F369897

General Info

Members Datasets Scaffolds Average Seq Length
260 188 217 225

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0685780|Ga0501070_0685780_12_701
Length 229
Sequence LLVEDDVDLAMSLQAVMKHEGFTVDVAFDGGTGTVRALSGDYSLIVLDILLPVRNGFQVCADVRRRDAAVPIQMLTAKDGEWDEAESLDTGADDYLTKPVSSIVLVAHMRALLRRSQLFPRRRFTWGGLTLDPLKRLCAGPRGEVHLSGRETEVLARLMLAEGEVVSKADLVRDVWGPDFSGDRNIAEVYIRHLRAKIDPCFEHPVITTVHGLGYQLALRDQLALREQR

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221561 Nocardioides sp. Root151 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221576 Nocardioides sp. Root614 Isolate Unclassified
7 2643221590 Nocardioides sp. Root682 Isolate Unclassified
8 2643221604 Nocardioides sp. Root190 Isolate Unclassified
9 2643221617 Nocardioides sp. Root79 Isolate Unclassified
10 2643221620 Nocardioides sp. Root240 Isolate Unclassified
11 2643221630 Microbacterium sp. Root322 Isolate Unclassified
12 2643221696 Nocardioides sp. Root140 Isolate Unclassified
13 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
14 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
15 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
16 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
17 2738541305 Nocardioides sp. CF167 Isolate Unclassified
18 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
19 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
20 2773857759 Microbacterium sp. 1294 Isolate Unclassified
21 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
22 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
23 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
24 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
25 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
26 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
27 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
28 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
29 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
30 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
31 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
32 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
33 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
34 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
35 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
36 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
37 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
38 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
39 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
40 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
41 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
42 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
43 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
44 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
45 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
182 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
185 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.46
Metatranscriptomes 0
Isolates 16.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.77
Bulb 0
Endosphere 7.31
Nodule 0
Rhizoplane 1.54
Rhizosphere 68.85
Stem 0
Stem Tuber 0
Unclassified 21.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005417 3300000549 Bacteria 1621
2 JGI25154J39366_1003453 3300002738 Bacteria 3309
3 JGI25407J50210_10000514 3300003373 Bacteria 7787
4 Ga0065712_10264436 3300005290 Bacteria 929
5 Ga0065707_10100788 3300005295 Bacteria 2874
6 Ga0070689_100018676 3300005340 Bacteria 5113
7 Ga0070661_100374514 3300005344 Bacteria 1121
8 Ga0070669_100233717 3300005353 Bacteria 1458
9 Ga0070675_100109524 3300005354 Bacteria 2334
10 Ga0070671_100083206 3300005355 Bacteria 2676
11 Ga0070708_100445396 3300005445 Bacteria 1222
12 Ga0070706_100477280 3300005467 Bacteria 1160
13 Ga0070707_100339385 3300005468 Bacteria 1460
14 Ga0068853_100006179 3300005539 Bacteria 9483
15 Ga0068854_100828402 3300005578 Unclassified 808
16 Ga0068859_100136221 3300005617 Bacteria 2528
17 Ga0068864_100844279 3300005618 Bacteria 902
18 Ga0068862_100317028 3300005844 Bacteria 1438
19 Ga0081455_10001246 3300005937 Bacteria 31840
20 Ga0081455_10003571 3300005937 Bacteria 17853
21 Ga0081455_10010819 3300005937 Bacteria 9218
22 Ga0081538_10009216 3300005981 Bacteria 8269
23 Ga0081538_10020236 3300005981 Bacteria 4911
24 Ga0081538_10029332 3300005981 Bacteria 3761
25 Ga0081539_10003198 3300005985 Bacteria 20708
26 Ga0081539_10078870 3300005985 Bacteria 1737
27 Ga0075365_10004487 3300006038 Bacteria 7403
28 Ga0075365_10148114 3300006038 Bacteria 1632
29 Ga0075363_100037760 3300006048 Bacteria 2538
30 Ga0075364_10356192 3300006051 Bacteria 998
31 Ga0075370_10055659 3300006353 Bacteria 2247
32 Ga0075428_100071748 3300006844 Bacteria 3785
33 Ga0075428_100074856 3300006844 Bacteria 3698
34 Ga0075428_100241510 3300006844 Bacteria 1948
35 Ga0075430_100002023 3300006846 Bacteria 16724
36 Ga0075431_100151324 3300006847 Bacteria 2389
37 Ga0075429_100071577 3300006880 Bacteria 3019
38 Ga0075429_100083043 3300006880 Bacteria 2793
39 Ga0097620_100136223 3300006931 Bacteria 2528
40 Ga0111539_10473160 3300009094 Bacteria 1459
41 Ga0114129_10028935 3300009147 Bacteria 7850
42 Ga0114129_10173074 3300009147 Bacteria 2942
43 Ga0114129_11472352 3300009147 Bacteria 838
44 Ga0105243_10689475 3300009148 Unclassified 994
45 Ga0157370_10088443 3300013104 Bacteria 2909
46 Ga0157369_10135501 3300013105 Bacteria 2607
47 Ga0157372_10551445 3300013307 Bacteria 1344
48 Ga0163163_10042622 3300014325 Bacteria 4446
49 Ga0163163_10418186 3300014325 Bacteria 1399
50 Ga0157380_10055518 3300014326 Bacteria 3146
51 Ga0157380_10663095 3300014326 Bacteria 1043
52 Ga0157376_10019750 3300014969 Bacteria 5200
53 Ga0157376_10836154 3300014969 Bacteria 935
54 Ga0209646_1000030 3300025246 Bacteria 384216
55 Ga0207688_10275364 3300025901 Bacteria 1024
56 Ga0207650_10111161 3300025925 Bacteria 2121
57 Ga0207659_10109986 3300025926 Bacteria 2093
58 Ga0207644_10083008 3300025931 Bacteria 2372
59 Ga0207691_10634860 3300025940 Bacteria 903
60 Ga0207658_10862350 3300025986 Bacteria 824
61 Ga0207639_10214670 3300026041 Bacteria 1658
62 Ga0207676_10592920 3300026095 Bacteria 1063
63 Ga0210000_1021397 3300027462 Bacteria 989
64 Ga0268265_10272308 3300028380 Bacteria 1511
65 Ga0268265_10465088 3300028380 Bacteria 1184
66 Ga0307515_10009497 3300028794 Bacteria 18796
67 Ga0307515_10018349 3300028794 Bacteria 12675
68 Ga0307512_10004935 3300030522 Bacteria 14234
69 Ga0307512_10006661 3300030522 Bacteria 11639
70 Ga0307513_10021162 3300031456 Bacteria 7684
71 Ga0307408_100068603 3300031548 Bacteria 2612
72 Ga0307408_100679756 3300031548 Bacteria 923
73 Ga0307508_10003215 3300031616 Bacteria 16702
74 Ga0307405_10006104 3300031731 Bacteria 5895
75 Ga0307405_10059336 3300031731 Bacteria 2411
76 Ga0307405_10369374 3300031731 Bacteria 1113
77 Ga0307413_10036845 3300031824 Bacteria 2820
78 Ga0307413_10252452 3300031824 Bacteria 1309
79 Ga0307406_10000142 3300031901 Bacteria 42391
80 Ga0307406_10007267 3300031901 Bacteria 6135
81 Ga0307406_10074435 3300031901 Bacteria 2236
82 Ga0307406_10141482 3300031901 Bacteria 1703
83 Ga0307406_10327197 3300031901 Bacteria 1188
84 Ga0307407_10016265 3300031903 Bacteria 3700
85 Ga0307407_10137527 3300031903 Bacteria 1572
86 Ga0307407_10471975 3300031903 Bacteria 915
87 Ga0307412_10008857 3300031911 Bacteria 5763
88 Ga0307409_100025248 3300031995 Bacteria 4163
89 Ga0307409_100070166 3300031995 Bacteria 2780
90 Ga0307409_100220185 3300031995 Bacteria 1713
91 Ga0307416_100001327 3300032002 Bacteria 13336
92 Ga0307416_100072091 3300032002 Bacteria 2873
93 Ga0307416_100121905 3300032002 Bacteria 2326
94 Ga0307416_100380063 3300032002 Bacteria 1442
95 Ga0307411_10413726 3300032005 Bacteria 1118
96 Ga0307415_100000332 3300032126 Bacteria 20394
97 Ga0307415_100018877 3300032126 Bacteria 4175
98 Ga0307415_100198024 3300032126 Bacteria 1591
99 Ga0373951_0000055 3300035091 Bacteria 45686
100 Ga0373942_0000524 3300035207 Bacteria 10740
101 Ga0373962_0039636 3300035242 Bacteria 1322
102 Ga0395899_0010778 3300037312 Bacteria 7006
103 Ga0395900_0150897 3300037418 Bacteria 2374
104 Ga0395900_0170632 3300037418 Bacteria 2215
105 Ga0395900_0487619 3300037418 Bacteria 1184
106 Ga0395900_0553726 3300037418 Bacteria 1094
107 Ga0395898_0014812 3300037466 Bacteria 8004
108 Ga0395898_0019689 3300037466 Bacteria 6864
109 Ga0395898_0294102 3300037466 Bacteria 1549
110 Ga0395898_0775850 3300037466 Bacteria 899
111 Ga0395905_0325435 3300037471 Bacteria 1427
112 Ga0395905_0567217 3300037471 Bacteria 1036
113 Ga0395901_0027656 3300038443 Bacteria 5829
114 Ga0395901_0058043 3300038443 Bacteria 4025
115 Ga0395901_0085652 3300038443 Bacteria 3294
116 Ga0395901_0505366 3300038443 Bacteria 1230
117 Ga0436365_1393150 3300039437 Bacteria 839
118 Ga0451789_0217693 3300041443 Bacteria 1234
119 Ga0451789_0368459 3300041443 Bacteria 1358
120 Ga0451793_1699148 3300041452 Bacteria 1422
121 Ga0451843_0771198 3300041509 Bacteria 776
122 Ga0439452_013824 3300042010 Bacteria 2258
123 Ga0439463_001082 3300042016 Bacteria 7352
124 Ga0450915_007481 3300042119 Bacteria 715
125 Ga0439464_0002672 3300042439 Bacteria 4418
126 Ga0439460_0003483 3300042461 Bacteria 3805
127 Ga0439440_0005990 3300042993 Bacteria 2432
128 Ga0466969_0025931 3300044656 Bacteria 3010
129 Ga0466965_0084531 3300044683 Bacteria 1608
130 Ga0466966_0005025 3300044684 Bacteria 8698
131 Ga0466961_0003026 3300044693 Bacteria 10432
132 Ga0466961_0236588 3300044693 Bacteria 1123
133 Ga0466963_0011106 3300044694 Bacteria 5476
134 Ga0466971_0018543 3300044719 Bacteria 3082
135 Ga0466970_0045013 3300044765 Bacteria 2350
136 Ga0466959_0011167 3300045049 Bacteria 6445
137 Ga0466958_0053471 3300045836 Bacteria 2448
138 Ga0466967_0042434 3300045976 Bacteria 3931
139 Ga0495603_0011374 3300046455 Bacteria 5389
140 Ga0495629_0017117 3300046459 Bacteria 5199
141 Ga0495629_0327356 3300046459 Bacteria 1047
142 Ga0495639_0030228 3300046475 Bacteria 2407
143 Ga0495662_0054929 3300046476 Bacteria 1924
144 Ga0495584_0172009 3300046491 Bacteria 1101
145 Ga0495594_0153516 3300046499 Bacteria 1307
146 Ga0495632_0082395 3300046519 Bacteria 1533
147 Ga0495645_0094757 3300046543 Bacteria 2129
148 Ga0495588_0001596 3300046674 Bacteria 9686
149 Ga0495588_0046736 3300046674 Bacteria 2221
150 Ga0496111_0147468 3300048914 Bacteria 1745
151 Ga0496117_0000731 3300048920 Bacteria 51549
152 Ga0496118_0051510 3300048921 Bacteria 3149
153 Ga0496119_0139562 3300048922 Bacteria 1310
154 Ga0496119_0267386 3300048922 Bacteria 855
155 Ga0496121_0204415 3300048924 Bacteria 1405
156 Ga0496122_0008168 3300048925 Bacteria 11383
157 Ga0496122_0065851 3300048925 Bacteria 2623
158 Ga0496122_0115019 3300048925 Bacteria 1754
159 Ga0496122_0131334 3300048925 Bacteria 1590
160 Ga0496124_0003218 3300048927 Bacteria 20170
161 Ga0496124_0084497 3300048927 Bacteria 2602
162 Ga0496125_0003081 3300048928 Bacteria 20817
163 Ga0496125_0027309 3300048928 Bacteria 5177
164 Ga0496125_0045757 3300048928 Bacteria 3678
165 Ga0496125_0145735 3300048928 Bacteria 1637
166 Ga0496125_0342205 3300048928 Bacteria 897
167 Ga0496126_0020157 3300048929 Bacteria 6544
168 Ga0496126_0075976 3300048929 Bacteria 2981
169 Ga0496126_0182709 3300048929 Bacteria 1781
170 Ga0501299_014454 3300049522 Bacteria 1374
171 Ga0501031_0180586 3300049568 Bacteria 1379
172 Ga0501034_0003444 3300049571 Bacteria 18046
173 Ga0501037_0096894 3300049573 Bacteria 2132
174 Ga0501038_0394785 3300049574 Bacteria 1071
175 Ga0501039_0208672 3300049575 Bacteria 1536
176 Ga0501039_0278747 3300049575 Bacteria 1314
177 Ga0501042_0309220 3300049578 Bacteria 1142
178 Ga0501048_0163234 3300049582 Bacteria 1577
179 Ga0501068_0001035 3300049584 Bacteria 14696
180 Ga0501069_0020121 3300049585 Bacteria 3613
181 Ga0501069_0236680 3300049585 Bacteria 1064
182 Ga0501070_0007602 3300049586 Bacteria 9205
183 Ga0501070_0685780 3300049586 Bacteria 811
184 Ga0501071_0140220 3300049587 Bacteria 1800
185 Ga0501071_0408645 3300049587 Bacteria 1037
186 Ga0501072_0001978 3300049588 Bacteria 15269
187 Ga0501073_0000771 3300049589 Bacteria 22742
188 Ga0501074_0023079 3300049590 Bacteria 4524
189 Ga0501075_0161228 3300049591 Bacteria 1711
190 Ga0501076_0044722 3300049592 Bacteria 3493
191 Ga0501076_0762919 3300049592 Bacteria 798
192 Ga0501261_030113 3300049690 Bacteria 818
193 Ga0501079_0058665 3300049741 Bacteria 2970
194 Ga0501080_0008607 3300049742 Bacteria 9260
195 Ga0501083_0040910 3300049744 Bacteria 3145
196 Ga0501271_007528 3300049768 Bacteria 1099
197 nmdc:mga03n38_83472_c1 3300050490 Bacteria 1506
198 nmdc:mga00v17_127536_c1 3300050491 Bacteria 1624
199 nmdc:mga00v17_134758_c1 3300050491 Bacteria 1580
200 nmdc:mga0yw44_81508_c1 3300050492 Bacteria 2029
201 nmdc:mga09592_147085_c1 3300050508 Bacteria 2032
202 nmdc:mga09592_159708_c1 3300050508 Bacteria 1947
203 nmdc:mga09592_690482_c1 3300050508 Bacteria 869
204 nmdc:mga0qj67_172243_c1 3300050509 Bacteria 1758
205 nmdc:mga06r32_52623_c1 3300050510 Bacteria 3899
206 Ga0500644_0032139 3300053088 Bacteria 1675
207 Ga0500650_0018995 3300053098 Bacteria 2992
208 Ga0500652_003266 3300053131 Bacteria 4904
209 Ga0500573_0000052 3300053140 Bacteria 94687
210 Ga0500573_0021738 3300053140 Bacteria 3680
211 Ga0500573_0050704 3300053140 Bacteria 2387
212 Ga0500573_0059707 3300053140 Bacteria 2185
213 Ga0500577_0017203 3300053142 Bacteria 2297
214 Ga0500577_0077567 3300053142 Bacteria 1318
215 Ga0500577_0186153 3300053142 Bacteria 892
216 Ga0501084_0195878 3300054114 Bacteria 1705
217 Ga0530510_0103157 3300061734 Bacteria 2086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2675903059 2676484669 217
2 3300031456 Ga0307513_10021162 Ga0307513_100211622 219
3 3300061734 Ga0530510_0103157 Ga0530510_0103157_1413_2075 220
4 3300053140 Ga0500573_0000052 Ga0500573_0000052_89917_90582 221
5 iso_pu_bacteria 2585428094 2587864176 221
6 iso_pu_bacteria 2643221542 2643735175 221
7 iso_pu_bacteria 2643221553 2643784511 221
8 iso_pu_bacteria 2643221561 2643828109 221
9 iso_pu_bacteria 2643221575 2643888672 221
10 iso_pu_bacteria 2643221576 2643891741 221
11 iso_pu_bacteria 2643221590 2643960789 221
12 iso_pu_bacteria 2643221604 2644035702 221
13 iso_pu_bacteria 2643221617 2644101585 221
14 iso_pu_bacteria 2643221620 2644115648 221
15 iso_pu_bacteria 2643221630 2644171984 221
16 iso_pu_bacteria 2643221696 2644531198 221
17 iso_pu_bacteria 2643221724 2644678299 221
18 iso_pu_bacteria 2721755702 2723640948 221
19 iso_pu_bacteria 2728369380 2730231309 221
20 iso_pu_bacteria 2738541305 2738868200 221
21 iso_pu_bacteria 2747842429 2747954536 221
22 iso_pu_bacteria 2751185788 2753302527 221
23 iso_pu_bacteria 2773857759 2774382334 221
24 iso_pu_bacteria 2773857763 2774400561 221
25 iso_pu_bacteria 2811994874 2812332630 221
26 iso_pu_bacteria 2821268502 2821270968 221
27 iso_pu_bacteria 2852663356 2852663383 221
28 iso_pu_bacteria 2855386786 2855390506 221
29 iso_pu_bacteria 2857720070 2857722948 221
30 iso_pu_bacteria 2857723135 2857726563 221
31 iso_pu_bacteria 2857733635 2857735081 221
32 iso_pu_bacteria 2870622029 2870623402 221
33 iso_pu_bacteria 2919039151 2919040159 221
34 iso_pu_bacteria 2919042368 2919046021 221
35 iso_pu_bacteria 2928090899 2928093587 221
36 iso_pu_bacteria 2928104781 2928105852 221
37 iso_pu_bacteria 2939657138 2939657836 221
38 iso_pu_bacteria 2945968032 2945968216 221
39 iso_pu_bacteria 2946080515 2946083230 221
40 iso_pu_bacteria 2966924647 2966927364 221
41 iso_pu_bacteria 2977251589 2977252517 221
42 iso_pu_bacteria 2995463766 2995471644 221
43 iso_pu_bacteria 8004182704 8004182705 221
44 3300041509 Ga0451843_0771198 Ga0451843_0771198_82_750 222
45 3300042010 Ga0439452_013824 Ga0439452_013824_308_976 222
46 3300049586 Ga0501070_0685780 Ga0501070_0685780_12_701 222
47 3300005290 Ga0065712_10264436 Ga0065712_102644361 223
48 3300005295 Ga0065707_10100788 Ga0065707_101007883 223
49 3300005340 Ga0070689_100018676 Ga0070689_1000186763 223
50 3300005344 Ga0070661_100374514 Ga0070661_1003745142 223
51 3300005353 Ga0070669_100233717 Ga0070669_1002337172 223
52 3300005354 Ga0070675_100109524 Ga0070675_1001095242 223
53 3300005355 Ga0070671_100083206 Ga0070671_1000832064 223
54 3300005539 Ga0068853_100006179 Ga0068853_1000061791 223
55 3300005578 Ga0068854_100828402 Ga0068854_1008284021 223
56 3300005617 Ga0068859_100136221 Ga0068859_1001362212 223
57 3300005844 Ga0068862_100317028 Ga0068862_1003170282 223
58 3300006931 Ga0097620_100136223 Ga0097620_1001362233 223
59 3300009147 Ga0114129_11472352 Ga0114129_114723522 223
60 3300009148 Ga0105243_10689475 Ga0105243_106894752 223
61 3300013105 Ga0157369_10135501 Ga0157369_101355012 223
62 3300013307 Ga0157372_10551445 Ga0157372_105514452 223
63 3300014325 Ga0163163_10042622 Ga0163163_100426224 223
64 3300014326 Ga0157380_10055518 Ga0157380_100555184 223
65 3300014326 Ga0157380_10663095 Ga0157380_106630951 223
66 3300014969 Ga0157376_10836154 Ga0157376_108361541 223
67 3300025925 Ga0207650_10111161 Ga0207650_101111612 223
68 3300025926 Ga0207659_10109986 Ga0207659_101099862 223
69 3300025931 Ga0207644_10083008 Ga0207644_100830082 223
70 3300025940 Ga0207691_10634860 Ga0207691_106348602 223
71 3300025986 Ga0207658_10862350 Ga0207658_108623501 223
72 3300026041 Ga0207639_10214670 Ga0207639_102146702 223
73 3300026095 Ga0207676_10592920 Ga0207676_105929202 223
74 3300027462 Ga0210000_1021397 Ga0210000_10213972 223
75 3300028380 Ga0268265_10272308 Ga0268265_102723082 223
76 3300028380 Ga0268265_10465088 Ga0268265_104650882 223
77 3300006844 Ga0075428_100071748 Ga0075428_1000717485 224
78 3300006846 Ga0075430_100002023 Ga0075430_10000202315 224
79 3300006847 Ga0075431_100151324 Ga0075431_1001513242 224
80 3300006880 Ga0075429_100071577 Ga0075429_1000715773 224
81 3300009147 Ga0114129_10028935 Ga0114129_100289353 224
82 3300028794 Ga0307515_10009497 Ga0307515_100094974 224
83 3300028794 Ga0307515_10018349 Ga0307515_1001834912 224
84 3300030522 Ga0307512_10004935 Ga0307512_100049354 224
85 3300030522 Ga0307512_10006661 Ga0307512_100066612 224
86 3300031616 Ga0307508_10003215 Ga0307508_1000321511 224
87 3300035207 Ga0373942_0000524 Ga0373942_0000524_1386_2060 224
88 3300035242 Ga0373962_0039636 Ga0373962_0039636_416_1090 224
89 3300039437 Ga0436365_1393150 Ga0436365_1393150_155_829 224
90 3300044693 Ga0466961_0236588 Ga0466961_0236588_211_933 224
91 3300049571 Ga0501034_0003444 Ga0501034_0003444_13824_14498 224
92 3300049573 Ga0501037_0096894 Ga0501037_0096894_1072_1746 224
93 3300049584 Ga0501068_0001035 Ga0501068_0001035_12556_13230 224
94 3300049585 Ga0501069_0020121 Ga0501069_0020121_1272_1946 224
95 3300049586 Ga0501070_0007602 Ga0501070_0007602_6801_7475 224
96 3300049588 Ga0501072_0001978 Ga0501072_0001978_11372_12046 224
97 3300049589 Ga0501073_0000771 Ga0501073_0000771_546_1220 224
98 3300049590 Ga0501074_0023079 Ga0501074_0023079_1996_2670 224
99 3300049742 Ga0501080_0008607 Ga0501080_0008607_2578_3252 224
100 3300049744 Ga0501083_0040910 Ga0501083_0040910_1393_2067 224
101 3300050508 nmdc:mga09592_147085_c1 nmdc:mga09592_147085_c1_1194_1892 224
102 3300050509 nmdc:mga0qj67_172243_c1 nmdc:mga0qj67_172243_c1_950_1648 224
103 3300053088 Ga0500644_0032139 Ga0500644_0032139_569_1243 224
104 3300053131 Ga0500652_003266 Ga0500652_003266_2414_3088 224
105 iso_pu_bacteria 2984576629 2984579916 224
106 iso_pu_bacteria 2990256926 2990260405 224
107 3300000549 LJQas_1005417 LJQas_10054172 225
108 3300002738 JGI25154J39366_1003453 JGI25154J39366_10034532 225
109 3300003373 JGI25407J50210_10000514 JGI25407J50210_100005146 225
110 3300005445 Ga0070708_100445396 Ga0070708_1004453962 225
111 3300005467 Ga0070706_100477280 Ga0070706_1004772802 225
112 3300005468 Ga0070707_100339385 Ga0070707_1003393852 225
113 3300005618 Ga0068864_100844279 Ga0068864_1008442791 225
114 3300005937 Ga0081455_10001246 Ga0081455_1000124621 225
115 3300005937 Ga0081455_10003571 Ga0081455_1000357117 225
116 3300005937 Ga0081455_10010819 Ga0081455_100108195 225
117 3300005981 Ga0081538_10009216 Ga0081538_100092162 225
118 3300005981 Ga0081538_10020236 Ga0081538_100202363 225
119 3300005981 Ga0081538_10029332 Ga0081538_100293322 225
120 3300005985 Ga0081539_10003198 Ga0081539_100031985 225
121 3300005985 Ga0081539_10078870 Ga0081539_100788702 225
122 3300006038 Ga0075365_10004487 Ga0075365_100044875 225
123 3300006038 Ga0075365_10148114 Ga0075365_101481142 225
124 3300006048 Ga0075363_100037760 Ga0075363_1000377601 225
125 3300006051 Ga0075364_10356192 Ga0075364_103561921 225
126 3300006353 Ga0075370_10055659 Ga0075370_100556592 225
127 3300006844 Ga0075428_100074856 Ga0075428_1000748563 225
128 3300006844 Ga0075428_100241510 Ga0075428_1002415101 225
129 3300006880 Ga0075429_100083043 Ga0075429_1000830433 225
130 3300009094 Ga0111539_10473160 Ga0111539_104731602 225
131 3300009147 Ga0114129_10173074 Ga0114129_101730742 225
132 3300013104 Ga0157370_10088443 Ga0157370_100884434 225
133 3300014325 Ga0163163_10418186 Ga0163163_104181862 225
134 3300014969 Ga0157376_10019750 Ga0157376_100197504 225
135 3300025246 Ga0209646_1000030 Ga0209646_1000030147 225
136 3300025901 Ga0207688_10275364 Ga0207688_102753642 225
137 3300031548 Ga0307408_100068603 Ga0307408_1000686032 225
138 3300031548 Ga0307408_100679756 Ga0307408_1006797562 225
139 3300031731 Ga0307405_10006104 Ga0307405_100061043 225
140 3300031731 Ga0307405_10059336 Ga0307405_100593363 225
141 3300031731 Ga0307405_10369374 Ga0307405_103693742 225
142 3300031824 Ga0307413_10036845 Ga0307413_100368452 225
143 3300031824 Ga0307413_10252452 Ga0307413_102524522 225
144 3300031901 Ga0307406_10000142 Ga0307406_1000014213 225
145 3300031901 Ga0307406_10007267 Ga0307406_100072676 225
146 3300031901 Ga0307406_10074435 Ga0307406_100744352 225
147 3300031901 Ga0307406_10141482 Ga0307406_101414822 225
148 3300031901 Ga0307406_10327197 Ga0307406_103271972 225
149 3300031903 Ga0307407_10016265 Ga0307407_100162652 225
150 3300031903 Ga0307407_10137527 Ga0307407_101375272 225
151 3300031903 Ga0307407_10471975 Ga0307407_104719751 225
152 3300031911 Ga0307412_10008857 Ga0307412_100088574 225
153 3300031995 Ga0307409_100025248 Ga0307409_1000252481 225
154 3300031995 Ga0307409_100070166 Ga0307409_1000701662 225
155 3300031995 Ga0307409_100220185 Ga0307409_1002201851 225
156 3300032002 Ga0307416_100001327 Ga0307416_1000013276 225
157 3300032002 Ga0307416_100072091 Ga0307416_1000720912 225
158 3300032002 Ga0307416_100121905 Ga0307416_1001219052 225
159 3300032002 Ga0307416_100380063 Ga0307416_1003800632 225
160 3300032005 Ga0307411_10413726 Ga0307411_104137262 225
161 3300032126 Ga0307415_100000332 Ga0307415_1000003325 225
162 3300032126 Ga0307415_100018877 Ga0307415_1000188773 225
163 3300032126 Ga0307415_100198024 Ga0307415_1001980242 225
164 3300035091 Ga0373951_0000055 Ga0373951_0000055_3305_3982 225
165 3300037312 Ga0395899_0010778 Ga0395899_0010778_1081_1758 225
166 3300037418 Ga0395900_0150897 Ga0395900_0150897_221_919 225
167 3300037418 Ga0395900_0170632 Ga0395900_0170632_1056_1742 225
168 3300037418 Ga0395900_0487619 Ga0395900_0487619_141_818 225
169 3300037418 Ga0395900_0553726 Ga0395900_0553726_39_716 225
170 3300037466 Ga0395898_0014812 Ga0395898_0014812_7122_7808 225
171 3300037466 Ga0395898_0019689 Ga0395898_0019689_1652_2350 225
172 3300037466 Ga0395898_0294102 Ga0395898_0294102_429_1106 225
173 3300037466 Ga0395898_0775850 Ga0395898_0775850_23_700 225
174 3300037471 Ga0395905_0325435 Ga0395905_0325435_486_1172 225
175 3300037471 Ga0395905_0567217 Ga0395905_0567217_284_961 225
176 3300038443 Ga0395901_0027656 Ga0395901_0027656_4931_5629 225
177 3300038443 Ga0395901_0058043 Ga0395901_0058043_2958_3635 225
178 3300038443 Ga0395901_0085652 Ga0395901_0085652_1013_1699 225
179 3300038443 Ga0395901_0505366 Ga0395901_0505366_338_1015 225
180 3300041443 Ga0451789_0217693 Ga0451789_0217693_134_811 225
181 3300041443 Ga0451789_0368459 Ga0451789_0368459_290_967 225
182 3300041452 Ga0451793_1699148 Ga0451793_1699148_241_918 225
183 3300042016 Ga0439463_001082 Ga0439463_001082_2312_2989 225
184 3300042119 Ga0450915_007481 Ga0450915_007481_25_702 225
185 3300042439 Ga0439464_0002672 Ga0439464_0002672_2446_3123 225
186 3300042461 Ga0439460_0003483 Ga0439460_0003483_424_1101 225
187 3300042993 Ga0439440_0005990 Ga0439440_0005990_730_1407 225
188 3300044656 Ga0466969_0025931 Ga0466969_0025931_1879_2577 225
189 3300044683 Ga0466965_0084531 Ga0466965_0084531_550_1227 225
190 3300044684 Ga0466966_0005025 Ga0466966_0005025_1358_2056 225
191 3300044693 Ga0466961_0003026 Ga0466961_0003026_8187_8885 225
192 3300044694 Ga0466963_0011106 Ga0466963_0011106_2279_2977 225
193 3300044719 Ga0466971_0018543 Ga0466971_0018543_1949_2647 225
194 3300044765 Ga0466970_0045013 Ga0466970_0045013_234_932 225
195 3300045049 Ga0466959_0011167 Ga0466959_0011167_5644_6342 225
196 3300045836 Ga0466958_0053471 Ga0466958_0053471_1596_2294 225
197 3300045976 Ga0466967_0042434 Ga0466967_0042434_2420_3097 225
198 3300046455 Ga0495603_0011374 Ga0495603_0011374_620_1297 225
199 3300046459 Ga0495629_0017117 Ga0495629_0017117_814_1491 225
200 3300046459 Ga0495629_0327356 Ga0495629_0327356_37_714 225
201 3300046475 Ga0495639_0030228 Ga0495639_0030228_1637_2314 225
202 3300046476 Ga0495662_0054929 Ga0495662_0054929_1022_1699 225
203 3300046491 Ga0495584_0172009 Ga0495584_0172009_209_886 225
204 3300046499 Ga0495594_0153516 Ga0495594_0153516_131_808 225
205 3300046519 Ga0495632_0082395 Ga0495632_0082395_281_958 225
206 3300046543 Ga0495645_0094757 Ga0495645_0094757_1176_1853 225
207 3300046674 Ga0495588_0001596 Ga0495588_0001596_3038_3715 225
208 3300046674 Ga0495588_0046736 Ga0495588_0046736_586_1263 225
209 3300048914 Ga0496111_0147468 Ga0496111_0147468_757_1434 225
210 3300048920 Ga0496117_0000731 Ga0496117_0000731_26808_27485 225
211 3300048921 Ga0496118_0051510 Ga0496118_0051510_1674_2351 225
212 3300048922 Ga0496119_0139562 Ga0496119_0139562_271_948 225
213 3300048922 Ga0496119_0267386 Ga0496119_0267386_69_746 225
214 3300048924 Ga0496121_0204415 Ga0496121_0204415_473_1150 225
215 3300048925 Ga0496122_0008168 Ga0496122_0008168_5250_5927 225
216 3300048925 Ga0496122_0065851 Ga0496122_0065851_111_788 225
217 3300048925 Ga0496122_0115019 Ga0496122_0115019_716_1393 225
218 3300048925 Ga0496122_0131334 Ga0496122_0131334_860_1537 225
219 3300048927 Ga0496124_0003218 Ga0496124_0003218_4288_4965 225
220 3300048927 Ga0496124_0084497 Ga0496124_0084497_153_830 225
221 3300048928 Ga0496125_0003081 Ga0496125_0003081_2486_3163 225
222 3300048928 Ga0496125_0027309 Ga0496125_0027309_1045_1722 225
223 3300048928 Ga0496125_0045757 Ga0496125_0045757_686_1363 225
224 3300048928 Ga0496125_0145735 Ga0496125_0145735_668_1345 225
225 3300048928 Ga0496125_0342205 Ga0496125_0342205_102_779 225
226 3300048929 Ga0496126_0020157 Ga0496126_0020157_4404_5081 225
227 3300048929 Ga0496126_0075976 Ga0496126_0075976_431_1108 225
228 3300048929 Ga0496126_0182709 Ga0496126_0182709_54_731 225
229 3300049522 Ga0501299_014454 Ga0501299_014454_191_868 225
230 3300049568 Ga0501031_0180586 Ga0501031_0180586_207_932 225
231 3300049574 Ga0501038_0394785 Ga0501038_0394785_59_736 225
232 3300049575 Ga0501039_0208672 Ga0501039_0208672_23_700 225
233 3300049575 Ga0501039_0278747 Ga0501039_0278747_362_1087 225
234 3300049578 Ga0501042_0309220 Ga0501042_0309220_64_789 225
235 3300049582 Ga0501048_0163234 Ga0501048_0163234_329_1006 225
236 3300049585 Ga0501069_0236680 Ga0501069_0236680_165_890 225
237 3300049587 Ga0501071_0140220 Ga0501071_0140220_279_956 225
238 3300049587 Ga0501071_0408645 Ga0501071_0408645_39_716 225
239 3300049591 Ga0501075_0161228 Ga0501075_0161228_937_1662 225
240 3300049592 Ga0501076_0044722 Ga0501076_0044722_2581_3306 225
241 3300049592 Ga0501076_0762919 Ga0501076_0762919_94_771 225
242 3300049690 Ga0501261_030113 Ga0501261_030113_50_727 225
243 3300049741 Ga0501079_0058665 Ga0501079_0058665_1762_2487 225
244 3300049768 Ga0501271_007528 Ga0501271_007528_198_875 225
245 3300050490 nmdc:mga03n38_83472_c1 nmdc:mga03n38_83472_c1_378_1055 225
246 3300050491 nmdc:mga00v17_127536_c1 nmdc:mga00v17_127536_c1_495_1172 225
247 3300050491 nmdc:mga00v17_134758_c1 nmdc:mga00v17_134758_c1_558_1235 225
248 3300050492 nmdc:mga0yw44_81508_c1 nmdc:mga0yw44_81508_c1_368_1045 225
249 3300050508 nmdc:mga09592_159708_c1 nmdc:mga09592_159708_c1_482_1159 225
250 3300050508 nmdc:mga09592_690482_c1 nmdc:mga09592_690482_c1_68_754 225
251 3300050510 nmdc:mga06r32_52623_c1 nmdc:mga06r32_52623_c1_12_689 225
252 3300053098 Ga0500650_0018995 Ga0500650_0018995_1232_1909 225
253 3300053140 Ga0500573_0021738 Ga0500573_0021738_145_822 225
254 3300053140 Ga0500573_0050704 Ga0500573_0050704_1304_1981 225
255 3300053140 Ga0500573_0059707 Ga0500573_0059707_958_1635 225
256 3300053142 Ga0500577_0017203 Ga0500577_0017203_1505_2182 225
257 3300053142 Ga0500577_0077567 Ga0500577_0077567_240_917 225
258 3300053142 Ga0500577_0186153 Ga0500577_0186153_114_791 225
259 3300054114 Ga0501084_0195878 Ga0501084_0195878_673_1398 225
260 iso_pu_bacteria 2939660829 2939662060 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

1

110

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.972 2 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9719 1 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9708 1 118
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9674 2 118
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9673 2 118
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9947 1 84 3.40.50.2300
af_O07776_147_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9909 126 224 1.10.10.10
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.99 1 77 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9831 1 84 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9808 1 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A177RBC4-F1-model_v4 deleted 0.9604 1 222
AF-A0A7W7VCL5-F1-model_v4 DNA-binding response OmpR family regulator 0.9537 2 221 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4R7SPE0-F1-model_v4 deleted 0.9467 1 225
AF-A0A4R7SPE0-F1-model_v4 deleted 0.9427 1 225
AF-A0A7H5K7Q5-F1-model_v4 deleted 0.9371 1 223

Feature Viewer

pLDDT pTM Quality
89.27 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map