F370684
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 261 | 196 | 261 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300050496|nmdc:mga07m45_164297_c1|nmdc:mga07m45_164297_c1_323_916 |
| Length | 197 |
| Sequence | MQRDPPCEEDPALPGLFTLIERLQEIALAISWSQGAFAMDLPAHQLTMTVLMTPDTANFAGNVHGGHLLKWLDQVAYACASRYAARYVVTVSVDQVTFREPIFVGELVTFLSSVNHTGTSSMEIGIKVLAQDIRSQKVRHVNSCFFTMVAVDDERKPVPVPPLRPFTPDEKRRFEEAQLRKTLRKETEARFAALRGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 2 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 36 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 54 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 94 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 98 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 99 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 102 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 107 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 108 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 109 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 110 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 111 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 112 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 113 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 114 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 115 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 119 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 120 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 121 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 122 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 123 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 124 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 125 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 196 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.41 |
| Nodule | 0 |
| Rhizoplane | 3.07 |
| Rhizosphere | 80.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055538_1000020 | 3300003751 | Bacteria | 264193 |
| 2 | Ga0055539_1000025 | 3300003752 | Bacteria | 264193 |
| 3 | Ga0055533_1000034 | 3300003756 | Bacteria | 264193 |
| 4 | Ga0055525_1000044 | 3300003759 | Bacteria | 264193 |
| 5 | Ga0055540_1004327 | 3300003792 | Bacteria | 6456 |
| 6 | Ga0055531_10000282 | 3300003794 | Bacteria | 51863 |
| 7 | Ga0055541_1000019 | 3300003841 | Bacteria | 264193 |
| 8 | Ga0070658_10091268 | 3300005327 | Bacteria | 2510 |
| 9 | Ga0070670_100134830 | 3300005331 | Bacteria | 2133 |
| 10 | Ga0068869_100263992 | 3300005334 | Bacteria | 1379 |
| 11 | Ga0070666_10158642 | 3300005335 | Bacteria | 1581 |
| 12 | Ga0068868_100290727 | 3300005338 | Bacteria | 1385 |
| 13 | Ga0070675_100227877 | 3300005354 | Bacteria | 1625 |
| 14 | Ga0070671_100033194 | 3300005355 | Bacteria | 4268 |
| 15 | Ga0070673_100017355 | 3300005364 | Bacteria | 5116 |
| 16 | Ga0070673_100245826 | 3300005364 | Bacteria | 1557 |
| 17 | Ga0070659_100077925 | 3300005366 | Bacteria | 2644 |
| 18 | Ga0070667_101211169 | 3300005367 | Bacteria | 707 |
| 19 | Ga0070663_100066415 | 3300005455 | Bacteria | 2614 |
| 20 | Ga0070663_100172354 | 3300005455 | Bacteria | 1673 |
| 21 | Ga0070678_100304336 | 3300005456 | Bacteria | 1356 |
| 22 | Ga0070678_100334338 | 3300005456 | Bacteria | 1297 |
| 23 | Ga0070706_100001360 | 3300005467 | Bacteria | 25993 |
| 24 | Ga0070707_100968378 | 3300005468 | Bacteria | 816 |
| 25 | Ga0070707_101470738 | 3300005468 | Bacteria | 648 |
| 26 | Ga0070698_100253855 | 3300005471 | Bacteria | 1691 |
| 27 | Ga0070672_100092342 | 3300005543 | Bacteria | 2443 |
| 28 | Ga0070672_100135695 | 3300005543 | Bacteria | 2026 |
| 29 | Ga0070664_100402212 | 3300005564 | Bacteria | 1252 |
| 30 | Ga0068854_100607218 | 3300005578 | Bacteria | 935 |
| 31 | Ga0070702_100182053 | 3300005615 | Bacteria | 1376 |
| 32 | Ga0068852_100033762 | 3300005616 | Bacteria | 4252 |
| 33 | Ga0068851_10004702 | 3300005834 | Bacteria | 6175 |
| 34 | Ga0068851_10026563 | 3300005834 | Bacteria | 2846 |
| 35 | Ga0068863_100050726 | 3300005841 | Bacteria | 3932 |
| 36 | Ga0070717_10645499 | 3300006028 | Bacteria | 961 |
| 37 | Ga0075365_10287120 | 3300006038 | Bacteria | 1158 |
| 38 | Ga0075368_10045672 | 3300006042 | Bacteria | 1731 |
| 39 | Ga0075363_100212735 | 3300006048 | Bacteria | 1107 |
| 40 | Ga0075364_10468591 | 3300006051 | Bacteria | 861 |
| 41 | Ga0075362_10360127 | 3300006177 | Bacteria | 729 |
| 42 | Ga0075367_10018827 | 3300006178 | Bacteria | 3817 |
| 43 | Ga0075366_10019493 | 3300006195 | Bacteria | 3926 |
| 44 | Ga0075366_10172208 | 3300006195 | Bacteria | 1314 |
| 45 | Ga0075370_10002635 | 3300006353 | Bacteria | 8377 |
| 46 | Ga0075370_10025547 | 3300006353 | Bacteria | 3269 |
| 47 | Ga0075370_10078943 | 3300006353 | Bacteria | 1890 |
| 48 | Ga0068871_100113022 | 3300006358 | Bacteria | 2287 |
| 49 | Ga0068871_100352661 | 3300006358 | Bacteria | 1302 |
| 50 | Ga0075430_100016785 | 3300006846 | Bacteria | 6235 |
| 51 | Ga0075429_100000180 | 3300006880 | Bacteria | 41123 |
| 52 | Ga0111539_10154144 | 3300009094 | Bacteria | 2689 |
| 53 | Ga0105243_10001937 | 3300009148 | Bacteria | 17629 |
| 54 | Ga0105248_10166585 | 3300009177 | Bacteria | 2484 |
| 55 | Ga0105248_10174828 | 3300009177 | Bacteria | 2420 |
| 56 | Ga0105248_10562672 | 3300009177 | Bacteria | 1286 |
| 57 | Ga0157378_10194956 | 3300013297 | Bacteria | 1913 |
| 58 | Ga0157375_10414698 | 3300013308 | Bacteria | 1513 |
| 59 | Ga0157375_10524459 | 3300013308 | Bacteria | 1347 |
| 60 | Ga0157380_11606005 | 3300014326 | Bacteria | 706 |
| 61 | Ga0182008_10180774 | 3300014497 | Bacteria | 1067 |
| 62 | Ga0157377_11142926 | 3300014745 | Bacteria | 599 |
| 63 | Ga0182006_1015796 | 3300015261 | Bacteria | 3230 |
| 64 | Ga0182007_10035163 | 3300015262 | Bacteria | 1689 |
| 65 | Ga0182007_10373544 | 3300015262 | Bacteria | 540 |
| 66 | Ga0163161_10421394 | 3300017792 | Bacteria | 1074 |
| 67 | Ga0213872_10000861 | 3300021361 | Bacteria | 21979 |
| 68 | Ga0213872_10003870 | 3300021361 | Bacteria | 8125 |
| 69 | Ga0213872_10006035 | 3300021361 | Bacteria | 6133 |
| 70 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 71 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 72 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 73 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 74 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 75 | Ga0209673_1014257 | 3300025273 | Bacteria | 3082 |
| 76 | Ga0209675_1001754 | 3300025291 | Bacteria | 11902 |
| 77 | Ga0209051_1000861 | 3300025303 | Bacteria | 30871 |
| 78 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 79 | Ga0207656_10004537 | 3300025321 | Bacteria | 4860 |
| 80 | Ga0207656_10010104 | 3300025321 | Bacteria | 3522 |
| 81 | Ga0207680_10011262 | 3300025903 | Bacteria | 4513 |
| 82 | Ga0207645_10322898 | 3300025907 | Bacteria | 1030 |
| 83 | Ga0207643_10078532 | 3300025908 | Bacteria | 1910 |
| 84 | Ga0207705_10161027 | 3300025909 | Bacteria | 1686 |
| 85 | Ga0207705_10209982 | 3300025909 | Bacteria | 1477 |
| 86 | Ga0207684_10011407 | 3300025910 | Bacteria | 7776 |
| 87 | Ga0207657_10237876 | 3300025919 | Bacteria | 1455 |
| 88 | Ga0207646_10085988 | 3300025922 | Bacteria | 2813 |
| 89 | Ga0207659_10821811 | 3300025926 | Bacteria | 798 |
| 90 | Ga0207644_10015839 | 3300025931 | Bacteria | 5069 |
| 91 | Ga0207644_10032757 | 3300025931 | Bacteria | 3628 |
| 92 | Ga0207690_10084704 | 3300025932 | Bacteria | 2223 |
| 93 | Ga0207686_10007713 | 3300025934 | Bacteria | 5800 |
| 94 | Ga0207669_11126028 | 3300025937 | Bacteria | 663 |
| 95 | Ga0207691_10312622 | 3300025940 | Bacteria | 1348 |
| 96 | Ga0207711_10047793 | 3300025941 | Bacteria | 3660 |
| 97 | Ga0207711_10061911 | 3300025941 | Bacteria | 3227 |
| 98 | Ga0207651_10088435 | 3300025960 | Bacteria | 2258 |
| 99 | Ga0207651_10880965 | 3300025960 | Bacteria | 796 |
| 100 | Ga0207640_10321524 | 3300025981 | Bacteria | 1232 |
| 101 | Ga0207658_10557740 | 3300025986 | Bacteria | 1026 |
| 102 | Ga0207677_10455645 | 3300026023 | Bacteria | 1097 |
| 103 | Ga0207678_10029428 | 3300026067 | Bacteria | 4794 |
| 104 | Ga0207678_10485393 | 3300026067 | Bacteria | 1076 |
| 105 | Ga0207702_11962158 | 3300026078 | Bacteria | 576 |
| 106 | Ga0207641_10016281 | 3300026088 | Bacteria | 6089 |
| 107 | Ga0207648_11580539 | 3300026089 | Bacteria | 616 |
| 108 | Ga0207676_10317671 | 3300026095 | Bacteria | 1428 |
| 109 | Ga0207683_10343938 | 3300026121 | Bacteria | 1368 |
| 110 | Ga0207698_10016534 | 3300026142 | Bacteria | 4977 |
| 111 | Ga0209813_10012966 | 3300027866 | Bacteria | 2215 |
| 112 | Ga0209974_10007232 | 3300027876 | Bacteria | 3832 |
| 113 | Ga0207428_10170502 | 3300027907 | Bacteria | 1649 |
| 114 | Ga0268264_10404620 | 3300028381 | Bacteria | 1312 |
| 115 | Ga0307515_10335057 | 3300028794 | Bacteria | 1169 |
| 116 | Ga0265328_10013421 | 3300031239 | Bacteria | 3244 |
| 117 | Ga0265331_10001807 | 3300031250 | Bacteria | 15200 |
| 118 | Ga0265327_10000042 | 3300031251 | Bacteria | 287487 |
| 119 | Ga0307516_10210902 | 3300031730 | Bacteria | 1657 |
| 120 | Ga0307410_10595338 | 3300031852 | Bacteria | 922 |
| 121 | Ga0307412_10880643 | 3300031911 | Bacteria | 783 |
| 122 | Ga0307412_11170015 | 3300031911 | Bacteria | 687 |
| 123 | Ga0307416_100397619 | 3300032002 | Bacteria | 1414 |
| 124 | Ga0373947_0447840 | 3300035725 | Bacteria | 874 |
| 125 | Ga0395899_0433547 | 3300037312 | Bacteria | 864 |
| 126 | Ga0395898_0351686 | 3300037466 | Bacteria | 1405 |
| 127 | Ga0395898_0369460 | 3300037466 | Bacteria | 1368 |
| 128 | Ga0395898_0553389 | 3300037466 | Bacteria | 1093 |
| 129 | Ga0395905_0000330 | 3300037471 | Bacteria | 67978 |
| 130 | Ga0395905_0001286 | 3300037471 | Bacteria | 30908 |
| 131 | Ga0395905_0006945 | 3300037471 | Bacteria | 11315 |
| 132 | Ga0395905_0017509 | 3300037471 | Bacteria | 6803 |
| 133 | Ga0395905_0027233 | 3300037471 | Bacteria | 5390 |
| 134 | Ga0395901_0090933 | 3300038443 | Bacteria | 3195 |
| 135 | Ga0395901_0094639 | 3300038443 | Bacteria | 3130 |
| 136 | Ga0436361_0455065 | 3300039447 | Bacteria | 73475 |
| 137 | Ga0436361_0516261 | 3300039447 | Bacteria | 5785 |
| 138 | Ga0436361_0968600 | 3300039447 | Bacteria | 8144 |
| 139 | Ga0451853_0976526 | 3300041512 | Bacteria | 1953 |
| 140 | Ga0439449_0098743 | 3300042007 | Bacteria | 1079 |
| 141 | Ga0450894_032158 | 3300042131 | Bacteria | 735 |
| 142 | Ga0439458_0050483 | 3300042157 | Bacteria | 1026 |
| 143 | Ga0451577_0007618 | 3300042876 | Bacteria | 10619 |
| 144 | Ga0451577_0140588 | 3300042876 | Bacteria | 2169 |
| 145 | Ga0451577_0176390 | 3300042876 | Bacteria | 1926 |
| 146 | Ga0466969_0023680 | 3300044656 | Bacteria | 3162 |
| 147 | Ga0466969_0147817 | 3300044656 | Bacteria | 1083 |
| 148 | Ga0466972_0041539 | 3300044658 | Bacteria | 2239 |
| 149 | Ga0453683_0246681 | 3300044673 | Bacteria | 1138 |
| 150 | Ga0466965_0066840 | 3300044683 | Bacteria | 1803 |
| 151 | Ga0466965_0072609 | 3300044683 | Bacteria | 1731 |
| 152 | Ga0466965_0165496 | 3300044683 | Bacteria | 1161 |
| 153 | Ga0466966_0161455 | 3300044684 | Bacteria | 1364 |
| 154 | Ga0466966_0272989 | 3300044684 | Bacteria | 1017 |
| 155 | Ga0466961_0018099 | 3300044693 | Bacteria | 4530 |
| 156 | Ga0466964_0111652 | 3300044706 | Bacteria | 1220 |
| 157 | Ga0466964_0133258 | 3300044706 | Bacteria | 1134 |
| 158 | Ga0453684_0005959 | 3300044712 | Bacteria | 23631 |
| 159 | Ga0453684_0065914 | 3300044712 | Bacteria | 4614 |
| 160 | Ga0453684_0147612 | 3300044712 | Bacteria | 2799 |
| 161 | Ga0466971_0060181 | 3300044719 | Bacteria | 1716 |
| 162 | Ga0466971_0068326 | 3300044719 | Bacteria | 1611 |
| 163 | Ga0466970_0238434 | 3300044765 | Bacteria | 1017 |
| 164 | Ga0466957_0028532 | 3300044842 | Bacteria | 3324 |
| 165 | Ga0466960_0449845 | 3300044901 | Bacteria | 748 |
| 166 | Ga0466959_0005179 | 3300045049 | Bacteria | 8886 |
| 167 | Ga0466959_0094413 | 3300045049 | Bacteria | 2146 |
| 168 | Ga0451576_0012728 | 3300045051 | Bacteria | 9445 |
| 169 | Ga0451576_0043153 | 3300045051 | Bacteria | 4758 |
| 170 | Ga0466958_0146812 | 3300045836 | Bacteria | 1486 |
| 171 | Ga0466958_0362383 | 3300045836 | Bacteria | 934 |
| 172 | Ga0466967_0345952 | 3300045976 | Bacteria | 1438 |
| 173 | Ga0495651_0002400 | 3300046462 | Bacteria | 14464 |
| 174 | Ga0495650_0000387 | 3300046471 | Bacteria | 75577 |
| 175 | Ga0495580_0084662 | 3300046472 | Bacteria | 2208 |
| 176 | Ga0495605_0024267 | 3300046474 | Bacteria | 3175 |
| 177 | Ga0495584_0001153 | 3300046491 | Bacteria | 16284 |
| 178 | Ga0495585_0279540 | 3300046492 | Bacteria | 825 |
| 179 | Ga0495596_0031172 | 3300046500 | Bacteria | 2131 |
| 180 | Ga0495596_0075603 | 3300046500 | Bacteria | 1308 |
| 181 | Ga0495607_0005362 | 3300046501 | Bacteria | 9208 |
| 182 | Ga0495607_0013739 | 3300046501 | Bacteria | 5293 |
| 183 | Ga0495583_0000074 | 3300046506 | Bacteria | 177273 |
| 184 | Ga0495608_0001403 | 3300046511 | Bacteria | 17129 |
| 185 | Ga0495616_0055156 | 3300046513 | Bacteria | 1968 |
| 186 | Ga0495620_0189668 | 3300046515 | Bacteria | 793 |
| 187 | Ga0495628_0000474 | 3300046516 | Bacteria | 36662 |
| 188 | Ga0495630_0008028 | 3300046517 | Bacteria | 7585 |
| 189 | Ga0495643_0007384 | 3300046522 | Bacteria | 7099 |
| 190 | Ga0495644_0004506 | 3300046523 | Bacteria | 5473 |
| 191 | Ga0495648_0075227 | 3300046524 | Bacteria | 1943 |
| 192 | Ga0495642_0176008 | 3300046528 | Bacteria | 930 |
| 193 | Ga0495642_0405452 | 3300046528 | Bacteria | 601 |
| 194 | Ga0495652_0002709 | 3300046529 | Bacteria | 17989 |
| 195 | Ga0495652_0007737 | 3300046529 | Bacteria | 9883 |
| 196 | Ga0495586_0145725 | 3300046535 | Bacteria | 1330 |
| 197 | Ga0495587_0106609 | 3300046536 | Bacteria | 1611 |
| 198 | Ga0495587_0317959 | 3300046536 | Bacteria | 869 |
| 199 | Ga0495609_0000403 | 3300046538 | Bacteria | 36436 |
| 200 | Ga0495597_0234741 | 3300046542 | Bacteria | 725 |
| 201 | Ga0495645_0706803 | 3300046543 | Bacteria | 611 |
| 202 | Ga0495633_0126597 | 3300046558 | Bacteria | 1182 |
| 203 | Ga0495633_0270008 | 3300046558 | Bacteria | 774 |
| 204 | Ga0495656_0003519 | 3300046615 | Bacteria | 5299 |
| 205 | Ga0495611_0035412 | 3300046648 | Bacteria | 2211 |
| 206 | Ga0495661_0001725 | 3300046665 | Bacteria | 17691 |
| 207 | Ga0495588_0206978 | 3300046674 | Bacteria | 1036 |
| 208 | Ga0495623_0018754 | 3300046679 | Bacteria | 4467 |
| 209 | Ga0495669_0015823 | 3300046684 | Bacteria | 3229 |
| 210 | Ga0495649_0000697 | 3300046694 | Bacteria | 27422 |
| 211 | Ga0495589_0012565 | 3300046794 | Bacteria | 4382 |
| 212 | Ga0495589_0089350 | 3300046794 | Bacteria | 1496 |
| 213 | Ga0495600_0157241 | 3300046809 | Bacteria | 1470 |
| 214 | Ga0495604_0018697 | 3300047317 | Bacteria | 5549 |
| 215 | Ga0495636_0452804 | 3300047318 | Bacteria | 616 |
| 216 | Ga0495672_0000101 | 3300047320 | Bacteria | 139193 |
| 217 | Ga0495672_0068087 | 3300047320 | Bacteria | 2025 |
| 218 | Ga0495676_0256388 | 3300047321 | Bacteria | 1191 |
| 219 | Ga0495680_0108841 | 3300047322 | Bacteria | 2056 |
| 220 | Ga0495683_0005007 | 3300047323 | Bacteria | 7420 |
| 221 | Ga0495677_0000863 | 3300047445 | Bacteria | 12273 |
| 222 | Ga0495677_0006091 | 3300047445 | Bacteria | 4560 |
| 223 | Ga0495679_003393 | 3300047446 | Bacteria | 7675 |
| 224 | Ga0495686_0000109 | 3300047472 | Bacteria | 171482 |
| 225 | Ga0495686_0007449 | 3300047472 | Bacteria | 8204 |
| 226 | Ga0495593_0296409 | 3300047673 | Bacteria | 808 |
| 227 | Ga0495602_0006681 | 3300048088 | Bacteria | 12088 |
| 228 | Ga0495602_0080600 | 3300048088 | Bacteria | 2741 |
| 229 | Ga0495626_0000048 | 3300048091 | Bacteria | 161634 |
| 230 | Ga0495626_0016606 | 3300048091 | Bacteria | 3735 |
| 231 | Ga0495626_0088004 | 3300048091 | Bacteria | 1369 |
| 232 | Ga0496104_0130891 | 3300048907 | Bacteria | 2410 |
| 233 | Ga0496104_0238833 | 3300048907 | Bacteria | 1729 |
| 234 | Ga0496104_0533017 | 3300048907 | Bacteria | 1085 |
| 235 | Ga0496105_0238289 | 3300048908 | Bacteria | 1477 |
| 236 | Ga0496107_0832490 | 3300048910 | Bacteria | 675 |
| 237 | Ga0496109_0131836 | 3300048912 | Bacteria | 2333 |
| 238 | Ga0496114_0104260 | 3300048917 | Bacteria | 2425 |
| 239 | Ga0496114_0769902 | 3300048917 | Bacteria | 840 |
| 240 | Ga0496118_0346270 | 3300048921 | Bacteria | 794 |
| 241 | Ga0496121_0065826 | 3300048924 | Bacteria | 2946 |
| 242 | Ga0496122_0008722 | 3300048925 | Bacteria | 10854 |
| 243 | Ga0496123_0074535 | 3300048926 | Bacteria | 2100 |
| 244 | Ga0496125_0000650 | 3300048928 | Bacteria | 58031 |
| 245 | Ga0496126_0059493 | 3300048929 | Bacteria | 3440 |
| 246 | Ga0495678_009789 | 3300049459 | Bacteria | 4708 |
| 247 | Ga0501035_0285748 | 3300049822 | Bacteria | 1393 |
| 248 | Ga0501044_0052512 | 3300049823 | Bacteria | 4200 |
| 249 | nmdc:mga0k408_13597_c1 | 3300050493 | Bacteria | 4468 |
| 250 | nmdc:mga0k408_84524_c1 | 3300050493 | Bacteria | 1862 |
| 251 | nmdc:mga06z11_313331_c1 | 3300050494 | Bacteria | 935 |
| 252 | nmdc:mga07m45_12616_c1 | 3300050496 | Bacteria | 4469 |
| 253 | nmdc:mga07m45_164297_c1 | 3300050496 | Bacteria | 1289 |
| 254 | nmdc:mga07m45_8073_c1 | 3300050496 | Bacteria | 2435 |
| 255 | nmdc:mga05p37_84299_c2 | 3300050507 | Bacteria | 3477 |
| 256 | nmdc:mga09592_518_c1 | 3300050508 | Bacteria | 29234 |
| 257 | nmdc:mga0qj67_10350_c1 | 3300050509 | Bacteria | 6967 |
| 258 | nmdc:mga08y16_57848_c1 | 3300050511 | Bacteria | 4050 |
| 259 | Ga0500658_0146848 | 3300053134 | Bacteria | 1061 |
| 260 | Ga0466962_0010973 | 3300061719 | Bacteria | 4360 |
| 261 | Ga0466962_0115101 | 3300061719 | Bacteria | 1295 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10019493 | Ga0075366_100194931 | 153 |
| 2 | 3300050493 | nmdc:mga0k408_13597_c1 | nmdc:mga0k408_13597_c1_3279_3776 | 153 |
| 3 | 3300025291 | Ga0209675_1001754 | Ga0209675_100175410 | 155 |
| 4 | 3300037471 | Ga0395905_0000330 | Ga0395905_0000330_56595_57071 | 158 |
| 5 | 3300003751 | Ga0055538_1000020 | Ga0055538_1000020143 | 159 |
| 6 | 3300003752 | Ga0055539_1000025 | Ga0055539_1000025143 | 159 |
| 7 | 3300003756 | Ga0055533_1000034 | Ga0055533_1000034100 | 159 |
| 8 | 3300003759 | Ga0055525_1000044 | Ga0055525_1000044143 | 159 |
| 9 | 3300003792 | Ga0055540_1004327 | Ga0055540_10043272 | 159 |
| 10 | 3300003794 | Ga0055531_10000282 | Ga0055531_1000028237 | 159 |
| 11 | 3300003841 | Ga0055541_1000019 | Ga0055541_1000019143 | 159 |
| 12 | 3300005327 | Ga0070658_10091268 | Ga0070658_100912682 | 159 |
| 13 | 3300005331 | Ga0070670_100134830 | Ga0070670_1001348302 | 159 |
| 14 | 3300005334 | Ga0068869_100263992 | Ga0068869_1002639922 | 159 |
| 15 | 3300005335 | Ga0070666_10158642 | Ga0070666_101586421 | 159 |
| 16 | 3300005338 | Ga0068868_100290727 | Ga0068868_1002907272 | 159 |
| 17 | 3300005354 | Ga0070675_100227877 | Ga0070675_1002278772 | 159 |
| 18 | 3300005355 | Ga0070671_100033194 | Ga0070671_1000331942 | 159 |
| 19 | 3300005364 | Ga0070673_100017355 | Ga0070673_1000173553 | 159 |
| 20 | 3300005364 | Ga0070673_100245826 | Ga0070673_1002458262 | 159 |
| 21 | 3300005366 | Ga0070659_100077925 | Ga0070659_1000779253 | 159 |
| 22 | 3300005367 | Ga0070667_101211169 | Ga0070667_1012111691 | 159 |
| 23 | 3300005455 | Ga0070663_100066415 | Ga0070663_1000664152 | 159 |
| 24 | 3300005455 | Ga0070663_100172354 | Ga0070663_1001723542 | 159 |
| 25 | 3300005456 | Ga0070678_100304336 | Ga0070678_1003043362 | 159 |
| 26 | 3300005456 | Ga0070678_100334338 | Ga0070678_1003343382 | 159 |
| 27 | 3300005467 | Ga0070706_100001360 | Ga0070706_1000013606 | 159 |
| 28 | 3300005468 | Ga0070707_100968378 | Ga0070707_1009683781 | 159 |
| 29 | 3300005468 | Ga0070707_101470738 | Ga0070707_1014707381 | 159 |
| 30 | 3300005471 | Ga0070698_100253855 | Ga0070698_1002538551 | 159 |
| 31 | 3300005543 | Ga0070672_100092342 | Ga0070672_1000923421 | 159 |
| 32 | 3300005543 | Ga0070672_100135695 | Ga0070672_1001356952 | 159 |
| 33 | 3300005564 | Ga0070664_100402212 | Ga0070664_1004022121 | 159 |
| 34 | 3300005578 | Ga0068854_100607218 | Ga0068854_1006072182 | 159 |
| 35 | 3300005615 | Ga0070702_100182053 | Ga0070702_1001820532 | 159 |
| 36 | 3300005616 | Ga0068852_100033762 | Ga0068852_1000337622 | 159 |
| 37 | 3300005834 | Ga0068851_10004702 | Ga0068851_100047021 | 159 |
| 38 | 3300005834 | Ga0068851_10026563 | Ga0068851_100265632 | 159 |
| 39 | 3300005841 | Ga0068863_100050726 | Ga0068863_1000507262 | 159 |
| 40 | 3300006028 | Ga0070717_10645499 | Ga0070717_106454991 | 159 |
| 41 | 3300006038 | Ga0075365_10287120 | Ga0075365_102871201 | 159 |
| 42 | 3300006042 | Ga0075368_10045672 | Ga0075368_100456722 | 159 |
| 43 | 3300006048 | Ga0075363_100212735 | Ga0075363_1002127352 | 159 |
| 44 | 3300006051 | Ga0075364_10468591 | Ga0075364_104685912 | 159 |
| 45 | 3300006177 | Ga0075362_10360127 | Ga0075362_103601271 | 159 |
| 46 | 3300006178 | Ga0075367_10018827 | Ga0075367_100188273 | 159 |
| 47 | 3300006195 | Ga0075366_10172208 | Ga0075366_101722082 | 159 |
| 48 | 3300006353 | Ga0075370_10002635 | Ga0075370_100026352 | 159 |
| 49 | 3300006353 | Ga0075370_10025547 | Ga0075370_100255474 | 159 |
| 50 | 3300006353 | Ga0075370_10078943 | Ga0075370_100789432 | 159 |
| 51 | 3300006358 | Ga0068871_100113022 | Ga0068871_1001130224 | 159 |
| 52 | 3300006358 | Ga0068871_100352661 | Ga0068871_1003526612 | 159 |
| 53 | 3300006846 | Ga0075430_100016785 | Ga0075430_1000167853 | 159 |
| 54 | 3300006880 | Ga0075429_100000180 | Ga0075429_10000018016 | 159 |
| 55 | 3300009094 | Ga0111539_10154144 | Ga0111539_101541442 | 159 |
| 56 | 3300009148 | Ga0105243_10001937 | Ga0105243_100019377 | 159 |
| 57 | 3300009177 | Ga0105248_10166585 | Ga0105248_101665852 | 159 |
| 58 | 3300009177 | Ga0105248_10174828 | Ga0105248_101748284 | 159 |
| 59 | 3300009177 | Ga0105248_10562672 | Ga0105248_105626722 | 159 |
| 60 | 3300013297 | Ga0157378_10194956 | Ga0157378_101949562 | 159 |
| 61 | 3300013308 | Ga0157375_10414698 | Ga0157375_104146982 | 159 |
| 62 | 3300013308 | Ga0157375_10524459 | Ga0157375_105244592 | 159 |
| 63 | 3300014326 | Ga0157380_11606005 | Ga0157380_116060051 | 159 |
| 64 | 3300014497 | Ga0182008_10180774 | Ga0182008_101807741 | 159 |
| 65 | 3300014745 | Ga0157377_11142926 | Ga0157377_111429261 | 159 |
| 66 | 3300015261 | Ga0182006_1015796 | Ga0182006_10157964 | 159 |
| 67 | 3300015262 | Ga0182007_10035163 | Ga0182007_100351632 | 159 |
| 68 | 3300015262 | Ga0182007_10373544 | Ga0182007_103735441 | 159 |
| 69 | 3300017792 | Ga0163161_10421394 | Ga0163161_104213942 | 159 |
| 70 | 3300021361 | Ga0213872_10000861 | Ga0213872_1000086120 | 159 |
| 71 | 3300021361 | Ga0213872_10003870 | Ga0213872_100038707 | 159 |
| 72 | 3300021361 | Ga0213872_10006035 | Ga0213872_100060355 | 159 |
| 73 | 3300025224 | Ga0209784_100002 | Ga0209784_100002146 | 159 |
| 74 | 3300025225 | Ga0209566_100003 | Ga0209566_100003146 | 159 |
| 75 | 3300025226 | Ga0209674_100004 | Ga0209674_100004146 | 159 |
| 76 | 3300025230 | Ga0209563_100006 | Ga0209563_100006146 | 159 |
| 77 | 3300025253 | Ga0209677_100003 | Ga0209677_100003146 | 159 |
| 78 | 3300025273 | Ga0209673_1014257 | Ga0209673_10142572 | 159 |
| 79 | 3300025303 | Ga0209051_1000861 | Ga0209051_100086124 | 159 |
| 80 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022413 | 159 |
| 81 | 3300025321 | Ga0207656_10004537 | Ga0207656_100045371 | 159 |
| 82 | 3300025321 | Ga0207656_10010104 | Ga0207656_100101042 | 159 |
| 83 | 3300025903 | Ga0207680_10011262 | Ga0207680_100112621 | 159 |
| 84 | 3300025907 | Ga0207645_10322898 | Ga0207645_103228981 | 159 |
| 85 | 3300025908 | Ga0207643_10078532 | Ga0207643_100785322 | 159 |
| 86 | 3300025909 | Ga0207705_10161027 | Ga0207705_101610272 | 159 |
| 87 | 3300025909 | Ga0207705_10209982 | Ga0207705_102099822 | 159 |
| 88 | 3300025910 | Ga0207684_10011407 | Ga0207684_100114077 | 159 |
| 89 | 3300025919 | Ga0207657_10237876 | Ga0207657_102378762 | 159 |
| 90 | 3300025922 | Ga0207646_10085988 | Ga0207646_100859884 | 159 |
| 91 | 3300025926 | Ga0207659_10821811 | Ga0207659_108218111 | 159 |
| 92 | 3300025931 | Ga0207644_10015839 | Ga0207644_100158392 | 159 |
| 93 | 3300025931 | Ga0207644_10032757 | Ga0207644_100327574 | 159 |
| 94 | 3300025932 | Ga0207690_10084704 | Ga0207690_100847042 | 159 |
| 95 | 3300025934 | Ga0207686_10007713 | Ga0207686_100077132 | 159 |
| 96 | 3300025937 | Ga0207669_11126028 | Ga0207669_111260282 | 159 |
| 97 | 3300025940 | Ga0207691_10312622 | Ga0207691_103126222 | 159 |
| 98 | 3300025941 | Ga0207711_10047793 | Ga0207711_100477932 | 159 |
| 99 | 3300025941 | Ga0207711_10061911 | Ga0207711_100619112 | 159 |
| 100 | 3300025960 | Ga0207651_10088435 | Ga0207651_100884352 | 159 |
| 101 | 3300025960 | Ga0207651_10880965 | Ga0207651_108809652 | 159 |
| 102 | 3300025981 | Ga0207640_10321524 | Ga0207640_103215242 | 159 |
| 103 | 3300025986 | Ga0207658_10557740 | Ga0207658_105577401 | 159 |
| 104 | 3300026023 | Ga0207677_10455645 | Ga0207677_104556452 | 159 |
| 105 | 3300026067 | Ga0207678_10029428 | Ga0207678_100294283 | 159 |
| 106 | 3300026067 | Ga0207678_10485393 | Ga0207678_104853932 | 159 |
| 107 | 3300026078 | Ga0207702_11962158 | Ga0207702_119621581 | 159 |
| 108 | 3300026088 | Ga0207641_10016281 | Ga0207641_100162813 | 159 |
| 109 | 3300026089 | Ga0207648_11580539 | Ga0207648_115805391 | 159 |
| 110 | 3300026095 | Ga0207676_10317671 | Ga0207676_103176712 | 159 |
| 111 | 3300026121 | Ga0207683_10343938 | Ga0207683_103439382 | 159 |
| 112 | 3300026142 | Ga0207698_10016534 | Ga0207698_100165342 | 159 |
| 113 | 3300027866 | Ga0209813_10012966 | Ga0209813_100129661 | 159 |
| 114 | 3300027876 | Ga0209974_10007232 | Ga0209974_100072327 | 159 |
| 115 | 3300027907 | Ga0207428_10170502 | Ga0207428_101705023 | 159 |
| 116 | 3300028381 | Ga0268264_10404620 | Ga0268264_104046202 | 159 |
| 117 | 3300028794 | Ga0307515_10335057 | Ga0307515_103350572 | 159 |
| 118 | 3300031239 | Ga0265328_10013421 | Ga0265328_100134212 | 159 |
| 119 | 3300031250 | Ga0265331_10001807 | Ga0265331_1000180716 | 159 |
| 120 | 3300031251 | Ga0265327_10000042 | Ga0265327_1000004258 | 159 |
| 121 | 3300031730 | Ga0307516_10210902 | Ga0307516_102109022 | 159 |
| 122 | 3300031852 | Ga0307410_10595338 | Ga0307410_105953381 | 159 |
| 123 | 3300031911 | Ga0307412_10880643 | Ga0307412_108806432 | 159 |
| 124 | 3300031911 | Ga0307412_11170015 | Ga0307412_111700152 | 159 |
| 125 | 3300032002 | Ga0307416_100397619 | Ga0307416_1003976192 | 159 |
| 126 | 3300035725 | Ga0373947_0447840 | Ga0373947_0447840_310_792 | 159 |
| 127 | 3300037312 | Ga0395899_0433547 | Ga0395899_0433547_281_766 | 159 |
| 128 | 3300037466 | Ga0395898_0351686 | Ga0395898_0351686_170_658 | 159 |
| 129 | 3300037466 | Ga0395898_0369460 | Ga0395898_0369460_609_1088 | 159 |
| 130 | 3300037466 | Ga0395898_0553389 | Ga0395898_0553389_394_927 | 159 |
| 131 | 3300037471 | Ga0395905_0001286 | Ga0395905_0001286_30166_30651 | 159 |
| 132 | 3300037471 | Ga0395905_0006945 | Ga0395905_0006945_487_978 | 159 |
| 133 | 3300037471 | Ga0395905_0017509 | Ga0395905_0017509_191_676 | 159 |
| 134 | 3300037471 | Ga0395905_0027233 | Ga0395905_0027233_526_1014 | 159 |
| 135 | 3300038443 | Ga0395901_0090933 | Ga0395901_0090933_965_1450 | 159 |
| 136 | 3300038443 | Ga0395901_0094639 | Ga0395901_0094639_2068_2556 | 159 |
| 137 | 3300039447 | Ga0436361_0455065 | Ga0436361_0455065_4171_4698 | 159 |
| 138 | 3300039447 | Ga0436361_0516261 | Ga0436361_0516261_1539_2018 | 159 |
| 139 | 3300039447 | Ga0436361_0968600 | Ga0436361_0968600_4643_5125 | 159 |
| 140 | 3300041512 | Ga0451853_0976526 | Ga0451853_0976526_210_692 | 159 |
| 141 | 3300042007 | Ga0439449_0098743 | Ga0439449_0098743_574_1062 | 159 |
| 142 | 3300042131 | Ga0450894_032158 | Ga0450894_032158_215_712 | 159 |
| 143 | 3300042157 | Ga0439458_0050483 | Ga0439458_0050483_20_517 | 159 |
| 144 | 3300042876 | Ga0451577_0007618 | Ga0451577_0007618_3598_4077 | 159 |
| 145 | 3300042876 | Ga0451577_0140588 | Ga0451577_0140588_1059_1562 | 159 |
| 146 | 3300042876 | Ga0451577_0176390 | Ga0451577_0176390_777_1271 | 159 |
| 147 | 3300044656 | Ga0466969_0023680 | Ga0466969_0023680_619_1098 | 159 |
| 148 | 3300044656 | Ga0466969_0147817 | Ga0466969_0147817_477_971 | 159 |
| 149 | 3300044658 | Ga0466972_0041539 | Ga0466972_0041539_934_1425 | 159 |
| 150 | 3300044673 | Ga0453683_0246681 | Ga0453683_0246681_424_906 | 159 |
| 151 | 3300044683 | Ga0466965_0066840 | Ga0466965_0066840_442_936 | 159 |
| 152 | 3300044683 | Ga0466965_0072609 | Ga0466965_0072609_356_847 | 159 |
| 153 | 3300044683 | Ga0466965_0165496 | Ga0466965_0165496_297_782 | 159 |
| 154 | 3300044684 | Ga0466966_0161455 | Ga0466966_0161455_254_739 | 159 |
| 155 | 3300044684 | Ga0466966_0272989 | Ga0466966_0272989_511_990 | 159 |
| 156 | 3300044693 | Ga0466961_0018099 | Ga0466961_0018099_2394_2873 | 159 |
| 157 | 3300044706 | Ga0466964_0111652 | Ga0466964_0111652_148_642 | 159 |
| 158 | 3300044706 | Ga0466964_0133258 | Ga0466964_0133258_116_595 | 159 |
| 159 | 3300044712 | Ga0453684_0005959 | Ga0453684_0005959_12394_12885 | 159 |
| 160 | 3300044712 | Ga0453684_0065914 | Ga0453684_0065914_417_896 | 159 |
| 161 | 3300044712 | Ga0453684_0147612 | Ga0453684_0147612_2073_2561 | 159 |
| 162 | 3300044719 | Ga0466971_0060181 | Ga0466971_0060181_469_963 | 159 |
| 163 | 3300044719 | Ga0466971_0068326 | Ga0466971_0068326_191_670 | 159 |
| 164 | 3300044765 | Ga0466970_0238434 | Ga0466970_0238434_158_652 | 159 |
| 165 | 3300044842 | Ga0466957_0028532 | Ga0466957_0028532_869_1354 | 159 |
| 166 | 3300044901 | Ga0466960_0449845 | Ga0466960_0449845_178_669 | 159 |
| 167 | 3300045049 | Ga0466959_0005179 | Ga0466959_0005179_2149_2628 | 159 |
| 168 | 3300045049 | Ga0466959_0094413 | Ga0466959_0094413_77_562 | 159 |
| 169 | 3300045051 | Ga0451576_0012728 | Ga0451576_0012728_917_1405 | 159 |
| 170 | 3300045051 | Ga0451576_0043153 | Ga0451576_0043153_2466_2945 | 159 |
| 171 | 3300045836 | Ga0466958_0146812 | Ga0466958_0146812_48_542 | 159 |
| 172 | 3300045836 | Ga0466958_0362383 | Ga0466958_0362383_17_502 | 159 |
| 173 | 3300045976 | Ga0466967_0345952 | Ga0466967_0345952_449_943 | 159 |
| 174 | 3300046462 | Ga0495651_0002400 | Ga0495651_0002400_9765_10244 | 159 |
| 175 | 3300046471 | Ga0495650_0000387 | Ga0495650_0000387_40357_40842 | 159 |
| 176 | 3300046472 | Ga0495580_0084662 | Ga0495580_0084662_1327_1812 | 159 |
| 177 | 3300046474 | Ga0495605_0024267 | Ga0495605_0024267_2664_3149 | 159 |
| 178 | 3300046491 | Ga0495584_0001153 | Ga0495584_0001153_10494_10979 | 159 |
| 179 | 3300046492 | Ga0495585_0279540 | Ga0495585_0279540_298_783 | 159 |
| 180 | 3300046500 | Ga0495596_0031172 | Ga0495596_0031172_168_653 | 159 |
| 181 | 3300046500 | Ga0495596_0075603 | Ga0495596_0075603_580_1065 | 159 |
| 182 | 3300046501 | Ga0495607_0005362 | Ga0495607_0005362_6605_7090 | 159 |
| 183 | 3300046501 | Ga0495607_0013739 | Ga0495607_0013739_196_696 | 159 |
| 184 | 3300046506 | Ga0495583_0000074 | Ga0495583_0000074_32451_32936 | 159 |
| 185 | 3300046511 | Ga0495608_0001403 | Ga0495608_0001403_7593_8072 | 159 |
| 186 | 3300046513 | Ga0495616_0055156 | Ga0495616_0055156_192_677 | 159 |
| 187 | 3300046515 | Ga0495620_0189668 | Ga0495620_0189668_51_542 | 159 |
| 188 | 3300046516 | Ga0495628_0000474 | Ga0495628_0000474_26112_26591 | 159 |
| 189 | 3300046517 | Ga0495630_0008028 | Ga0495630_0008028_1939_2424 | 159 |
| 190 | 3300046522 | Ga0495643_0007384 | Ga0495643_0007384_3253_3738 | 159 |
| 191 | 3300046523 | Ga0495644_0004506 | Ga0495644_0004506_1386_1871 | 159 |
| 192 | 3300046524 | Ga0495648_0075227 | Ga0495648_0075227_1263_1748 | 159 |
| 193 | 3300046528 | Ga0495642_0176008 | Ga0495642_0176008_356_841 | 159 |
| 194 | 3300046528 | Ga0495642_0405452 | Ga0495642_0405452_95_580 | 159 |
| 195 | 3300046529 | Ga0495652_0002709 | Ga0495652_0002709_4349_4828 | 159 |
| 196 | 3300046529 | Ga0495652_0007737 | Ga0495652_0007737_3423_3908 | 159 |
| 197 | 3300046535 | Ga0495586_0145725 | Ga0495586_0145725_826_1311 | 159 |
| 198 | 3300046536 | Ga0495587_0106609 | Ga0495587_0106609_826_1311 | 159 |
| 199 | 3300046536 | Ga0495587_0317959 | Ga0495587_0317959_62_547 | 159 |
| 200 | 3300046538 | Ga0495609_0000403 | Ga0495609_0000403_33379_33864 | 159 |
| 201 | 3300046542 | Ga0495597_0234741 | Ga0495597_0234741_191_676 | 159 |
| 202 | 3300046543 | Ga0495645_0706803 | Ga0495645_0706803_75_560 | 159 |
| 203 | 3300046558 | Ga0495633_0126597 | Ga0495633_0126597_668_1153 | 159 |
| 204 | 3300046558 | Ga0495633_0270008 | Ga0495633_0270008_249_734 | 159 |
| 205 | 3300046615 | Ga0495656_0003519 | Ga0495656_0003519_3501_3986 | 159 |
| 206 | 3300046648 | Ga0495611_0035412 | Ga0495611_0035412_1168_1653 | 159 |
| 207 | 3300046665 | Ga0495661_0001725 | Ga0495661_0001725_8384_8935 | 159 |
| 208 | 3300046674 | Ga0495588_0206978 | Ga0495588_0206978_217_702 | 159 |
| 209 | 3300046679 | Ga0495623_0018754 | Ga0495623_0018754_1517_1996 | 159 |
| 210 | 3300046684 | Ga0495669_0015823 | Ga0495669_0015823_895_1380 | 159 |
| 211 | 3300046694 | Ga0495649_0000697 | Ga0495649_0000697_1350_1835 | 159 |
| 212 | 3300046794 | Ga0495589_0012565 | Ga0495589_0012565_3728_4213 | 159 |
| 213 | 3300046794 | Ga0495589_0089350 | Ga0495589_0089350_183_668 | 159 |
| 214 | 3300046809 | Ga0495600_0157241 | Ga0495600_0157241_338_823 | 159 |
| 215 | 3300047317 | Ga0495604_0018697 | Ga0495604_0018697_3215_3700 | 159 |
| 216 | 3300047318 | Ga0495636_0452804 | Ga0495636_0452804_68_553 | 159 |
| 217 | 3300047320 | Ga0495672_0000101 | Ga0495672_0000101_100235_100720 | 159 |
| 218 | 3300047320 | Ga0495672_0068087 | Ga0495672_0068087_501_986 | 159 |
| 219 | 3300047321 | Ga0495676_0256388 | Ga0495676_0256388_539_1024 | 159 |
| 220 | 3300047322 | Ga0495680_0108841 | Ga0495680_0108841_814_1299 | 159 |
| 221 | 3300047323 | Ga0495683_0005007 | Ga0495683_0005007_2224_2709 | 159 |
| 222 | 3300047445 | Ga0495677_0000863 | Ga0495677_0000863_8290_8841 | 159 |
| 223 | 3300047445 | Ga0495677_0006091 | Ga0495677_0006091_1450_1935 | 159 |
| 224 | 3300047446 | Ga0495679_003393 | Ga0495679_003393_2545_3030 | 159 |
| 225 | 3300047472 | Ga0495686_0000109 | Ga0495686_0000109_111233_111718 | 159 |
| 226 | 3300047472 | Ga0495686_0007449 | Ga0495686_0007449_918_1400 | 159 |
| 227 | 3300047673 | Ga0495593_0296409 | Ga0495593_0296409_144_629 | 159 |
| 228 | 3300048088 | Ga0495602_0006681 | Ga0495602_0006681_3158_3643 | 159 |
| 229 | 3300048088 | Ga0495602_0080600 | Ga0495602_0080600_1312_1791 | 159 |
| 230 | 3300048091 | Ga0495626_0000048 | Ga0495626_0000048_50632_51117 | 159 |
| 231 | 3300048091 | Ga0495626_0016606 | Ga0495626_0016606_1861_2346 | 159 |
| 232 | 3300048091 | Ga0495626_0088004 | Ga0495626_0088004_104_589 | 159 |
| 233 | 3300048907 | Ga0496104_0130891 | Ga0496104_0130891_1110_1592 | 159 |
| 234 | 3300048907 | Ga0496104_0238833 | Ga0496104_0238833_433_915 | 159 |
| 235 | 3300048907 | Ga0496104_0533017 | Ga0496104_0533017_165_647 | 159 |
| 236 | 3300048908 | Ga0496105_0238289 | Ga0496105_0238289_842_1324 | 159 |
| 237 | 3300048910 | Ga0496107_0832490 | Ga0496107_0832490_156_638 | 159 |
| 238 | 3300048912 | Ga0496109_0131836 | Ga0496109_0131836_860_1342 | 159 |
| 239 | 3300048917 | Ga0496114_0104260 | Ga0496114_0104260_702_1184 | 159 |
| 240 | 3300048917 | Ga0496114_0769902 | Ga0496114_0769902_241_723 | 159 |
| 241 | 3300048921 | Ga0496118_0346270 | Ga0496118_0346270_224_703 | 159 |
| 242 | 3300048924 | Ga0496121_0065826 | Ga0496121_0065826_1442_1921 | 159 |
| 243 | 3300048925 | Ga0496122_0008722 | Ga0496122_0008722_6272_6754 | 159 |
| 244 | 3300048926 | Ga0496123_0074535 | Ga0496123_0074535_471_953 | 159 |
| 245 | 3300048928 | Ga0496125_0000650 | Ga0496125_0000650_33847_34329 | 159 |
| 246 | 3300048929 | Ga0496126_0059493 | Ga0496126_0059493_438_920 | 159 |
| 247 | 3300049459 | Ga0495678_009789 | Ga0495678_009789_1035_1520 | 159 |
| 248 | 3300049822 | Ga0501035_0285748 | Ga0501035_0285748_207_692 | 159 |
| 249 | 3300049823 | Ga0501044_0052512 | Ga0501044_0052512_366_851 | 159 |
| 250 | 3300050493 | nmdc:mga0k408_84524_c1 | nmdc:mga0k408_84524_c1_649_1131 | 159 |
| 251 | 3300050494 | nmdc:mga06z11_313331_c1 | nmdc:mga06z11_313331_c1_344_832 | 159 |
| 252 | 3300050496 | nmdc:mga07m45_12616_c1 | nmdc:mga07m45_12616_c1_2550_3068 | 159 |
| 253 | 3300050496 | nmdc:mga07m45_164297_c1 | nmdc:mga07m45_164297_c1_323_916 | 159 |
| 254 | 3300050496 | nmdc:mga07m45_8073_c1 | nmdc:mga07m45_8073_c1_715_1194 | 159 |
| 255 | 3300050507 | nmdc:mga05p37_84299_c2 | nmdc:mga05p37_84299_c2_175_657 | 159 |
| 256 | 3300050508 | nmdc:mga09592_518_c1 | nmdc:mga09592_518_c1_24221_24703 | 159 |
| 257 | 3300050509 | nmdc:mga0qj67_10350_c1 | nmdc:mga0qj67_10350_c1_1327_1809 | 159 |
| 258 | 3300050511 | nmdc:mga08y16_57848_c1 | nmdc:mga08y16_57848_c1_257_736 | 159 |
| 259 | 3300053134 | Ga0500658_0146848 | Ga0500658_0146848_492_1013 | 159 |
| 260 | 3300061719 | Ga0466962_0010973 | Ga0466962_0010973_1612_2091 | 159 |
| 261 | 3300061719 | Ga0466962_0115101 | Ga0466962_0115101_263_757 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ien-assembly1.cif.gz_A | crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 | 0.9375 | 1 | 147 |
| 5szu-assembly1.cif.gz_A | novel structural insights into gdp-mediated regulation of acyl-coa thioesterases | 0.9367 | 2 | 148 |
| 5t02-assembly1.cif.gz_F | structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis | 0.9313 | 3 | 147 |
| 5szy-assembly1.cif.gz_A | novel structural insights into gdp-mediated regulation of acyl-coa thioesterases | 0.9298 | 1 | 149 |
| 5szv-assembly2.cif.gz_D | novel structural insights into gdp-mediated regulation of acyl-coa thioesterases | 0.9269 | 2 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ienA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9375 | 1 | 147 | 3.10.129.10 |
| 1vpmB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9169 | 7 | 148 | 3.10.129.10 |
| 2q2bB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9081 | 7 | 145 | 3.10.129.10 |
| 4mobA02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9014 | 8 | 147 | 3.10.129.10 |
| 3b7kA01 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8982 | 7 | 148 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A433SEB3-F1-model_v4 | Putative acyl-CoA thioester hydrolase (EC 3.1.2.-) | 0.9515 | 3 | 156 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-A0A3C0JB27-F1-model_v4 | Acyl-CoA thioesterase | 0.951 | 2 | 156 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-A0A6P1J9S2-F1-model_v4 | Acyl-CoA thioesterase | 0.9502 | 1 | 157 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-A0A2G6R587-F1-model_v4 | Acyl-CoA thioesterase | 0.9497 | 5 | 150 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-I0HQJ8-F1-model_v4 | Thioesterase superfamily protein (EC 3.1.2.-) | 0.9495 | 3 | 156 |
GO:0005829
GO:0006637 GO:0052816 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar