F369909

General Info

Members Datasets Scaffolds Average Seq Length
260 154 520 142

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0299940|Ga0501044_0299940_662_1096
Length 144
Sequence MAKKIEGYIKLQVKAGQANPSPPIGPALGQRGLNIMEFCKAFNAATQKMEPGMPIPVVITAFSDRSFTFKMKTPPATYFLKKAANITSGSKTPGKPGSIAGSVTLKQCRDIAETKMEDLNATDLDQATKIIAGSARSMGLQVVE

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
41 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
79 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
80 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
100 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
152 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
153 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
154 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.31
Metatranscriptomes 16.15
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0299940 3300049823 Bacteria 1536
2 Ga0058859_10001805 3300004798 Bacteria 3863
3 Ga0058860_11661736 3300004801 Bacteria 1225
4 Ga0070687_100036828 3300005343 Bacteria 2441
5 Ga0070714_100047039 3300005435 Bacteria 3663
6 Ga0070700_100526638 3300005441 Bacteria 914
7 Ga0070694_100002272 3300005444 Bacteria 11361
8 Ga0070685_10272198 3300005466 Bacteria 1130
9 Ga0070707_100256978 3300005468 Bacteria 1700
10 Ga0070707_101859211 3300005468 Bacteria 569
11 Ga0070698_100026208 3300005471 Bacteria 6069
12 Ga0070699_100063102 3300005518 Bacteria 3212
13 Ga0070693_100675042 3300005547 Bacteria 754
14 Ga0070704_100008067 3300005549 Bacteria 6290
15 Ga0068857_100326431 3300005577 Bacteria 1418
16 Ga0068861_100171103 3300005719 Bacteria 1800
17 Ga0068851_10980586 3300005834 Bacteria 532
18 Ga0075432_10006997 3300006058 Bacteria 3843
19 Ga0070716_100330861 3300006173 Bacteria 1071
20 Ga0075428_100438216 3300006844 Bacteria 1400
21 Ga0075430_100005862 3300006846 Bacteria 10370
22 Ga0075431_100465523 3300006847 Bacteria 1258
23 Ga0075433_10166084 3300006852 Bacteria 1964
24 Ga0075433_10767898 3300006852 Bacteria 843
25 Ga0075434_100007190 3300006871 Bacteria 10295
26 Ga0105244_10155003 3300009036 Bacteria 1096
27 Ga0111539_10532946 3300009094 Bacteria 1368
28 Ga0105245_12723972 3300009098 Bacteria 547
29 Ga0105247_10784881 3300009101 Unclassified 725
30 Ga0105243_10109132 3300009148 Bacteria 2311
31 Ga0105238_10000058 3300009551 Bacteria 130734
32 Ga0105238_10000130 3300009551 Bacteria 82894
33 Ga0105249_10017354 3300009553 Bacteria 6391
34 Ga0105246_12352574 3300011119 Bacteria 522
35 Ga0157369_12098066 3300013105 Bacteria 573
36 Ga0157374_12223908 3300013296 Bacteria 575
37 Ga0157375_11537270 3300013308 Bacteria 786
38 Ga0157375_12727082 3300013308 Bacteria 591
39 Ga0182008_10759861 3300014497 Bacteria 559
40 Ga0157377_10020106 3300014745 Bacteria 3493
41 Ga0157376_10815752 3300014969 Bacteria 946
42 Ga0197907_10238229 3300020069 Bacteria 2432
43 Ga0197907_11146780 3300020069 Bacteria 600
44 Ga0206356_11638095 3300020070 Bacteria 933
45 Ga0206355_1254761 3300020076 Bacteria 699
46 Ga0206351_10545646 3300020077 Bacteria 5226
47 Ga0206351_10818235 3300020077 Bacteria 855
48 Ga0206352_10172446 3300020078 Bacteria 820
49 Ga0206352_10482108 3300020078 Bacteria 932
50 Ga0206350_11192080 3300020080 Bacteria 591
51 Ga0206353_10151330 3300020082 Bacteria 616
52 Ga0213872_10014466 3300021361 Bacteria 3681
53 Ga0224712_10000417 3300022467 Bacteria 8406
54 Ga0207647_10021595 3300025904 Bacteria 4296
55 Ga0207662_10004293 3300025918 Bacteria 7478
56 Ga0207646_10894982 3300025922 Bacteria 788
57 Ga0207694_10000007 3300025924 Bacteria 595422
58 Ga0207694_10000799 3300025924 Bacteria 28255
59 Ga0207659_10364042 3300025926 Bacteria 1202
60 Ga0207664_10081713 3300025929 Bacteria 2630
61 Ga0207644_11167283 3300025931 Bacteria 647
62 Ga0207709_10015359 3300025935 Bacteria 4245
63 Ga0207665_10496078 3300025939 Bacteria 943
64 Ga0207691_10382655 3300025940 Bacteria 1201
65 Ga0207712_10118851 3300025961 Bacteria 1996
66 Ga0207674_10123527 3300026116 Bacteria 2555
67 Ga0207675_100005308 3300026118 Bacteria 12384
68 Ga0207428_10000755 3300027907 Bacteria 36919
69 Ga0268265_12229626 3300028380 Bacteria 555
70 Ga0268264_11490709 3300028381 Bacteria 687
71 Ga0265338_10093522 3300028800 Bacteria 2477
72 Ga0265338_10929763 3300028800 Unclassified 591
73 Ga0265327_10021045 3300031251 Bacteria 3950
74 Ga0265316_10070150 3300031344 Bacteria 2703
75 Ga0307408_100083093 3300031548 Bacteria 2399
76 Ga0316579_10019813 3300031691 Bacteria 2977
77 Ga0316579_10312833 3300031691 Unclassified 759
78 Ga0316579_10375468 3300031691 Bacteria 687
79 Ga0316576_10010423 3300031727 Bacteria 6037
80 Ga0316576_10013514 3300031727 Bacteria 5430
81 Ga0316576_10105538 3300031727 Bacteria 2109
82 Ga0316576_10126009 3300031727 Bacteria 1924
83 Ga0316576_10666094 3300031727 Bacteria 756
84 Ga0316578_10027559 3300031728 Bacteria 3212
85 Ga0316578_10075409 3300031728 Bacteria 2001
86 Ga0316578_10097965 3300031728 Bacteria 1757
87 Ga0316578_10311064 3300031728 Bacteria 941
88 Ga0307405_10610976 3300031731 Bacteria 891
89 Ga0316577_10005372 3300031733 Bacteria 6715
90 Ga0316577_10057962 3300031733 Bacteria 2162
91 Ga0316577_10166791 3300031733 Bacteria 1242
92 Ga0316577_10361056 3300031733 Bacteria 825
93 Ga0316577_10514469 3300031733 Unclassified 680
94 Ga0307410_10075145 3300031852 Bacteria 2355
95 Ga0307407_10086767 3300031903 Bacteria 1907
96 Ga0307409_100329760 3300031995 Bacteria 1432
97 Ga0307414_10978982 3300032004 Bacteria 778
98 Ga0307411_10096161 3300032005 Bacteria 2081
99 Ga0307415_100122244 3300032126 Bacteria 1954
100 Ga0307415_100281026 3300032126 Bacteria 1369
101 Ga0307415_100412563 3300032126 Bacteria 1156
102 Ga0316585_10294601 3300032137 Bacteria 539
103 Ga0316580_10020660 3300032139 Bacteria 2029
104 Ga0316580_10250550 3300032139 Bacteria 547
105 Ga0316593_10001156 3300032168 Bacteria 5608
106 Ga0316593_10002067 3300032168 Bacteria 4650
107 Ga0316593_10032856 3300032168 Bacteria 1697
108 Ga0316593_10033034 3300032168 Bacteria 1692
109 Ga0316593_10222034 3300032168 Unclassified 702
110 Ga0316592_1013422 3300033524 Bacteria 1688
111 Ga0316592_1015135 3300033524 Bacteria 1604
112 Ga0316588_1020800 3300033528 Bacteria 1489
113 Ga0316588_1036581 3300033528 Bacteria 1166
114 Ga0316588_1137713 3300033528 Bacteria 623
115 Ga0316587_1082200 3300033529 Bacteria 610
116 Ga0316596_1002971 3300033541 Bacteria 3681
117 Ga0316596_1014057 3300033541 Bacteria 1981
118 Ga0316596_1016242 3300033541 Bacteria 1863
119 Ga0316596_1073252 3300033541 Bacteria 918
120 Ga0316596_1092859 3300033541 Bacteria 814
121 Ga0316574_0011777 3300035398 Bacteria 4981
122 Ga0316574_0041874 3300035398 Bacteria 2824
123 Ga0316574_0176613 3300035398 Bacteria 1374
124 Ga0316574_0209957 3300035398 Bacteria 1249
125 Ga0316574_0589502 3300035398 Bacteria 688
126 Ga0373937_1084289 3300036401 Bacteria 750
127 Ga0316582_0014111 3300036647 Bacteria 4523
128 Ga0316582_0031327 3300036647 Bacteria 3249
129 Ga0316582_0036821 3300036647 Bacteria 3030
130 Ga0316582_0083966 3300036647 Bacteria 2085
131 Ga0316582_0090292 3300036647 Bacteria 2016
132 Ga0316582_0117988 3300036647 Bacteria 1773
133 Ga0316582_0189256 3300036647 Unclassified 1402
134 Ga0316582_0569560 3300036647 Bacteria 780
135 Ga0316582_0694201 3300036647 Bacteria 699
136 Ga0316582_0764979 3300036647 Bacteria 662
137 Ga0316582_0980138 3300036647 Unclassified 577
138 Ga0316582_0983826 3300036647 Bacteria 576
139 Ga0316584_0017588 3300036712 Bacteria 5145
140 Ga0316584_0033377 3300036712 Bacteria 3812
141 Ga0316584_0105484 3300036712 Bacteria 2109
142 Ga0316584_0313323 3300036712 Bacteria 1134
143 Ga0316584_0560931 3300036712 Bacteria 796
144 Ga0316584_0922144 3300036712 Bacteria 587
145 Ga0395900_0148375 3300037418 Bacteria 2397
146 Ga0395900_1355578 3300037418 Bacteria 625
147 Ga0395898_0522851 3300037466 Bacteria 1128
148 Ga0316581_0039195 3300037588 Bacteria 1442
149 Ga0316581_0054855 3300037588 Bacteria 1222
150 Ga0436364_0040531 3300037853 Bacteria 974
151 Ga0436364_0234498 3300037853 Bacteria 658
152 Ga0436364_0552661 3300037853 Bacteria 595
153 Ga0436364_0559184 3300037853 Bacteria 655
154 Ga0395901_0282530 3300038443 Bacteria 1724
155 Ga0436365_0053534 3300039437 Bacteria 1132
156 Ga0436365_1180952 3300039437 Bacteria 649
157 Ga0436360_0253966 3300039438 Bacteria 630
158 Ga0436360_0629914 3300039438 Bacteria 599
159 Ga0436360_0666240 3300039438 Bacteria 564
160 Ga0436360_0832493 3300039438 Bacteria 545
161 Ga0436360_1130923 3300039438 Bacteria 524
162 Ga0436360_1227641 3300039438 Bacteria 644
163 Ga0436361_0150908 3300039447 Bacteria 1255
164 Ga0436361_0195222 3300039447 Bacteria 9839
165 Ga0436361_0462799 3300039447 Bacteria 725
166 Ga0436361_0500836 3300039447 Bacteria 1497
167 Ga0436363_0227492 3300039450 Bacteria 571
168 Ga0436363_0739975 3300039450 Bacteria 749
169 Ga0436363_0860487 3300039450 Bacteria 536
170 Ga0436363_0912971 3300039450 Bacteria 598
171 Ga0436363_1658260 3300039450 Bacteria 580
172 Ga0436362_0523085 3300039453 Bacteria 9299
173 Ga0436362_0823898 3300039453 Bacteria 571
174 Ga0451843_0894202 3300041509 Bacteria 904
175 Ga0439455_0080016 3300042012 Bacteria 887
176 Ga0439434_0150278 3300042435 Bacteria 771
177 Ga0451577_0000006 3300042876 Bacteria 709265
178 Ga0451577_0065473 3300042876 Bacteria 3241
179 Ga0451577_0099821 3300042876 Bacteria 2593
180 Ga0451577_0475696 3300042876 Bacteria 1134
181 Ga0451577_1197039 3300042876 Bacteria 678
182 Ga0466972_0108186 3300044658 Bacteria 1314
183 Ga0453683_0000086 3300044673 Bacteria 139689
184 Ga0453683_0000088 3300044673 Bacteria 138620
185 Ga0453683_0055576 3300044673 Bacteria 2478
186 Ga0453683_0143391 3300044673 Bacteria 1508
187 Ga0453683_0325849 3300044673 Bacteria 985
188 Ga0453683_0787130 3300044673 Bacteria 626
189 Ga0453684_0000037 3300044712 Bacteria 709327
190 Ga0453684_0003980 3300044712 Bacteria 32269
191 Ga0453684_0006653 3300044712 Bacteria 21828
192 Ga0453684_0141118 3300044712 Bacteria 2877
193 Ga0453684_0142608 3300044712 Bacteria 2858
194 Ga0453684_0508716 3300044712 Bacteria 1332
195 Ga0453684_0544218 3300044712 Unclassified 1280
196 Ga0453684_0798964 3300044712 Bacteria 1017
197 Ga0453684_0933354 3300044712 Bacteria 927
198 Ga0466957_0575713 3300044842 Bacteria 787
199 Ga0451576_0064678 3300045051 Bacteria 3809
200 Ga0451576_0132882 3300045051 Bacteria 2594
201 Ga0451576_1354062 3300045051 Bacteria 741
202 Ga0451576_1357767 3300045051 Bacteria 740
203 Ga0495630_0081609 3300046517 Bacteria 2440
204 Ga0495613_0138670 3300046689 Bacteria 1739
205 Ga0495636_0057934 3300047318 Bacteria 1633
206 Ga0496102_0086130 3300048905 Bacteria 2901
207 Ga0496103_1012378 3300048906 Bacteria 517
208 Ga0496106_0534982 3300048909 Bacteria 941
209 Ga0496114_0354619 3300048917 Bacteria 1298
210 Ga0496114_0835167 3300048917 Bacteria 801
211 Ga0501316_043755 3300049532 Bacteria 630
212 Ga0501323_059302 3300049539 Bacteria 595
213 Ga0501031_0348242 3300049568 Bacteria 959
214 Ga0501034_0488943 3300049571 Bacteria 1145
215 Ga0501034_1128247 3300049571 Bacteria 664
216 Ga0501036_0049905 3300049572 Bacteria 3545
217 Ga0501037_0715070 3300049573 Bacteria 666
218 Ga0501038_0157353 3300049574 Bacteria 1849
219 Ga0501043_0113541 3300049579 Bacteria 2127
220 Ga0501046_0001481 3300049580 Bacteria 22486
221 Ga0501046_0144264 3300049580 Bacteria 1799
222 Ga0501047_1005151 3300049581 Bacteria 647
223 Ga0501070_0826388 3300049586 Bacteria 726
224 Ga0501071_1249664 3300049587 Bacteria 574
225 Ga0501072_1070041 3300049588 Bacteria 628
226 Ga0501075_0138668 3300049591 Bacteria 1853
227 Ga0501076_0360815 3300049592 Bacteria 1194
228 Ga0501249_079170 3300049679 Bacteria 772
229 Ga0501035_0057170 3300049822 Bacteria 3478
230 Ga0501035_0286567 3300049822 Bacteria 1391
231 Ga0501035_0446625 3300049822 Bacteria 1070
232 Ga0501044_0073452 3300049823 Bacteria 3476
233 Ga0501044_0128463 3300049823 Bacteria 2530
234 Ga0501044_0774943 3300049823 Bacteria 840
235 nmdc:mga05p37_11186_c1 3300050507 Bacteria 10667
236 nmdc:mga0qj67_7799_c1 3300050509 Bacteria 7913
237 nmdc:mga06r32_30997_c1 3300050510 Bacteria 5020
238 nmdc:mga08y16_45863_c1 3300050511 Bacteria 4579
239 nmdc:mga0n895_204352_c1 3300050512 Bacteria 2006
240 nmdc:mga0n895_6845_c1 3300050512 Bacteria 9736
241 nmdc:mga0a205_17465_c1 3300050515 Bacteria 6728
242 Ga0501084_0030431 3300054114 Bacteria 4514
243 Ga0501084_1871670 3300054114 Bacteria 501
244 Ga0587066_118330 3300059490 Bacteria 623
245 Ga0587070_138044 3300059491 Bacteria 600
246 Ga0587073_0164531 3300059492 Bacteria 639
247 Ga0587080_031000 3300059503 Bacteria 931
248 Ga0587083_0210241 3300059505 Bacteria 560
249 Ga0587086_096286 3300059507 Bacteria 540
250 Ga0587094_063008 3300059513 Bacteria 653
251 Ga0587075_123056 3300059644 Bacteria 539
252 Ga0587079_077971 3300059647 Bacteria 752
253 Ga0587079_104966 3300059647 Bacteria 679
254 Ga0587119_063119 3300059658 Bacteria 575
255 Ga0501082_0029571 3300060353 Bacteria 4720
256 Ga0530510_1146819 3300061734 Bacteria 596
257 2688066214 2687453257 Bacteria 6784659
258 2729906692 2728369276 Bacteria 5610032
259 2889421727 2889415604 Bacteria 8048700
260 2920111246 2920107658 Bacteria 10042636
261 Ga0501044_0299940
262 Ga0058859_10001805
263 Ga0058860_11661736
264 Ga0070687_100036828
265 Ga0070714_100047039
266 Ga0070700_100526638
267 Ga0070694_100002272
268 Ga0070685_10272198
269 Ga0070707_100256978
270 Ga0070707_101859211
271 Ga0070698_100026208
272 Ga0070699_100063102
273 Ga0070693_100675042
274 Ga0070704_100008067
275 Ga0068857_100326431
276 Ga0068861_100171103
277 Ga0068851_10980586
278 Ga0075432_10006997
279 Ga0070716_100330861
280 Ga0075428_100438216
281 Ga0075430_100005862
282 Ga0075431_100465523
283 Ga0075433_10166084
284 Ga0075433_10767898
285 Ga0075434_100007190
286 Ga0105244_10155003
287 Ga0111539_10532946
288 Ga0105245_12723972
289 Ga0105247_10784881
290 Ga0105243_10109132
291 Ga0105238_10000058
292 Ga0105238_10000130
293 Ga0105249_10017354
294 Ga0105246_12352574
295 Ga0157369_12098066
296 Ga0157374_12223908
297 Ga0157375_11537270
298 Ga0157375_12727082
299 Ga0182008_10759861
300 Ga0157377_10020106
301 Ga0157376_10815752
302 Ga0197907_10238229
303 Ga0197907_11146780
304 Ga0206356_11638095
305 Ga0206355_1254761
306 Ga0206351_10545646
307 Ga0206351_10818235
308 Ga0206352_10172446
309 Ga0206352_10482108
310 Ga0206350_11192080
311 Ga0206353_10151330
312 Ga0213872_10014466
313 Ga0224712_10000417
314 Ga0207647_10021595
315 Ga0207662_10004293
316 Ga0207646_10894982
317 Ga0207694_10000007
318 Ga0207694_10000799
319 Ga0207659_10364042
320 Ga0207664_10081713
321 Ga0207644_11167283
322 Ga0207709_10015359
323 Ga0207665_10496078
324 Ga0207691_10382655
325 Ga0207712_10118851
326 Ga0207674_10123527
327 Ga0207675_100005308
328 Ga0207428_10000755
329 Ga0268265_12229626
330 Ga0268264_11490709
331 Ga0265338_10093522
332 Ga0265338_10929763
333 Ga0265327_10021045
334 Ga0265316_10070150
335 Ga0307408_100083093
336 Ga0316579_10019813
337 Ga0316579_10312833
338 Ga0316579_10375468
339 Ga0316576_10010423
340 Ga0316576_10013514
341 Ga0316576_10105538
342 Ga0316576_10126009
343 Ga0316576_10666094
344 Ga0316578_10027559
345 Ga0316578_10075409
346 Ga0316578_10097965
347 Ga0316578_10311064
348 Ga0307405_10610976
349 Ga0316577_10005372
350 Ga0316577_10057962
351 Ga0316577_10166791
352 Ga0316577_10361056
353 Ga0316577_10514469
354 Ga0307410_10075145
355 Ga0307407_10086767
356 Ga0307409_100329760
357 Ga0307414_10978982
358 Ga0307411_10096161
359 Ga0307415_100122244
360 Ga0307415_100281026
361 Ga0307415_100412563
362 Ga0316585_10294601
363 Ga0316580_10020660
364 Ga0316580_10250550
365 Ga0316593_10001156
366 Ga0316593_10002067
367 Ga0316593_10032856
368 Ga0316593_10033034
369 Ga0316593_10222034
370 Ga0316592_1013422
371 Ga0316592_1015135
372 Ga0316588_1020800
373 Ga0316588_1036581
374 Ga0316588_1137713
375 Ga0316587_1082200
376 Ga0316596_1002971
377 Ga0316596_1014057
378 Ga0316596_1016242
379 Ga0316596_1073252
380 Ga0316596_1092859
381 Ga0316574_0011777
382 Ga0316574_0041874
383 Ga0316574_0176613
384 Ga0316574_0209957
385 Ga0316574_0589502
386 Ga0373937_1084289
387 Ga0316582_0014111
388 Ga0316582_0031327
389 Ga0316582_0036821
390 Ga0316582_0083966
391 Ga0316582_0090292
392 Ga0316582_0117988
393 Ga0316582_0189256
394 Ga0316582_0569560
395 Ga0316582_0694201
396 Ga0316582_0764979
397 Ga0316582_0980138
398 Ga0316582_0983826
399 Ga0316584_0017588
400 Ga0316584_0033377
401 Ga0316584_0105484
402 Ga0316584_0313323
403 Ga0316584_0560931
404 Ga0316584_0922144
405 Ga0395900_0148375
406 Ga0395900_1355578
407 Ga0395898_0522851
408 Ga0316581_0039195
409 Ga0316581_0054855
410 Ga0436364_0040531
411 Ga0436364_0234498
412 Ga0436364_0552661
413 Ga0436364_0559184
414 Ga0395901_0282530
415 Ga0436365_0053534
416 Ga0436365_1180952
417 Ga0436360_0253966
418 Ga0436360_0629914
419 Ga0436360_0666240
420 Ga0436360_0832493
421 Ga0436360_1130923
422 Ga0436360_1227641
423 Ga0436361_0150908
424 Ga0436361_0195222
425 Ga0436361_0462799
426 Ga0436361_0500836
427 Ga0436363_0227492
428 Ga0436363_0739975
429 Ga0436363_0860487
430 Ga0436363_0912971
431 Ga0436363_1658260
432 Ga0436362_0523085
433 Ga0436362_0823898
434 Ga0451843_0894202
435 Ga0439455_0080016
436 Ga0439434_0150278
437 Ga0451577_0000006
438 Ga0451577_0065473
439 Ga0451577_0099821
440 Ga0451577_0475696
441 Ga0451577_1197039
442 Ga0466972_0108186
443 Ga0453683_0000086
444 Ga0453683_0000088
445 Ga0453683_0055576
446 Ga0453683_0143391
447 Ga0453683_0325849
448 Ga0453683_0787130
449 Ga0453684_0000037
450 Ga0453684_0003980
451 Ga0453684_0006653
452 Ga0453684_0141118
453 Ga0453684_0142608
454 Ga0453684_0508716
455 Ga0453684_0544218
456 Ga0453684_0798964
457 Ga0453684_0933354
458 Ga0466957_0575713
459 Ga0451576_0064678
460 Ga0451576_0132882
461 Ga0451576_1354062
462 Ga0451576_1357767
463 Ga0495630_0081609
464 Ga0495613_0138670
465 Ga0495636_0057934
466 Ga0496102_0086130
467 Ga0496103_1012378
468 Ga0496106_0534982
469 Ga0496114_0354619
470 Ga0496114_0835167
471 Ga0501316_043755
472 Ga0501323_059302
473 Ga0501031_0348242
474 Ga0501034_0488943
475 Ga0501034_1128247
476 Ga0501036_0049905
477 Ga0501037_0715070
478 Ga0501038_0157353
479 Ga0501043_0113541
480 Ga0501046_0001481
481 Ga0501046_0144264
482 Ga0501047_1005151
483 Ga0501070_0826388
484 Ga0501071_1249664
485 Ga0501072_1070041
486 Ga0501075_0138668
487 Ga0501076_0360815
488 Ga0501249_079170
489 Ga0501035_0057170
490 Ga0501035_0286567
491 Ga0501035_0446625
492 Ga0501044_0073452
493 Ga0501044_0128463
494 Ga0501044_0774943
495 nmdc:mga05p37_11186_c1
496 nmdc:mga0qj67_7799_c1
497 nmdc:mga06r32_30997_c1
498 nmdc:mga08y16_45863_c1
499 nmdc:mga0n895_204352_c1
500 nmdc:mga0n895_6845_c1
501 nmdc:mga0a205_17465_c1
502 Ga0501084_0030431
503 Ga0501084_1871670
504 Ga0587066_118330
505 Ga0587070_138044
506 Ga0587073_0164531
507 Ga0587080_031000
508 Ga0587083_0210241
509 Ga0587086_096286
510 Ga0587094_063008
511 Ga0587075_123056
512 Ga0587079_077971
513 Ga0587079_104966
514 Ga0587119_063119
515 Ga0501082_0029571
516 Ga0530510_1146819
517 2688066214
518 2729906692
519 2889421727
520 2920111246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

9

67

0.99

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

72

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9906 71 141
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9877 71 140
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9865 71 140
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9764 3 72
5gae-assembly1.cif.gz_J rnc in complex with a translocating secyeg 0.9748 71 140
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9943 72 139 1.10.10.250
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9837 3 67 3.30.1550.10
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9713 73 140 1.10.10.250
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9634 67 140 1.10.10.250
2qa4I02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9614 72 133 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A496M9P7-F1-model_v4 deleted 1.002 71 141
AF-A0A2S7TEL3-F1-model_v4 deleted 1.001 73 141
AF-A0A7C3NAE7-F1-model_v4 50S ribosomal protein L11 1.001 76 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7J4E0X6-F1-model_v4 deleted 1 1 69
AF-D6SXA2-F1-model_v4 deleted 0.9985 79 141

Map