F369754

General Info

Members Datasets Scaffolds Average Seq Length
260 179 520 282

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0023681|Ga0466969_0023681_1015_1944
Length 309
Sequence MKDEGERIAMVTAYDASFARLCDQAGADVLLVGDSLGMVIKGEDNTLAVTMDEMIYHCRAVARGVAAGSGRAMIVGDLPFMSYQSAEDEALRNAGRLLKEGKAEAVKLEGGAEYAGMVHKMSRIGIPVMGHIGLTPQSVHALGGFKVQGRETSQADRLKADAVALAEAGAFALVLEGIPRELAAEITQALPIPTIGIGAGVECDGQVLVLYDLLGMNEEFRPRFVKRYENFAVRVRTAVDTYISEVRSGEFPGLEHSFTREQGSKDKERGPAAARVAAAGGVVAESEGSESPLSGLACVPLRPLTGGRE

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
150 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
154 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
173 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
176 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0
Rhizoplane 0.77
Rhizosphere 93.08
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0023681 3300044656 Bacteria 3162
2 Ga0065712_10068691 3300005290 Bacteria 9380
3 Ga0065707_10106395 3300005295 Bacteria 2598
4 Ga0070658_10053589 3300005327 Bacteria 3274
5 Ga0070683_100247321 3300005329 Bacteria 1696
6 Ga0070670_100117346 3300005331 Bacteria 2295
7 Ga0070680_100027654 3300005336 Bacteria 4543
8 Ga0070680_100054094 3300005336 Bacteria 3277
9 Ga0070680_100214074 3300005336 Bacteria 1626
10 Ga0070689_100097127 3300005340 Bacteria 2329
11 Ga0070674_100025099 3300005356 Bacteria 3876
12 Ga0070688_100110722 3300005365 Bacteria 1826
13 Ga0070701_10029678 3300005438 Bacteria 2699
14 Ga0070711_100188530 3300005439 Bacteria 1583
15 Ga0070700_100180373 3300005441 Bacteria 1469
16 Ga0070694_100066080 3300005444 Bacteria 2480
17 Ga0070694_100219998 3300005444 Unclassified 1424
18 Ga0070678_100006685 3300005456 Bacteria 6788
19 Ga0070662_100142109 3300005457 Bacteria 1861
20 Ga0070681_10018755 3300005458 Bacteria 6924
21 Ga0070681_10030651 3300005458 Bacteria 5397
22 Ga0070681_10064879 3300005458 Bacteria 3622
23 Ga0070681_10083538 3300005458 Bacteria 3147
24 Ga0070681_10133201 3300005458 Bacteria 2417
25 Ga0070681_10425909 3300005458 Bacteria 1239
26 Ga0070707_100291448 3300005468 Bacteria 1586
27 Ga0070698_100000128 3300005471 Bacteria 65860
28 Ga0070698_100069395 3300005471 Bacteria 3538
29 Ga0070698_100312635 3300005471 Bacteria 1502
30 Ga0070699_100052769 3300005518 Bacteria 3518
31 Ga0070699_100116882 3300005518 Bacteria 2344
32 Ga0070679_100015209 3300005530 Bacteria 7392
33 Ga0070679_100017168 3300005530 Bacteria 7000
34 Ga0070679_100040861 3300005530 Bacteria 4615
35 Ga0070679_100417931 3300005530 Bacteria 1286
36 Ga0070679_100436050 3300005530 Unclassified 1255
37 Ga0070684_100074184 3300005535 Bacteria 2999
38 Ga0070697_100500051 3300005536 Bacteria 1063
39 Ga0070695_100030801 3300005545 Bacteria 3341
40 Ga0070695_100470331 3300005545 Bacteria 967
41 Ga0070696_100030221 3300005546 Bacteria 3708
42 Ga0070665_100002759 3300005548 Bacteria 19041
43 Ga0070665_100517607 3300005548 Bacteria 1205
44 Ga0070704_100001028 3300005549 Bacteria 14366
45 Ga0070704_100018017 3300005549 Bacteria 4505
46 Ga0068855_100199875 3300005563 Bacteria 2251
47 Ga0068855_100329962 3300005563 Bacteria 1684
48 Ga0068855_100492703 3300005563 Bacteria 1333
49 Ga0068854_100510278 3300005578 Bacteria 1014
50 Ga0068856_100363985 3300005614 Bacteria 1465
51 Ga0068859_100052084 3300005617 Bacteria 4115
52 Ga0068861_100066305 3300005719 Bacteria 2783
53 Ga0068862_100415127 3300005844 Bacteria 1262
54 Ga0070717_10023682 3300006028 Bacteria 4869
55 Ga0070717_10029826 3300006028 Bacteria 4381
56 Ga0075431_100027032 3300006847 Bacteria 5885
57 Ga0075431_100213478 3300006847 Bacteria 1970
58 Ga0075434_100015173 3300006871 Bacteria 7381
59 Ga0075434_100179862 3300006871 Bacteria 2135
60 Ga0075429_100064117 3300006880 Bacteria 3201
61 Ga0075429_100361880 3300006880 Bacteria 1270
62 Ga0097620_100052084 3300006931 Bacteria 4115
63 Ga0075435_100014031 3300007076 Bacteria 5975
64 Ga0111539_10012413 3300009094 Bacteria 10683
65 Ga0111539_10029501 3300009094 Bacteria 6680
66 Ga0111539_10269807 3300009094 Bacteria 1981
67 Ga0111539_10327168 3300009094 Bacteria 1784
68 Ga0111539_10341856 3300009094 Bacteria 1742
69 Ga0111539_10465397 3300009094 Bacteria 1472
70 Ga0105245_10000051 3300009098 Bacteria 127940
71 Ga0114129_10011042 3300009147 Bacteria 12864
72 Ga0114129_10055805 3300009147 Bacteria 5536
73 Ga0114129_10310024 3300009147 Bacteria 2101
74 Ga0105237_10125658 3300009545 Bacteria 2559
75 Ga0105249_10226279 3300009553 Bacteria 1843
76 Ga0105249_10398258 3300009553 Bacteria 1406
77 Ga0105239_10180067 3300010375 Bacteria 2365
78 Ga0157369_10021965 3300013105 Bacteria 7132
79 Ga0157374_10098599 3300013296 Bacteria 2798
80 Ga0157376_10127206 3300014969 Bacteria 2268
81 Ga0157376_10204520 3300014969 Bacteria 1819
82 Ga0207643_10230177 3300025908 Bacteria 1137
83 Ga0207707_10001003 3300025912 Bacteria 27052
84 Ga0207707_10047450 3300025912 Bacteria 3740
85 Ga0207707_10106602 3300025912 Bacteria 2449
86 Ga0207707_10192247 3300025912 Bacteria 1780
87 Ga0207707_10208268 3300025912 Bacteria 1704
88 Ga0207660_10065102 3300025917 Bacteria 2633
89 Ga0207660_10216269 3300025917 Bacteria 1502
90 Ga0207662_10032720 3300025918 Bacteria 3028
91 Ga0207657_10089778 3300025919 Bacteria 2566
92 Ga0207652_10002311 3300025921 Bacteria 16155
93 Ga0207652_10143971 3300025921 Bacteria 2132
94 Ga0207652_10209226 3300025921 Bacteria 1756
95 Ga0207652_10339352 3300025921 Bacteria 1356
96 Ga0207687_10000364 3300025927 Bacteria 30288
97 Ga0207706_10045348 3300025933 Bacteria 3896
98 Ga0207670_10041870 3300025936 Bacteria 3015
99 Ga0207670_10085805 3300025936 Bacteria 2213
100 Ga0207669_10017322 3300025937 Bacteria 3692
101 Ga0207661_10023031 3300025944 Bacteria 4702
102 Ga0207667_10153623 3300025949 Bacteria 2368
103 Ga0207667_10211548 3300025949 Bacteria 1988
104 Ga0207712_10082243 3300025961 Bacteria 2347
105 Ga0207712_10304632 3300025961 Bacteria 1309
106 Ga0207708_10179459 3300026075 Bacteria 1681
107 Ga0207708_10369595 3300026075 Bacteria 1180
108 Ga0207674_10081979 3300026116 Bacteria 3227
109 Ga0207674_10158847 3300026116 Bacteria 2215
110 Ga0207675_100054905 3300026118 Bacteria 3716
111 Ga0207683_10008974 3300026121 Bacteria 8517
112 Ga0209966_1015235 3300027695 Viruses 1442
113 Ga0209998_10002889 3300027717 Bacteria 3853
114 Ga0207428_10207113 3300027907 Bacteria 1475
115 Ga0268266_10273217 3300028379 Bacteria 1569
116 Ga0268264_10042296 3300028381 Bacteria 3772
117 Ga0265318_10007602 3300028577 Bacteria 4884
118 Ga0307515_10036661 3300028794 Bacteria 7924
119 Ga0265338_10185372 3300028800 Bacteria 1582
120 Ga0265338_10252273 3300028800 Bacteria 1301
121 Ga0265330_10014803 3300031235 Bacteria 3618
122 Ga0265332_10005462 3300031238 Bacteria 5861
123 Ga0265332_10007847 3300031238 Bacteria 4815
124 Ga0265320_10009069 3300031240 Bacteria 6033
125 Ga0265339_10005452 3300031249 Bacteria 8476
126 Ga0265331_10004192 3300031250 Bacteria 9031
127 Ga0265316_10024057 3300031344 Bacteria 5113
128 Ga0307509_10006736 3300031507 Bacteria 15307
129 Ga0307509_10054745 3300031507 Bacteria 4245
130 Ga0307509_10246906 3300031507 Bacteria 1572
131 Ga0307408_100096433 3300031548 Bacteria 2244
132 Ga0307408_100376874 3300031548 Unclassified 1212
133 Ga0307508_10007782 3300031616 Bacteria 9954
134 Ga0307508_10032129 3300031616 Bacteria 4743
135 Ga0316575_10047888 3300031665 Unclassified 1699
136 Ga0316579_10005852 3300031691 Bacteria 4986
137 Ga0265314_10055742 3300031711 Bacteria 2725
138 Ga0265342_10002951 3300031712 Bacteria 14310
139 Ga0307516_10355122 3300031730 Bacteria 1131
140 Ga0307405_10149091 3300031731 Bacteria 1642
141 Ga0307405_10208387 3300031731 Bacteria 1425
142 Ga0316577_10130015 3300031733 Bacteria 1417
143 Ga0307413_10086401 3300031824 Unclassified 2028
144 Ga0307410_10172411 3300031852 Bacteria 1631
145 Ga0307406_10095648 3300031901 Bacteria 2010
146 Ga0307407_10041647 3300031903 Bacteria 2570
147 Ga0307412_10465174 3300031911 Bacteria 1045
148 Ga0307409_100367295 3300031995 Bacteria 1363
149 Ga0307414_10295338 3300032004 Bacteria 1368
150 Ga0307411_10034686 3300032005 Bacteria 3143
151 Ga0307411_10111042 3300032005 Bacteria 1962
152 Ga0307411_10150914 3300032005 Bacteria 1727
153 Ga0307411_10186784 3300032005 Bacteria 1578
154 Ga0307415_100163876 3300032126 Bacteria 1726
155 Ga0307507_10117593 3300033179 Bacteria 2142
156 Ga0373944_0048264 3300035089 Bacteria 1336
157 Ga0373949_0000548 3300035090 Bacteria 12378
158 Ga0373943_0007591 3300035170 Bacteria 4870
159 Ga0373955_0036262 3300035172 Bacteria 2616
160 Ga0373961_0000127 3300035241 Bacteria 38962
161 Ga0373927_0302451 3300035695 Bacteria 1053
162 Ga0316582_0048436 3300036647 Bacteria 2687
163 Ga0316582_0081988 3300036647 Bacteria 2108
164 Ga0316582_0101302 3300036647 Bacteria 1908
165 Ga0395899_0333553 3300037312 Bacteria 1018
166 Ga0395900_0024751 3300037418 Bacteria 6144
167 Ga0395905_0421285 3300037471 Bacteria 1231
168 Ga0395905_0553579 3300037471 Bacteria 1051
169 Ga0316581_0014128 3300037588 Bacteria 2270
170 Ga0395901_0036190 3300038443 Bacteria 5100
171 Ga0395901_0646995 3300038443 Bacteria 1061
172 Ga0436362_1257838 3300039453 Bacteria 1325
173 Ga0451577_0000223 3300042876 Bacteria 116763
174 Ga0451577_0235013 3300042876 Bacteria 1658
175 Ga0451577_0455259 3300042876 Bacteria 1162
176 Ga0466972_0076919 3300044658 Bacteria 1590
177 Ga0453683_0099945 3300044673 Unclassified 1821
178 Ga0453683_0145305 3300044673 Bacteria 1497
179 Ga0466966_0082907 3300044684 Bacteria 1995
180 Ga0453684_0000722 3300044712 Bacteria 116763
181 Ga0466959_0069360 3300045049 Bacteria 2554
182 Ga0466967_0149078 3300045976 Bacteria 2185
183 Ga0495630_0290350 3300046517 Bacteria 1250
184 Ga0495633_0055090 3300046558 Bacteria 1870
185 Ga0495623_0029405 3300046679 Bacteria 3536
186 Ga0495658_0178483 3300046683 Bacteria 1317
187 Ga0495676_0237077 3300047321 Bacteria 1251
188 Ga0495602_0058527 3300048088 Bacteria 3372
189 Ga0496112_0169536 3300048915 Bacteria 2148
190 Ga0496115_0519472 3300048918 Bacteria 955
191 Ga0501031_0013400 3300049568 Bacteria 5348
192 Ga0501032_0354044 3300049569 Bacteria 946
193 Ga0501034_0017798 3300049571 Bacteria 7290
194 Ga0501036_0075062 3300049572 Bacteria 2859
195 Ga0501037_0045599 3300049573 Bacteria 3218
196 Ga0501038_0084113 3300049574 Bacteria 2677
197 Ga0501038_0334359 3300049574 Bacteria 1182
198 Ga0501038_0356738 3300049574 Bacteria 1138
199 Ga0501039_0027676 3300049575 Bacteria 4359
200 Ga0501040_0125461 3300049576 Bacteria 1803
201 Ga0501040_0133483 3300049576 Bacteria 1746
202 Ga0501042_0090138 3300049578 Bacteria 2200
203 Ga0501042_0101009 3300049578 Bacteria 2074
204 Ga0501043_0084179 3300049579 Bacteria 2500
205 Ga0501046_0055703 3300049580 Bacteria 3106
206 Ga0501046_0189865 3300049580 Bacteria 1533
207 Ga0501047_0012353 3300049581 Bacteria 8084
208 Ga0501068_0011994 3300049584 Bacteria 4901
209 Ga0501069_0083744 3300049585 Bacteria 1798
210 Ga0501070_0129249 3300049586 Bacteria 2087
211 Ga0501071_0059811 3300049587 Bacteria 2757
212 Ga0501071_0522816 3300049587 Bacteria 910
213 Ga0501072_0035852 3300049588 Bacteria 3887
214 Ga0501074_0023141 3300049590 Bacteria 4518
215 Ga0501075_0003557 3300049591 Bacteria 10433
216 Ga0501075_0094118 3300049591 Bacteria 2274
217 Ga0501075_0202067 3300049591 Bacteria 1515
218 Ga0501076_0257173 3300049592 Bacteria 1429
219 Ga0501077_0019183 3300049593 Bacteria 4324
220 Ga0501077_0044433 3300049593 Bacteria 2822
221 Ga0501217_016389 3300049661 Bacteria 1698
222 Ga0501230_001217 3300049667 Bacteria 3015
223 Ga0501249_008380 3300049679 Bacteria 2146
224 Ga0501249_009100 3300049679 Bacteria 2065
225 Ga0501221_002010 3300049704 Unclassified 3390
226 Ga0501225_0001641 3300049705 Bacteria 6985
227 Ga0501234_004570 3300049707 Bacteria 2177
228 Ga0501079_0012153 3300049741 Bacteria 6573
229 Ga0501080_0013486 3300049742 Bacteria 7520
230 Ga0501080_0511817 3300049742 Bacteria 1072
231 Ga0501081_0036677 3300049743 Bacteria 3343
232 Ga0501083_0005420 3300049744 Bacteria 9034
233 Ga0501268_000102 3300049765 Bacteria 7043
234 Ga0501270_008840 3300049767 Bacteria 1286
235 Ga0501044_0097776 3300049823 Bacteria 2956
236 Ga0501045_0008048 3300049824 Bacteria 7344
237 Ga0501045_0098811 3300049824 Bacteria 2159
238 Ga0501212_016349 3300049851 Bacteria 1114
239 nmdc:mga05p37_200622_c2 3300050507 Bacteria 1503
240 nmdc:mga0qj67_170770_c1 3300050509 Bacteria 1765
241 nmdc:mga08y16_247984_c1 3300050511 Bacteria 1840
242 nmdc:mga08y16_68839_c1 3300050511 Bacteria 3690
243 nmdc:mga08y16_78468_c1 3300050511 Bacteria 3442
244 nmdc:mga0n895_62710_c1 3300050512 Bacteria 3675
245 nmdc:mga0n895_738228_c1 3300050512 Bacteria 978
246 nmdc:mga0a205_73648_c1 3300050515 Bacteria 3299
247 Ga0500566_0001810 3300053094 Bacteria 12566
248 Ga0500554_000046 3300053102 Bacteria 21232
249 Ga0500595_001949 3300053119 Bacteria 10616
250 Ga0500614_000105 3300053123 Bacteria 20231
251 Ga0500619_025352 3300053154 Bacteria 1755
252 Ga0500622_0054030 3300053156 Bacteria 2061
253 Ga0500634_0041997 3300053161 Bacteria 2482
254 Ga0500639_068736 3300053163 Bacteria 1809
255 Ga0501084_0009379 3300054114 Bacteria 8095
256 Ga0501084_0155756 3300054114 Bacteria 1927
257 Ga0501084_0193585 3300054114 Bacteria 1715
258 Ga0501082_0005005 3300060353 Bacteria 11567
259 Ga0530510_0000328 3300061734 Bacteria 30598
260 Ga0530510_0373966 3300061734 Bacteria 1072
261 Ga0466969_0023681
262 Ga0065712_10068691
263 Ga0065707_10106395
264 Ga0070658_10053589
265 Ga0070683_100247321
266 Ga0070670_100117346
267 Ga0070680_100027654
268 Ga0070680_100054094
269 Ga0070680_100214074
270 Ga0070689_100097127
271 Ga0070674_100025099
272 Ga0070688_100110722
273 Ga0070701_10029678
274 Ga0070711_100188530
275 Ga0070700_100180373
276 Ga0070694_100066080
277 Ga0070694_100219998
278 Ga0070678_100006685
279 Ga0070662_100142109
280 Ga0070681_10018755
281 Ga0070681_10030651
282 Ga0070681_10064879
283 Ga0070681_10083538
284 Ga0070681_10133201
285 Ga0070681_10425909
286 Ga0070707_100291448
287 Ga0070698_100000128
288 Ga0070698_100069395
289 Ga0070698_100312635
290 Ga0070699_100052769
291 Ga0070699_100116882
292 Ga0070679_100015209
293 Ga0070679_100017168
294 Ga0070679_100040861
295 Ga0070679_100417931
296 Ga0070679_100436050
297 Ga0070684_100074184
298 Ga0070697_100500051
299 Ga0070695_100030801
300 Ga0070695_100470331
301 Ga0070696_100030221
302 Ga0070665_100002759
303 Ga0070665_100517607
304 Ga0070704_100001028
305 Ga0070704_100018017
306 Ga0068855_100199875
307 Ga0068855_100329962
308 Ga0068855_100492703
309 Ga0068854_100510278
310 Ga0068856_100363985
311 Ga0068859_100052084
312 Ga0068861_100066305
313 Ga0068862_100415127
314 Ga0070717_10023682
315 Ga0070717_10029826
316 Ga0075431_100027032
317 Ga0075431_100213478
318 Ga0075434_100015173
319 Ga0075434_100179862
320 Ga0075429_100064117
321 Ga0075429_100361880
322 Ga0097620_100052084
323 Ga0075435_100014031
324 Ga0111539_10012413
325 Ga0111539_10029501
326 Ga0111539_10269807
327 Ga0111539_10327168
328 Ga0111539_10341856
329 Ga0111539_10465397
330 Ga0105245_10000051
331 Ga0114129_10011042
332 Ga0114129_10055805
333 Ga0114129_10310024
334 Ga0105237_10125658
335 Ga0105249_10226279
336 Ga0105249_10398258
337 Ga0105239_10180067
338 Ga0157369_10021965
339 Ga0157374_10098599
340 Ga0157376_10127206
341 Ga0157376_10204520
342 Ga0207643_10230177
343 Ga0207707_10001003
344 Ga0207707_10047450
345 Ga0207707_10106602
346 Ga0207707_10192247
347 Ga0207707_10208268
348 Ga0207660_10065102
349 Ga0207660_10216269
350 Ga0207662_10032720
351 Ga0207657_10089778
352 Ga0207652_10002311
353 Ga0207652_10143971
354 Ga0207652_10209226
355 Ga0207652_10339352
356 Ga0207687_10000364
357 Ga0207706_10045348
358 Ga0207670_10041870
359 Ga0207670_10085805
360 Ga0207669_10017322
361 Ga0207661_10023031
362 Ga0207667_10153623
363 Ga0207667_10211548
364 Ga0207712_10082243
365 Ga0207712_10304632
366 Ga0207708_10179459
367 Ga0207708_10369595
368 Ga0207674_10081979
369 Ga0207674_10158847
370 Ga0207675_100054905
371 Ga0207683_10008974
372 Ga0209966_1015235
373 Ga0209998_10002889
374 Ga0207428_10207113
375 Ga0268266_10273217
376 Ga0268264_10042296
377 Ga0265318_10007602
378 Ga0307515_10036661
379 Ga0265338_10185372
380 Ga0265338_10252273
381 Ga0265330_10014803
382 Ga0265332_10005462
383 Ga0265332_10007847
384 Ga0265320_10009069
385 Ga0265339_10005452
386 Ga0265331_10004192
387 Ga0265316_10024057
388 Ga0307509_10006736
389 Ga0307509_10054745
390 Ga0307509_10246906
391 Ga0307408_100096433
392 Ga0307408_100376874
393 Ga0307508_10007782
394 Ga0307508_10032129
395 Ga0316575_10047888
396 Ga0316579_10005852
397 Ga0265314_10055742
398 Ga0265342_10002951
399 Ga0307516_10355122
400 Ga0307405_10149091
401 Ga0307405_10208387
402 Ga0316577_10130015
403 Ga0307413_10086401
404 Ga0307410_10172411
405 Ga0307406_10095648
406 Ga0307407_10041647
407 Ga0307412_10465174
408 Ga0307409_100367295
409 Ga0307414_10295338
410 Ga0307411_10034686
411 Ga0307411_10111042
412 Ga0307411_10150914
413 Ga0307411_10186784
414 Ga0307415_100163876
415 Ga0307507_10117593
416 Ga0373944_0048264
417 Ga0373949_0000548
418 Ga0373943_0007591
419 Ga0373955_0036262
420 Ga0373961_0000127
421 Ga0373927_0302451
422 Ga0316582_0048436
423 Ga0316582_0081988
424 Ga0316582_0101302
425 Ga0395899_0333553
426 Ga0395900_0024751
427 Ga0395905_0421285
428 Ga0395905_0553579
429 Ga0316581_0014128
430 Ga0395901_0036190
431 Ga0395901_0646995
432 Ga0436362_1257838
433 Ga0451577_0000223
434 Ga0451577_0235013
435 Ga0451577_0455259
436 Ga0466972_0076919
437 Ga0453683_0099945
438 Ga0453683_0145305
439 Ga0466966_0082907
440 Ga0453684_0000722
441 Ga0466959_0069360
442 Ga0466967_0149078
443 Ga0495630_0290350
444 Ga0495633_0055090
445 Ga0495623_0029405
446 Ga0495658_0178483
447 Ga0495676_0237077
448 Ga0495602_0058527
449 Ga0496112_0169536
450 Ga0496115_0519472
451 Ga0501031_0013400
452 Ga0501032_0354044
453 Ga0501034_0017798
454 Ga0501036_0075062
455 Ga0501037_0045599
456 Ga0501038_0084113
457 Ga0501038_0334359
458 Ga0501038_0356738
459 Ga0501039_0027676
460 Ga0501040_0125461
461 Ga0501040_0133483
462 Ga0501042_0090138
463 Ga0501042_0101009
464 Ga0501043_0084179
465 Ga0501046_0055703
466 Ga0501046_0189865
467 Ga0501047_0012353
468 Ga0501068_0011994
469 Ga0501069_0083744
470 Ga0501070_0129249
471 Ga0501071_0059811
472 Ga0501071_0522816
473 Ga0501072_0035852
474 Ga0501074_0023141
475 Ga0501075_0003557
476 Ga0501075_0094118
477 Ga0501075_0202067
478 Ga0501076_0257173
479 Ga0501077_0019183
480 Ga0501077_0044433
481 Ga0501217_016389
482 Ga0501230_001217
483 Ga0501249_008380
484 Ga0501249_009100
485 Ga0501221_002010
486 Ga0501225_0001641
487 Ga0501234_004570
488 Ga0501079_0012153
489 Ga0501080_0013486
490 Ga0501080_0511817
491 Ga0501081_0036677
492 Ga0501083_0005420
493 Ga0501268_000102
494 Ga0501270_008840
495 Ga0501044_0097776
496 Ga0501045_0008048
497 Ga0501045_0098811
498 Ga0501212_016349
499 nmdc:mga05p37_200622_c2
500 nmdc:mga0qj67_170770_c1
501 nmdc:mga08y16_247984_c1
502 nmdc:mga08y16_68839_c1
503 nmdc:mga08y16_78468_c1
504 nmdc:mga0n895_62710_c1
505 nmdc:mga0n895_738228_c1
506 nmdc:mga0a205_73648_c1
507 Ga0500566_0001810
508 Ga0500554_000046
509 Ga0500595_001949
510 Ga0500614_000105
511 Ga0500619_025352
512 Ga0500622_0054030
513 Ga0500634_0041997
514 Ga0500639_068736
515 Ga0501084_0009379
516 Ga0501084_0155756
517 Ga0501084_0193585
518 Ga0501082_0005005
519 Ga0530510_0000328
520 Ga0530510_0373966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02548

Pantoate_transf

Ketopantoate hydroxymethyltransferase

1

254

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9764 36 297
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9686 36 297
3vav-assembly1.cif.gz_J crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.8826 36 299
1o66-assembly1.cif.gz_B crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.8807 36 294
3vav-assembly1.cif.gz_D crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.8806 36 299
ID Description Score Start End Superfamily
af_Q5ABB3_27_304_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9847 37 300 3.20.20.60
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9833 36 300 3.20.20.60
1oy0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9764 36 297 3.20.20.60
af_Q2FV21_2_270_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9762 39 300 3.20.20.60
1oy0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9686 36 297 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2V9UH40-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9967 36 176 GO:0000287
GO:0003864
GO:0008168
GO:0015940
GO:0032259
AF-A0A3B1CY54-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9949 36 300 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A7Y5GY72-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9928 36 300 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A0F2IWS3-F1-model_v4 deleted 0.9926 36 300
AF-A0A848B7W4-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9922 37 300 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259

Map