017 3300048907 Bacteria 1085
235 Ga0496105_0238289 3300048908 Bacteria 1477
236 Ga0496107_0832490 3300048910 Bacteria 675
237 Ga0496109_0131836 3300048912 Bacteria 2333
238 Ga0496114_0104260 3300048917 Bacteria 2425
239 Ga0496114_0769902 3300048917 Bacteria 840
240 Ga0496118_0346270 3300048921 Bacteria 794
241 Ga0496121_0065826 3300048924 Bacteria 2946
242 Ga0496122_0008722 3300048925 Bacteria 10854
243 Ga0496123_0074535 3300048926 Bacteria 2100
244 Ga0496125_0000650 3300048928 Bacteria 58031
245 Ga0496126_0059493 3300048929 Bacteria 3440
246 Ga0495678_009789 3300049459 Bacteria 4708
247 Ga0501035_0285748 3300049822 Bacteria 1393
248 Ga0501044_0052512 3300049823 Bacteria 4200
249 nmdc:mga0k408_13597_c1 3300050493 Bacteria 4468
250 nmdc:mga0k408_84524_c1 3300050493 Bacteria 1862
251 nmdc:mga06z11_313331_c1 3300050494 Bacteria 935
252 nmdc:mga07m45_12616_c1 3300050496 Bacteria 4469
253 nmdc:mga07m45_164297_c1 3300050496 Bacteria 1289
254 nmdc:mga07m45_8073_c1 3300050496 Bacteria 2435
255 nmdc:mga05p37_84299_c2 3300050507 Bacteria 3477
256 nmdc:mga09592_518_c1 3300050508 Bacteria 29234
257 nmdc:mga0qj67_10350_c1 3300050509 Bacteria 6967
258 nmdc:mga08y16_57848_c1 3300050511 Bacteria 4050
259 Ga0500658_0146848 3300053134 Bacteria 1061
260 Ga0466962_0010973 3300061719 Bacteria 4360
261 Ga0466962_0115101 3300061719 Bacteria 1295

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10019493 Ga0075366_100194931 153
2 3300050493 nmdc:mga0k408_13597_c1 nmdc:mga0k408_13597_c1_3279_3776 153
3 3300025291 Ga0209675_1001754 Ga0209675_100175410 155
4 3300037471 Ga0395905_0000330 Ga0395905_0000330_56595_57071 158
5 3300003751 Ga0055538_1000020 Ga0055538_1000020143 159
6 3300003752 Ga0055539_1000025 Ga0055539_1000025143 159
7 3300003756 Ga0055533_1000034 Ga0055533_1000034100 159
8 3300003759 Ga0055525_1000044 Ga0055525_1000044143 159
9 3300003792 Ga0055540_1004327 Ga0055540_10043272 159
10 3300003794 Ga0055531_10000282 Ga0055531_1000028237 159
11 3300003841 Ga0055541_1000019 Ga0055541_1000019143 159
12 3300005327 Ga0070658_10091268 Ga0070658_100912682 159
13 3300005331 Ga0070670_100134830 Ga0070670_1001348302 159
14 3300005334 Ga0068869_100263992 Ga0068869_1002639922 159
15 3300005335 Ga0070666_10158642 Ga0070666_101586421 159
16 3300005338 Ga0068868_100290727 Ga0068868_1002907272 159
17 3300005354 Ga0070675_100227877 Ga0070675_1002278772 159
18 3300005355 Ga0070671_100033194 Ga0070671_1000331942 159
19 3300005364 Ga0070673_100017355 Ga0070673_1000173553 159
20 3300005364 Ga0070673_100245826 Ga0070673_1002458262 159
21 3300005366 Ga0070659_100077925 Ga0070659_1000779253 159
22 3300005367 Ga0070667_101211169 Ga0070667_1012111691 159
23 3300005455 Ga0070663_100066415 Ga0070663_1000664152 159
24 3300005455 Ga0070663_100172354 Ga0070663_1001723542 159
25 3300005456 Ga0070678_100304336 Ga0070678_1003043362 159
26 3300005456 Ga0070678_100334338 Ga0070678_1003343382 159
27 3300005467 Ga0070706_100001360 Ga0070706_1000013606 159
28 3300005468 Ga0070707_100968378 Ga0070707_1009683781 159
29 3300005468 Ga0070707_101470738 Ga0070707_1014707381 159
30 3300005471 Ga0070698_100253855 Ga0070698_1002538551 159
31 3300005543 Ga0070672_100092342 Ga0070672_1000923421 159
32 3300005543 Ga0070672_100135695 Ga0070672_1001356952 159
33 3300005564 Ga0070664_100402212 Ga0070664_1004022121 159
34 3300005578 Ga0068854_100607218 Ga0068854_1006072182 159
35 3300005615 Ga0070702_100182053 Ga0070702_1001820532 159
36 3300005616 Ga0068852_100033762 Ga0068852_1000337622 159
37 3300005834 Ga0068851_10004702 Ga0068851_100047021 159
38 3300005834 Ga0068851_10026563 Ga0068851_100265632 159
39 3300005841 Ga0068863_100050726 Ga0068863_1000507262 159
40 3300006028 Ga0070717_10645499 Ga0070717_106454991 159
41 3300006038 Ga0075365_10287120 Ga0075365_102871201 159
42 3300006042 Ga0075368_10045672 Ga0075368_100456722 159
43 3300006048 Ga0075363_100212735 Ga0075363_1002127352 159
44 3300006051 Ga0075364_10468591 Ga0075364_104685912 159
45 3300006177 Ga0075362_10360127 Ga0075362_103601271 159
46 3300006178 Ga0075367_10018827 Ga0075367_100188273 159
47 3300006195 Ga0075366_10172208 Ga0075366_101722082 159
48 3300006353 Ga0075370_10002635 Ga0075370_100026352 159
49 3300006353 Ga0075370_10025547 Ga0075370_100255474 159
50 3300006353 Ga0075370_10078943 Ga0075370_100789432 159
51 3300006358 Ga0068871_100113022 Ga0068871_1001130224 159
52 3300006358 Ga0068871_100352661 Ga0068871_1003526612 159
53 3300006846 Ga0075430_100016785 Ga0075430_1000167853 159
54 3300006880 Ga0075429_100000180 Ga0075429_10000018016 159
55 3300009094 Ga0111539_10154144 Ga0111539_101541442 159
56 3300009148 Ga0105243_10001937 Ga0105243_100019377 159
57 3300009177 Ga0105248_10166585 Ga0105248_101665852 159
58 3300009177 Ga0105248_10174828 Ga0105248_101748284 159
59 3300009177 Ga0105248_10562672 Ga0105248_105626722 159
60 3300013297 Ga0157378_10194956 Ga0157378_101949562 159
61 3300013308 Ga0157375_10414698 Ga0157375_104146982 159
62 3300013308 Ga0157375_10524459 Ga0157375_105244592 159
63 3300014326 Ga0157380_11606005 Ga0157380_116060051 159
64 3300014497 Ga0182008_10180774 Ga0182008_101807741 159
65 3300014745 Ga0157377_11142926 Ga0157377_111429261 159
66 3300015261 Ga0182006_1015796 Ga0182006_10157964 159
67 3300015262 Ga0182007_10035163 Ga0182007_100351632 159
68 3300015262 Ga0182007_10373544 Ga0182007_103735441 159
69 3300017792 Ga0163161_10421394 Ga0163161_104213942 159
70 3300021361 Ga0213872_10000861 Ga0213872_1000086120 159
71 3300021361 Ga0213872_10003870 Ga0213872_100038707 159
72 3300021361 Ga0213872_10006035 Ga0213872_100060355 159
73 3300025224 Ga0209784_100002 Ga0209784_100002146 159
74 3300025225 Ga0209566_100003 Ga0209566_100003146 159
75 3300025226 Ga0209674_100004 Ga0209674_100004146 159
76 3300025230 Ga0209563_100006 Ga0209563_100006146 159
77 3300025253 Ga0209677_100003 Ga0209677_100003146 159
78 3300025273 Ga0209673_1014257 Ga0209673_10142572 159
79 3300025303 Ga0209051_1000861 Ga0209051_100086124 159
80 3300025304 Ga0209257_1000022 Ga0209257_1000022413 159
81 3300025321 Ga0207656_10004537 Ga0207656_100045371 159
82 3300025321 Ga0207656_10010104 Ga0207656_100101042 159
83 3300025903 Ga0207680_10011262 Ga0207680_100112621 159
84 3300025907 Ga0207645_10322898 Ga0207645_103228981 159
85 3300025908 Ga0207643_10078532 Ga0207643_100785322 159
86 3300025909 Ga0207705_10161027 Ga0207705_101610272 159
87 3300025909 Ga0207705_10209982 Ga0207705_102099822 159
88 3300025910 Ga0207684_10011407 Ga0207684_100114077 159
89 3300025919 Ga0207657_10237876 Ga0207657_102378762 159
90 3300025922 Ga0207646_10085988 Ga0207646_100859884 159
91 3300025926 Ga0207659_10821811 Ga0207659_108218111 159
92 3300025931 Ga0207644_10015839 Ga0207644_100158392 159
93 3300025931 Ga0207644_10032757 Ga0207644_100327574 159
94 3300025932 Ga0207690_10084704 Ga0207690_100847042 159
95 3300025934 Ga0207686_10007713 Ga0207686_100077132 159
96 3300025937 Ga0207669_11126028 Ga0207669_111260282 159
97 3300025940 Ga0207691_10312622 Ga0207691_103126222 159
98 3300025941 Ga0207711_10047793 Ga0207711_100477932 159
99 3300025941 Ga0207711_10061911 Ga0207711_100619112 159
100 3300025960 Ga0207651_10088435 Ga0207651_100884352 159
101 3300025960 Ga0207651_10880965 Ga0207651_108809652 159
102 3300025981 Ga0207640_10321524 Ga0207640_103215242 159
103 3300025986 Ga0207658_10557740 Ga0207658_105577401 159
104 3300026023 Ga0207677_10455645 Ga0207677_104556452 159
105 3300026067 Ga0207678_10029428 Ga0207678_100294283 159
106 3300026067 Ga0207678_10485393 Ga0207678_104853932 159
107 3300026078 Ga0207702_11962158 Ga0207702_119621581 159
108 3300026088 Ga0207641_10016281 Ga0207641_100162813 159
109 3300026089 Ga0207648_11580539 Ga0207648_115805391 159
110 3300026095 Ga0207676_10317671 Ga0207676_103176712 159
111 3300026121 Ga0207683_10343938 Ga0207683_103439382 159
112 3300026142 Ga0207698_10016534 Ga0207698_100165342 159
113 3300027866 Ga0209813_10012966 Ga0209813_100129661 159
114 3300027876 Ga0209974_10007232 Ga0209974_100072327 159
115 3300027907 Ga0207428_10170502 Ga0207428_101705023 159
116 3300028381 Ga0268264_10404620 Ga0268264_104046202 159
117 3300028794 Ga0307515_10335057 Ga0307515_103350572 159
118 3300031239 Ga0265328_10013421 Ga0265328_100134212 159
119 3300031250 Ga0265331_10001807 Ga0265331_1000180716 159
120 3300031251 Ga0265327_10000042 Ga0265327_1000004258 159
121 3300031730 Ga0307516_10210902 Ga0307516_102109022 159
122 3300031852 Ga0307410_10595338 Ga0307410_105953381 159
123 3300031911 Ga0307412_10880643 Ga0307412_108806432 159
124 3300031911 Ga0307412_11170015 Ga0307412_111700152 159
125 3300032002 Ga0307416_100397619 Ga0307416_1003976192 159
126 3300035725 Ga0373947_0447840 Ga0373947_0447840_310_792 159
127 3300037312 Ga0395899_0433547 Ga0395899_0433547_281_766 159
128 3300037466 Ga0395898_0351686 Ga0395898_0351686_170_658 159
129 3300037466 Ga0395898_0369460 Ga0395898_0369460_609_1088 159
130 3300037466 Ga0395898_0553389 Ga0395898_0553389_394_927 159
131 3300037471 Ga0395905_0001286 Ga0395905_0001286_30166_30651 159
132 3300037471 Ga0395905_0006945 Ga0395905_0006945_487_978 159
133 3300037471 Ga0395905_0017509 Ga0395905_0017509_191_676 159
134 3300037471 Ga0395905_0027233 Ga0395905_0027233_526_1014 159
135 3300038443 Ga0395901_0090933 Ga0395901_0090933_965_1450 159
136 3300038443 Ga0395901_0094639 Ga0395901_0094639_2068_2556 159
137 3300039447 Ga0436361_0455065 Ga0436361_0455065_4171_4698 159
138 3300039447 Ga0436361_0516261 Ga0436361_0516261_1539_2018 159
139 3300039447 Ga0436361_0968600 Ga0436361_0968600_4643_5125 159
140 3300041512 Ga0451853_0976526 Ga0451853_0976526_210_692 159
141 3300042007 Ga0439449_0098743 Ga0439449_0098743_574_1062 159
142 3300042131 Ga0450894_032158 Ga0450894_032158_215_712 159
143 3300042157 Ga0439458_0050483 Ga0439458_0050483_20_517 159
144 3300042876 Ga0451577_0007618 Ga0451577_0007618_3598_4077 159
145 3300042876 Ga0451577_0140588 Ga0451577_0140588_1059_1562 159
146 3300042876 Ga0451577_0176390 Ga0451577_0176390_777_1271 159
147 3300044656 Ga0466969_0023680 Ga0466969_0023680_619_1098 159
148 3300044656 Ga0466969_0147817 Ga0466969_0147817_477_971 159
149 3300044658 Ga0466972_0041539 Ga0466972_0041539_934_1425 159
150 3300044673 Ga0453683_0246681 Ga0453683_0246681_424_906 159
151 3300044683 Ga0466965_0066840 Ga0466965_0066840_442_936 159
152 3300044683 Ga0466965_0072609 Ga0466965_0072609_356_847 159
153 3300044683 Ga0466965_0165496 Ga0466965_0165496_297_782 159
154 3300044684 Ga0466966_0161455 Ga0466966_0161455_254_739 159
155 3300044684 Ga0466966_0272989 Ga0466966_0272989_511_990 159
156 3300044693 Ga0466961_0018099 Ga0466961_0018099_2394_2873 159
157 3300044706 Ga0466964_0111652 Ga0466964_0111652_148_642 159
158 3300044706 Ga0466964_0133258 Ga0466964_0133258_116_595 159
159 3300044712 Ga0453684_0005959 Ga0453684_0005959_12394_12885 159
160 3300044712 Ga0453684_0065914 Ga0453684_0065914_417_896 159
161 3300044712 Ga0453684_0147612 Ga0453684_0147612_2073_2561 159
162 3300044719 Ga0466971_0060181 Ga0466971_0060181_469_963 159
163 3300044719 Ga0466971_0068326 Ga0466971_0068326_191_670 159
164 3300044765 Ga0466970_0238434 Ga0466970_0238434_158_652 159
165 3300044842 Ga0466957_0028532 Ga0466957_0028532_869_1354 159
166 3300044901 Ga0466960_0449845 Ga0466960_0449845_178_669 159
167 3300045049 Ga0466959_0005179 Ga0466959_0005179_2149_2628 159
168 3300045049 Ga0466959_0094413 Ga0466959_0094413_77_562 159
169 3300045051 Ga0451576_0012728 Ga0451576_0012728_917_1405 159
170 3300045051 Ga0451576_0043153 Ga0451576_0043153_2466_2945 159
171 3300045836 Ga0466958_0146812 Ga0466958_0146812_48_542 159
172 3300045836 Ga0466958_0362383 Ga0466958_0362383_17_502 159
173 3300045976 Ga0466967_0345952 Ga0466967_0345952_449_943 159
174 3300046462 Ga0495651_0002400 Ga0495651_0002400_9765_10244 159
175 3300046471 Ga0495650_0000387 Ga0495650_0000387_40357_40842 159
176 3300046472 Ga0495580_0084662 Ga0495580_0084662_1327_1812 159
177 3300046474 Ga0495605_0024267 Ga0495605_0024267_2664_3149 159
178 3300046491 Ga0495584_0001153 Ga0495584_0001153_10494_10979 159
179 3300046492 Ga0495585_0279540 Ga0495585_0279540_298_783 159
180 3300046500 Ga0495596_0031172 Ga0495596_0031172_168_653 159
181 3300046500 Ga0495596_0075603 Ga0495596_0075603_580_1065 159
182 3300046501 Ga0495607_0005362 Ga0495607_0005362_6605_7090 159
183 3300046501 Ga0495607_0013739 Ga0495607_0013739_196_696 159
184 3300046506 Ga0495583_0000074 Ga0495583_0000074_32451_32936 159
185 3300046511 Ga0495608_0001403 Ga0495608_0001403_7593_8072 159
186 3300046513 Ga0495616_0055156 Ga0495616_0055156_192_677 159
187 3300046515 Ga0495620_0189668 Ga0495620_0189668_51_542 159
188 3300046516 Ga0495628_0000474 Ga0495628_0000474_26112_26591 159
189 3300046517 Ga0495630_0008028 Ga0495630_0008028_1939_2424 159
190 3300046522 Ga0495643_0007384 Ga0495643_0007384_3253_3738 159
191 3300046523 Ga0495644_0004506 Ga0495644_0004506_1386_1871 159
192 3300046524 Ga0495648_0075227 Ga0495648_0075227_1263_1748 159
193 3300046528 Ga0495642_0176008 Ga0495642_0176008_356_841 159
194 3300046528 Ga0495642_0405452 Ga0495642_0405452_95_580 159
195 3300046529 Ga0495652_0002709 Ga0495652_0002709_4349_4828 159
196 3300046529 Ga0495652_0007737 Ga0495652_0007737_3423_3908 159
197 3300046535 Ga0495586_0145725 Ga0495586_0145725_826_1311 159
198 3300046536 Ga0495587_0106609 Ga0495587_0106609_826_1311 159
199 3300046536 Ga0495587_0317959 Ga0495587_0317959_62_547 159
200 3300046538 Ga0495609_0000403 Ga0495609_0000403_33379_33864 159
201 3300046542 Ga0495597_0234741 Ga0495597_0234741_191_676 159
202 3300046543 Ga0495645_0706803 Ga0495645_0706803_75_560 159
203 3300046558 Ga0495633_0126597 Ga0495633_0126597_668_1153 159
204 3300046558 Ga0495633_0270008 Ga0495633_0270008_249_734 159
205 3300046615 Ga0495656_0003519 Ga0495656_0003519_3501_3986 159
206 3300046648 Ga0495611_0035412 Ga0495611_0035412_1168_1653 159
207 3300046665 Ga0495661_0001725 Ga0495661_0001725_8384_8935 159
208 3300046674 Ga0495588_0206978 Ga0495588_0206978_217_702 159
209 3300046679 Ga0495623_0018754 Ga0495623_0018754_1517_1996 159
210 3300046684 Ga0495669_0015823 Ga0495669_0015823_895_1380 159
211 3300046694 Ga0495649_0000697 Ga0495649_0000697_1350_1835 159
212 3300046794 Ga0495589_0012565 Ga0495589_0012565_3728_4213 159
213 3300046794 Ga0495589_0089350 Ga0495589_0089350_183_668 159
214 3300046809 Ga0495600_0157241 Ga0495600_0157241_338_823 159
215 3300047317 Ga0495604_0018697 Ga0495604_0018697_3215_3700 159
216 3300047318 Ga0495636_0452804 Ga0495636_0452804_68_553 159
217 3300047320 Ga0495672_0000101 Ga0495672_0000101_100235_100720 159
218 3300047320 Ga0495672_0068087 Ga0495672_0068087_501_986 159
219 3300047321 Ga0495676_0256388 Ga0495676_0256388_539_1024 159
220 3300047322 Ga0495680_0108841 Ga0495680_0108841_814_1299 159
221 3300047323 Ga0495683_0005007 Ga0495683_0005007_2224_2709 159
222 3300047445 Ga0495677_0000863 Ga0495677_0000863_8290_8841 159
223 3300047445 Ga0495677_0006091 Ga0495677_0006091_1450_1935 159
224 3300047446 Ga0495679_003393 Ga0495679_003393_2545_3030 159
225 3300047472 Ga0495686_0000109 Ga0495686_0000109_111233_111718 159
226 3300047472 Ga0495686_0007449 Ga0495686_0007449_918_1400 159
227 3300047673 Ga0495593_0296409 Ga0495593_0296409_144_629 159
228 3300048088 Ga0495602_0006681 Ga0495602_0006681_3158_3643 159
229 3300048088 Ga0495602_0080600 Ga0495602_0080600_1312_1791 159
230 3300048091 Ga0495626_0000048 Ga0495626_0000048_50632_51117 159
231 3300048091 Ga0495626_0016606 Ga0495626_0016606_1861_2346 159
232 3300048091 Ga0495626_0088004 Ga0495626_0088004_104_589 159
233 3300048907 Ga0496104_0130891 Ga0496104_0130891_1110_1592 159
234 3300048907 Ga0496104_0238833 Ga0496104_0238833_433_915 159
235 3300048907 Ga0496104_0533017 Ga0496104_0533017_165_647 159
236 3300048908 Ga0496105_0238289 Ga0496105_0238289_842_1324 159
237 3300048910 Ga0496107_0832490 Ga0496107_0832490_156_638 159
238 3300048912 Ga0496109_0131836 Ga0496109_0131836_860_1342 159
239 3300048917 Ga0496114_0104260 Ga0496114_0104260_702_1184 159
240 3300048917 Ga0496114_0769902 Ga0496114_0769902_241_723 159
241 3300048921 Ga0496118_0346270 Ga0496118_0346270_224_703 159
242 3300048924 Ga0496121_0065826 Ga0496121_0065826_1442_1921 159
243 3300048925 Ga0496122_0008722 Ga0496122_0008722_6272_6754 159
244 3300048926 Ga0496123_0074535 Ga0496123_0074535_471_953 159
245 3300048928 Ga0496125_0000650 Ga0496125_0000650_33847_34329 159
246 3300048929 Ga0496126_0059493 Ga0496126_0059493_438_920 159
247 3300049459 Ga0495678_009789 Ga0495678_009789_1035_1520 159
248 3300049822 Ga0501035_0285748 Ga0501035_0285748_207_692 159
249 3300049823 Ga0501044_0052512 Ga0501044_0052512_366_851 159
250 3300050493 nmdc:mga0k408_84524_c1 nmdc:mga0k408_84524_c1_649_1131 159
251 3300050494 nmdc:mga06z11_313331_c1 nmdc:mga06z11_313331_c1_344_832 159
252 3300050496 nmdc:mga07m45_12616_c1 nmdc:mga07m45_12616_c1_2550_3068 159
253 3300050496 nmdc:mga07m45_164297_c1 nmdc:mga07m45_164297_c1_323_916 159
254 3300050496 nmdc:mga07m45_8073_c1 nmdc:mga07m45_8073_c1_715_1194 159
255 3300050507 nmdc:mga05p37_84299_c2 nmdc:mga05p37_84299_c2_175_657 159
256 3300050508 nmdc:mga09592_518_c1 nmdc:mga09592_518_c1_24221_24703 159
257 3300050509 nmdc:mga0qj67_10350_c1 nmdc:mga0qj67_10350_c1_1327_1809 159
258 3300050511 nmdc:mga08y16_57848_c1 nmdc:mga08y16_57848_c1_257_736 159
259 3300053134 Ga0500658_0146848 Ga0500658_0146848_492_1013 159
260 3300061719 Ga0466962_0010973 Ga0466962_0010973_1612_2091 159
261 3300061719 Ga0466962_0115101 Ga0466962_0115101_263_757 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

60

137

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ien-assembly1.cif.gz_A crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 0.9375 1 147
5szu-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9367 2 148
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.9313 3 147
5szy-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9298 1 149
5szv-assembly2.cif.gz_D novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9269 2 149
ID Description Score Start End Superfamily
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9375 1 147 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9169 7 148 3.10.129.10
2q2bB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9081 7 145 3.10.129.10
4mobA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9014 8 147 3.10.129.10
3b7kA01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8982 7 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A433SEB3-F1-model_v4 Putative acyl-CoA thioester hydrolase (EC 3.1.2.-) 0.9515 3 156 GO:0005829
GO:0006637
GO:0052816
AF-A0A3C0JB27-F1-model_v4 Acyl-CoA thioesterase 0.951 2 156 GO:0005829
GO:0006637
GO:0052816
AF-A0A6P1J9S2-F1-model_v4 Acyl-CoA thioesterase 0.9502 1 157 GO:0005829
GO:0006637
GO:0052816
AF-A0A2G6R587-F1-model_v4 Acyl-CoA thioesterase 0.9497 5 150 GO:0005829
GO:0006637
GO:0052816
AF-I0HQJ8-F1-model_v4 Thioesterase superfamily protein (EC 3.1.2.-) 0.9495 3 156 GO:0005829
GO:0006637
GO:0052816

Feature Viewer

pLDDT pTM Quality
83.66 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map