F369730

General Info

Members Datasets Scaffolds Average Seq Length
260 220 243 219

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0016862|Ga0439436_0016862_44_760
Length 238
Sequence MTTTPTTGYATAEGTPASGGADAAPPMTADHRLSMDELAAVIARDIPAGAFVNLGIGQPTKIADHLPADSGVVLHTENGMLNMGPKAEGDAVDPDLTNAGKVPVTELPGAAYFHHADSFAMMRGGHLDVCVLGAYQVAFDGDLANWHTGEPDAIPAVGGAMDLAIGAKDVYVMMTLFTRSGEPKLVPRCTYPLTGVGCVSRVYTDHGVFDVGPEGVRIRETYGVSADELGERLGITPL

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2643221647 Streptomyces sp. Root369 Isolate Unclassified
3 2643221714 Streptomyces sp. Root264 Isolate Unclassified
4 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
5 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
6 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
7 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
8 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
9 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
10 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
11 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
12 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
13 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
14 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
15 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
16 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
95 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
96 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
136 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
137 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
140 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
144 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
187 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
188 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.69
Metatranscriptomes 0.77
Isolates 6.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0.38
Rhizoplane 2.31
Rhizosphere 81.54
Stem 0
Stem Tuber 0
Unclassified 8.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10014642 3300003203 Bacteria 3331
2 JGI25405J52794_10012568 3300003911 Bacteria 1632
3 Ga0070668_100012378 3300005347 Bacteria 6353
4 Ga0070709_10003517 3300005434 Bacteria 8421
5 Ga0070709_10663539 3300005434 Bacteria 808
6 Ga0070714_100075518 3300005435 Bacteria 2924
7 Ga0070713_100042123 3300005436 Bacteria 3724
8 Ga0070710_10002430 3300005437 Bacteria 8822
9 Ga0070710_10016864 3300005437 Bacteria 3727
10 Ga0070711_100005137 3300005439 Bacteria 7797
11 Ga0070711_100039325 3300005439 Bacteria 3185
12 Ga0070700_100304963 3300005441 Bacteria 1164
13 Ga0070662_100013659 3300005457 Bacteria 5407
14 Ga0070707_100033322 3300005468 Bacteria 4912
15 Ga0070698_100003270 3300005471 Bacteria 17804
16 Ga0070684_100300195 3300005535 Bacteria 1474
17 Ga0068854_100033643 3300005578 Bacteria 3575
18 Ga0068852_101260435 3300005616 Bacteria 761
19 Ga0068859_100003012 3300005617 Bacteria 17078
20 Ga0068866_10014332 3300005718 Bacteria 3498
21 Ga0068861_100011634 3300005719 Bacteria 6122
22 Ga0068858_100093577 3300005842 Bacteria 2798
23 Ga0081455_10001196 3300005937 Bacteria 32499
24 Ga0081455_10009510 3300005937 Bacteria 9989
25 Ga0081455_10011348 3300005937 Bacteria 8960
26 Ga0081455_10025662 3300005937 Bacteria 5435
27 Ga0081538_10001354 3300005981 Bacteria 25218
28 Ga0081538_10142318 3300005981 Bacteria 1103
29 Ga0081539_10000196 3300005985 Bacteria 140882
30 Ga0081539_10008546 3300005985 Bacteria 8867
31 Ga0075365_10179493 3300006038 Bacteria 1480
32 Ga0075368_10023717 3300006042 Bacteria 2346
33 Ga0075363_100000428 3300006048 Bacteria 13104
34 Ga0075363_100000984 3300006048 Bacteria 10178
35 Ga0075364_10002413 3300006051 Bacteria 10474
36 Ga0075364_10028050 3300006051 Bacteria 3601
37 Ga0075432_10000582 3300006058 Bacteria 11034
38 Ga0070715_10288497 3300006163 Bacteria 873
39 Ga0070716_100014949 3300006173 Bacteria 3983
40 Ga0070712_100327196 3300006175 Bacteria 1248
41 Ga0075367_10050439 3300006178 Bacteria 2457
42 Ga0075367_10079651 3300006178 Bacteria 1980
43 Ga0075370_10005390 3300006353 Bacteria 6354
44 Ga0075428_100104388 3300006844 Bacteria 3090
45 Ga0075428_100292698 3300006844 Bacteria 1751
46 Ga0075431_100233610 3300006847 Bacteria 1873
47 Ga0075433_10003786 3300006852 Bacteria 11716
48 Ga0075434_100001264 3300006871 Bacteria 21084
49 Ga0068865_100024459 3300006881 Bacteria 3963
50 Ga0075436_100006661 3300006914 Bacteria 7910
51 Ga0097620_100003012 3300006931 Bacteria 17078
52 Ga0099826_10193831 3300006948 Bacteria 1118
53 Ga0075435_100005724 3300007076 Bacteria 8716
54 Ga0111539_10013335 3300009094 Bacteria 10269
55 Ga0105245_10004971 3300009098 Bacteria 11693
56 Ga0105247_10051039 3300009101 Bacteria 2546
57 Ga0105243_10331132 3300009148 Bacteria 1391
58 Ga0105249_10005642 3300009553 Bacteria 10830
59 Ga0105239_10108474 3300010375 Bacteria 3076
60 Ga0163162_10018219 3300013306 Bacteria 6877
61 Ga0182008_10004118 3300014497 Bacteria 8566
62 Ga0182006_1075192 3300015261 Bacteria 1243
63 Ga0182007_10001803 3300015262 Bacteria 11169
64 Ga0182005_1039380 3300015265 Bacteria 1285
65 Ga0183367_1004 3300015688 Bacteria 716880
66 Ga0207692_10004295 3300025898 Bacteria 5634
67 Ga0207642_10018283 3300025899 Bacteria 2686
68 Ga0207710_10056822 3300025900 Bacteria 1766
69 Ga0207688_10054823 3300025901 Bacteria 2237
70 Ga0207688_10211642 3300025901 Bacteria 1165
71 Ga0207699_10008734 3300025906 Bacteria 5013
72 Ga0207693_10002299 3300025915 Bacteria 16604
73 Ga0207693_10082175 3300025915 Bacteria 2523
74 Ga0207663_10114868 3300025916 Bacteria 1833
75 Ga0207681_10461601 3300025923 Bacteria 1035
76 Ga0207664_10051618 3300025929 Bacteria 3248
77 Ga0207664_10341861 3300025929 Bacteria 1323
78 Ga0207706_10007151 3300025933 Bacteria 10323
79 Ga0207709_10105522 3300025935 Bacteria 1872
80 Ga0207669_10018392 3300025937 Bacteria 3612
81 Ga0207704_10057910 3300025938 Bacteria 2383
82 Ga0207665_10002734 3300025939 Bacteria 11832
83 Ga0207712_10006472 3300025961 Bacteria 7385
84 Ga0207668_10012931 3300025972 Bacteria 5126
85 Ga0207703_10074780 3300026035 Bacteria 2806
86 Ga0207708_10042999 3300026075 Bacteria 3443
87 Ga0207675_100033878 3300026118 Bacteria 4760
88 Ga0209813_10017384 3300027866 Bacteria 1974
89 Ga0207428_10004650 3300027907 Bacteria 13003
90 Ga0268265_10332976 3300028380 Bacteria 1379
91 Ga0307515_10278587 3300028794 Bacteria 1383
92 Ga0307511_10167661 3300030521 Bacteria 1215
93 Ga0307512_10011000 3300030522 Bacteria 8599
94 Ga0307512_10191664 3300030522 Bacteria 1126
95 Ga0314311_1212014 3300030733 Bacteria 1392
96 Ga0316181_1220579 3300030744 Bacteria 1827
97 Ga0307513_10000085 3300031456 Bacteria 131110
98 Ga0307408_100000997 3300031548 Bacteria 21854
99 Ga0307508_10271928 3300031616 Bacteria 1288
100 Ga0316576_10024487 3300031727 Bacteria 4215
101 Ga0307516_10178338 3300031730 Bacteria 1860
102 Ga0307413_10022214 3300031824 Bacteria 3415
103 Ga0307410_10022470 3300031852 Bacteria 3900
104 Ga0307410_10109094 3300031852 Bacteria 2000
105 Ga0326468_10000383 3300031889 Bacteria 4664
106 Ga0307406_10156527 3300031901 Bacteria 1632
107 Ga0307406_10257827 3300031901 Bacteria 1317
108 Ga0307407_10007038 3300031903 Bacteria 5062
109 Ga0307407_10040924 3300031903 Bacteria 2587
110 Ga0307407_10300635 3300031903 Bacteria 1119
111 Ga0307409_100000511 3300031995 Bacteria 16728
112 Ga0307409_100523775 3300031995 Bacteria 1158
113 Ga0307416_100000130 3300032002 Bacteria 45489
114 Ga0307416_100101887 3300032002 Bacteria 2502
115 Ga0307416_100199150 3300032002 Bacteria 1898
116 Ga0307416_100278478 3300032002 Bacteria 1647
117 Ga0307416_100377079 3300032002 Bacteria 1447
118 Ga0307414_10071582 3300032004 Bacteria 2501
119 Ga0307414_10761261 3300032004 Bacteria 881
120 Ga0307411_10062570 3300032005 Bacteria 2483
121 Ga0307415_100020472 3300032126 Bacteria 4040
122 Ga0307415_100197973 3300032126 Bacteria 1591
123 Ga0373934_0017616 3300035086 Bacteria 2729
124 Ga0373940_0003921 3300035088 Bacteria 3094
125 Ga0373923_0040719 3300035111 Bacteria 1913
126 Ga0373941_0016740 3300035115 Bacteria 1998
127 Ga0373954_0036610 3300035118 Bacteria 2278
128 Ga0373956_0020609 3300035119 Bacteria 2807
129 Ga0373957_0023771 3300035120 Bacteria 2194
130 Ga0373942_0000939 3300035207 Bacteria 7953
131 Ga0373924_0033696 3300035410 Bacteria 2069
132 Ga0373933_0022647 3300035724 Bacteria 3580
133 Ga0373937_0099151 3300036401 Bacteria 2702
134 Ga0395900_0205855 3300037418 Bacteria 1989
135 Ga0395898_0082891 3300037466 Bacteria 3091
136 Ga0436364_0042712 3300037853 Bacteria 1505
137 Ga0436364_1142142 3300037853 Bacteria 1089
138 Ga0395901_0036773 3300038443 Bacteria 5062
139 Ga0439436_0016862 3300041404 Bacteria 2189
140 Ga0439439_0140244 3300041406 Bacteria 682
141 Ga0451795_0676903 3300041456 Bacteria 811
142 Ga0451800_0508465 3300041459 Bacteria 1237
143 Ga0451853_0922841 3300041512 Bacteria 2948
144 Ga0451853_2631856 3300041512 Bacteria 1277
145 Ga0451853_3996526 3300041512 Bacteria 5127
146 Ga0439455_0006273 3300042012 Bacteria 2460
147 Ga0439457_004778 3300042014 Bacteria 3488
148 Ga0439457_054950 3300042014 Bacteria 897
149 Ga0439463_017093 3300042016 Bacteria 1796
150 Ga0439463_052671 3300042016 Bacteria 1038
151 Ga0450894_000535 3300042131 Bacteria 6434
152 Ga0450898_000306 3300042134 Bacteria 5523
153 Ga0450899_002036 3300042135 Bacteria 2217
154 Ga0450903_004729 3300042138 Bacteria 2306
155 Ga0450906_001479 3300042145 Bacteria 5124
156 Ga0450908_032099 3300042184 Bacteria 911
157 Ga0439435_0023858 3300042436 Bacteria 1609
158 Ga0439459_0069745 3300042438 Bacteria 811
159 Ga0450893_0041021 3300042532 Bacteria 848
160 Ga0450901_012086 3300042533 Bacteria 899
161 Ga0450901_012249 3300042533 Bacteria 894
162 Ga0466965_0037952 3300044683 Bacteria 2366
163 Ga0466964_0039089 3300044706 Bacteria 1910
164 Ga0466957_0359394 3300044842 Bacteria 989
165 Ga0466960_0267497 3300044901 Bacteria 954
166 Ga0466967_0060829 3300045976 Bacteria 3349
167 Ga0466967_0438384 3300045976 Bacteria 1275
168 Ga0495629_0146059 3300046459 Bacteria 1645
169 Ga0495629_0405274 3300046459 Bacteria 927
170 Ga0495638_0001977 3300046460 Bacteria 17520
171 Ga0495651_0022699 3300046462 Bacteria 4877
172 Ga0495653_0064662 3300046463 Bacteria 2755
173 Ga0495582_0262418 3300046473 Bacteria 991
174 Ga0495662_0100202 3300046476 Bacteria 1417
175 Ga0495664_0160537 3300046477 Bacteria 1363
176 Ga0495608_0020610 3300046511 Bacteria 4531
177 Ga0495610_0106538 3300046512 Bacteria 1248
178 Ga0495618_0040711 3300046514 Bacteria 2925
179 Ga0495628_0024876 3300046516 Bacteria 4897
180 Ga0495630_0111464 3300046517 Bacteria 2072
181 Ga0495652_0000390 3300046529 Bacteria 51932
182 Ga0495652_0094129 3300046529 Bacteria 2444
183 Ga0495586_0238738 3300046535 Bacteria 1035
184 Ga0495645_0129658 3300046543 Bacteria 1768
185 Ga0495667_0028178 3300046559 Bacteria 3781
186 Ga0495634_0010946 3300046642 Bacteria 6620
187 Ga0495635_0045744 3300046663 Bacteria 3019
188 Ga0495657_0028766 3300046675 Bacteria 3904
189 Ga0495599_0057742 3300046678 Bacteria 2428
190 Ga0495623_0058810 3300046679 Bacteria 2416
191 Ga0495623_0066087 3300046679 Bacteria 2260
192 Ga0495646_0046831 3300046680 Bacteria 2634
193 Ga0495624_0122529 3300046690 Bacteria 1596
194 Ga0495671_0293186 3300046692 Bacteria 783
195 Ga0495600_0017533 3300046809 Bacteria 4556
196 Ga0495604_0037977 3300047317 Bacteria 3789
197 Ga0495674_0082113 3300047319 Bacteria 2763
198 Ga0495680_0068749 3300047322 Bacteria 2704
199 Ga0495685_003718 3300047447 Bacteria 4884
200 Ga0495684_0025356 3300047471 Bacteria 4558
201 Ga0495602_0067407 3300048088 Bacteria 3079
202 Ga0496102_0039397 3300048905 Bacteria 4270
203 Ga0496108_0000017 3300048911 Bacteria 235428
204 Ga0496110_0088908 3300048913 Bacteria 2760
205 Ga0496114_0030191 3300048917 Bacteria 4458
206 Ga0496125_0044637 3300048928 Bacteria 3744
207 Ga0501291_005126 3300049514 Bacteria 1699
208 Ga0501300_025025 3300049523 Bacteria 875
209 Ga0501317_005685 3300049533 Bacteria 1346
210 Ga0501318_003818 3300049534 Bacteria 1407
211 Ga0501046_0270608 3300049580 Bacteria 1246
212 Ga0501047_0000092 3300049581 Bacteria 111389
213 Ga0501047_0000744 3300049581 Bacteria 33946
214 Ga0501071_0397711 3300049587 Bacteria 1052
215 Ga0501076_0530268 3300049592 Bacteria 971
216 Ga0501202_033795 3300049652 Bacteria 1078
217 Ga0501243_015833 3300049675 Bacteria 1214
218 Ga0501080_0259158 3300049742 Bacteria 1585
219 Ga0501271_010968 3300049768 Bacteria 964
220 Ga0501035_0764213 3300049822 Bacteria 774
221 Ga0501044_0067882 3300049823 Bacteria 3633
222 Ga0501045_0293096 3300049824 Bacteria 1211
223 nmdc:mga00v17_510465_c1 3300050491 Bacteria 779
224 nmdc:mga00v17_5799_c1 3300050491 Bacteria 6518
225 nmdc:mga0yw44_443502_c1 3300050492 Bacteria 879
226 nmdc:mga04h51_45781_c1 3300050495 Bacteria 1448
227 nmdc:mga04h51_56669_c1 3300050495 Bacteria 1331
228 nmdc:mga09592_422114_c1 3300050508 Bacteria 1152
229 nmdc:mga08y16_6021_c1 3300050511 Bacteria 12712
230 nmdc:mga0n895_59052_c1 3300050512 Bacteria 3785
231 nmdc:mga0rr50_12961_c1 3300050513 Bacteria 5408
232 nmdc:mga08x19_43371_c1 3300050514 Bacteria 2870
233 nmdc:mga0a205_6264_c1 3300050515 Bacteria 10741
234 Ga0495601_0000284 3300053077 Bacteria 27115
235 Ga0495612_0079765 3300053078 Bacteria 1374
236 Ga0500610_0004115 3300053079 Bacteria 5715
237 Ga0495595_0079927 3300053084 Bacteria 1556
238 Ga0495619_0373494 3300053085 Bacteria 985
239 Ga0500562_010267 3300053108 Bacteria 2372
240 Ga0500577_0051581 3300053142 Bacteria 1547
241 Ga0500616_0000131 3300053153 Bacteria 131881
242 Ga0500611_123624 3300053727 Bacteria 692
243 Ga0466962_0035290 3300061719 Bacteria 2394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10001354 Ga0081538_1000135430 192
2 3300049587 Ga0501071_0397711 Ga0501071_0397711_294_929 193
3 3300006178 Ga0075367_10050439 Ga0075367_100504393 198
4 3300045976 Ga0466967_0438384 Ga0466967_0438384_51_689 198
5 3300050491 nmdc:mga00v17_510465_c1 nmdc:mga00v17_510465_c1_123_740 198
6 3300050495 nmdc:mga04h51_45781_c1 nmdc:mga04h51_45781_c1_573_1229 198
7 3300053727 Ga0500611_123624 Ga0500611_123624_19_639 198
8 3300031548 Ga0307408_100000997 Ga0307408_10000099713 199
9 3300031824 Ga0307413_10022214 Ga0307413_100222143 199
10 3300031852 Ga0307410_10022470 Ga0307410_100224707 199
11 3300031903 Ga0307407_10007038 Ga0307407_100070389 199
12 3300031995 Ga0307409_100000511 Ga0307409_10000051117 199
13 3300032002 Ga0307416_100000130 Ga0307416_10000013030 199
14 3300032005 Ga0307411_10062570 Ga0307411_100625702 199
15 3300032126 Ga0307415_100020472 Ga0307415_1000204724 199
16 3300037853 Ga0436364_1142142 Ga0436364_1142142_43_663 201
17 3300046459 Ga0495629_0146059 Ga0495629_0146059_759_1421 202
18 3300053153 Ga0500616_0000131 Ga0500616_0000131_26194_26895 202
19 3300025901 Ga0207688_10211642 Ga0207688_102116421 204
20 3300031852 Ga0307410_10109094 Ga0307410_101090943 204
21 3300032004 Ga0307414_10761261 Ga0307414_107612611 204
22 3300041406 Ga0439439_0140244 Ga0439439_0140244_14_652 204
23 3300042014 Ga0439457_004778 Ga0439457_004778_2837_3475 204
24 3300046692 Ga0495671_0293186 Ga0495671_0293186_110_769 204
25 3300049533 Ga0501317_005685 Ga0501317_005685_239_889 204
26 3300049534 Ga0501318_003818 Ga0501318_003818_72_722 204
27 iso_pu_bacteria 2643221647 2644267364 204
28 iso_pu_bacteria 2643221714 2644630171 204
29 iso_pu_bacteria 2728369276 2729909359 204
30 iso_pu_bacteria 2758568621 2760625876 204
31 iso_pu_bacteria 2784746768 2785373464 204
32 iso_pu_bacteria 2786546132 2786666876 204
33 iso_pu_bacteria 2818991472 2819744517 204
34 iso_pu_bacteria 2877676314 2877676325 204
35 iso_pu_bacteria 2946072368 2946079425 204
36 iso_pu_bacteria 2954380949 2954389808 204
37 iso_pu_bacteria 2954673503 2954681963 204
38 iso_pu_bacteria 2954682443 2954690963 204
39 iso_pu_bacteria 2954691527 2954700911 204
40 iso_pu_bacteria 2954701450 2954706428 204
41 3300005535 Ga0070684_100300195 Ga0070684_1003001952 205
42 3300005985 Ga0081539_10008546 Ga0081539_100085463 205
43 3300006048 Ga0075363_100000428 Ga0075363_1000004282 205
44 3300006844 Ga0075428_100292698 Ga0075428_1002926982 205
45 3300028380 Ga0268265_10332976 Ga0268265_103329762 205
46 3300030522 Ga0307512_10191664 Ga0307512_101916642 205
47 3300031616 Ga0307508_10271928 Ga0307508_102719282 205
48 3300031889 Ga0326468_10000383 Ga0326468_100003836 205
49 3300031901 Ga0307406_10156527 Ga0307406_101565272 205
50 3300032002 Ga0307416_100199150 Ga0307416_1001991503 205
51 3300032126 Ga0307415_100197973 Ga0307415_1001979732 205
52 3300042016 Ga0439463_052671 Ga0439463_052671_129_767 205
53 3300046473 Ga0495582_0262418 Ga0495582_0262418_187_822 205
54 3300048911 Ga0496108_0000017 Ga0496108_0000017_103905_104534 205
55 3300049580 Ga0501046_0270608 Ga0501046_0270608_512_1153 205
56 3300003203 JGI25406J46586_10014642 JGI25406J46586_100146423 206
57 3300003911 JGI25405J52794_10012568 JGI25405J52794_100125682 206
58 3300005347 Ga0070668_100012378 Ga0070668_1000123783 206
59 3300005434 Ga0070709_10003517 Ga0070709_100035172 206
60 3300005434 Ga0070709_10663539 Ga0070709_106635391 206
61 3300005435 Ga0070714_100075518 Ga0070714_1000755182 206
62 3300005436 Ga0070713_100042123 Ga0070713_1000421235 206
63 3300005437 Ga0070710_10002430 Ga0070710_100024307 206
64 3300005437 Ga0070710_10016864 Ga0070710_100168643 206
65 3300005439 Ga0070711_100005137 Ga0070711_1000051375 206
66 3300005439 Ga0070711_100039325 Ga0070711_1000393253 206
67 3300005441 Ga0070700_100304963 Ga0070700_1003049631 206
68 3300005457 Ga0070662_100013659 Ga0070662_1000136593 206
69 3300005468 Ga0070707_100033322 Ga0070707_1000333225 206
70 3300005471 Ga0070698_100003270 Ga0070698_10000327018 206
71 3300005578 Ga0068854_100033643 Ga0068854_1000336434 206
72 3300005616 Ga0068852_101260435 Ga0068852_1012604351 206
73 3300005617 Ga0068859_100003012 Ga0068859_1000030125 206
74 3300005718 Ga0068866_10014332 Ga0068866_100143324 206
75 3300005719 Ga0068861_100011634 Ga0068861_1000116345 206
76 3300005842 Ga0068858_100093577 Ga0068858_1000935774 206
77 3300005937 Ga0081455_10001196 Ga0081455_1000119624 206
78 3300005937 Ga0081455_10009510 Ga0081455_1000951011 206
79 3300005937 Ga0081455_10011348 Ga0081455_100113485 206
80 3300005937 Ga0081455_10025662 Ga0081455_100256624 206
81 3300005981 Ga0081538_10142318 Ga0081538_101423182 206
82 3300005985 Ga0081539_10000196 Ga0081539_1000019660 206
83 3300006038 Ga0075365_10179493 Ga0075365_101794932 206
84 3300006042 Ga0075368_10023717 Ga0075368_100237173 206
85 3300006048 Ga0075363_100000984 Ga0075363_1000009843 206
86 3300006051 Ga0075364_10002413 Ga0075364_100024137 206
87 3300006051 Ga0075364_10028050 Ga0075364_100280502 206
88 3300006058 Ga0075432_10000582 Ga0075432_100005827 206
89 3300006163 Ga0070715_10288497 Ga0070715_102884971 206
90 3300006173 Ga0070716_100014949 Ga0070716_1000149492 206
91 3300006175 Ga0070712_100327196 Ga0070712_1003271961 206
92 3300006178 Ga0075367_10079651 Ga0075367_100796514 206
93 3300006353 Ga0075370_10005390 Ga0075370_100053903 206
94 3300006844 Ga0075428_100104388 Ga0075428_1001043882 206
95 3300006847 Ga0075431_100233610 Ga0075431_1002336102 206
96 3300006852 Ga0075433_10003786 Ga0075433_100037867 206
97 3300006871 Ga0075434_100001264 Ga0075434_10000126412 206
98 3300006881 Ga0068865_100024459 Ga0068865_1000244593 206
99 3300006914 Ga0075436_100006661 Ga0075436_1000066612 206
100 3300006931 Ga0097620_100003012 Ga0097620_10000301214 206
101 3300006948 Ga0099826_10193831 Ga0099826_101938312 206
102 3300007076 Ga0075435_100005724 Ga0075435_1000057248 206
103 3300009094 Ga0111539_10013335 Ga0111539_100133357 206
104 3300009098 Ga0105245_10004971 Ga0105245_100049717 206
105 3300009101 Ga0105247_10051039 Ga0105247_100510392 206
106 3300009148 Ga0105243_10331132 Ga0105243_103311322 206
107 3300009553 Ga0105249_10005642 Ga0105249_100056428 206
108 3300010375 Ga0105239_10108474 Ga0105239_101084744 206
109 3300013306 Ga0163162_10018219 Ga0163162_100182195 206
110 3300014497 Ga0182008_10004118 Ga0182008_100041188 206
111 3300015261 Ga0182006_1075192 Ga0182006_10751922 206
112 3300015262 Ga0182007_10001803 Ga0182007_100018033 206
113 3300015265 Ga0182005_1039380 Ga0182005_10393802 206
114 3300015688 Ga0183367_1004 Ga0183367_1004381 206
115 3300025898 Ga0207692_10004295 Ga0207692_100042957 206
116 3300025899 Ga0207642_10018283 Ga0207642_100182832 206
117 3300025900 Ga0207710_10056822 Ga0207710_100568222 206
118 3300025901 Ga0207688_10054823 Ga0207688_100548232 206
119 3300025906 Ga0207699_10008734 Ga0207699_100087347 206
120 3300025915 Ga0207693_10002299 Ga0207693_100022999 206
121 3300025915 Ga0207693_10082175 Ga0207693_100821752 206
122 3300025916 Ga0207663_10114868 Ga0207663_101148681 206
123 3300025923 Ga0207681_10461601 Ga0207681_104616012 206
124 3300025929 Ga0207664_10051618 Ga0207664_100516182 206
125 3300025929 Ga0207664_10341861 Ga0207664_103418612 206
126 3300025933 Ga0207706_10007151 Ga0207706_100071512 206
127 3300025935 Ga0207709_10105522 Ga0207709_101055222 206
128 3300025937 Ga0207669_10018392 Ga0207669_100183923 206
129 3300025938 Ga0207704_10057910 Ga0207704_100579103 206
130 3300025939 Ga0207665_10002734 Ga0207665_1000273412 206
131 3300025961 Ga0207712_10006472 Ga0207712_100064725 206
132 3300025972 Ga0207668_10012931 Ga0207668_100129315 206
133 3300026035 Ga0207703_10074780 Ga0207703_100747804 206
134 3300026075 Ga0207708_10042999 Ga0207708_100429991 206
135 3300026118 Ga0207675_100033878 Ga0207675_1000338784 206
136 3300027866 Ga0209813_10017384 Ga0209813_100173842 206
137 3300027907 Ga0207428_10004650 Ga0207428_100046508 206
138 3300028794 Ga0307515_10278587 Ga0307515_102785872 206
139 3300030521 Ga0307511_10167661 Ga0307511_101676611 206
140 3300030522 Ga0307512_10011000 Ga0307512_100110008 206
141 3300030733 Ga0314311_1212014 Ga0314311_12120142 206
142 3300030744 Ga0316181_1220579 Ga0316181_12205792 206
143 3300031456 Ga0307513_10000085 Ga0307513_1000008519 206
144 3300031727 Ga0316576_10024487 Ga0316576_100244876 206
145 3300031730 Ga0307516_10178338 Ga0307516_101783382 206
146 3300031901 Ga0307406_10257827 Ga0307406_102578272 206
147 3300031903 Ga0307407_10040924 Ga0307407_100409242 206
148 3300031903 Ga0307407_10300635 Ga0307407_103006352 206
149 3300031995 Ga0307409_100523775 Ga0307409_1005237751 206
150 3300032002 Ga0307416_100101887 Ga0307416_1001018872 206
151 3300032002 Ga0307416_100278478 Ga0307416_1002784782 206
152 3300032002 Ga0307416_100377079 Ga0307416_1003770792 206
153 3300032004 Ga0307414_10071582 Ga0307414_100715822 206
154 3300035086 Ga0373934_0017616 Ga0373934_0017616_104_742 206
155 3300035088 Ga0373940_0003921 Ga0373940_0003921_1033_1677 206
156 3300035111 Ga0373923_0040719 Ga0373923_0040719_56_694 206
157 3300035115 Ga0373941_0016740 Ga0373941_0016740_121_765 206
158 3300035118 Ga0373954_0036610 Ga0373954_0036610_1367_2005 206
159 3300035119 Ga0373956_0020609 Ga0373956_0020609_1998_2636 206
160 3300035120 Ga0373957_0023771 Ga0373957_0023771_1219_1857 206
161 3300035207 Ga0373942_0000939 Ga0373942_0000939_4407_5051 206
162 3300035410 Ga0373924_0033696 Ga0373924_0033696_1350_1988 206
163 3300035724 Ga0373933_0022647 Ga0373933_0022647_1619_2257 206
164 3300036401 Ga0373937_0099151 Ga0373937_0099151_692_1330 206
165 3300037418 Ga0395900_0205855 Ga0395900_0205855_685_1350 206
166 3300037466 Ga0395898_0082891 Ga0395898_0082891_2080_2745 206
167 3300037853 Ga0436364_0042712 Ga0436364_0042712_66_698 206
168 3300038443 Ga0395901_0036773 Ga0395901_0036773_3450_4115 206
169 3300041404 Ga0439436_0016862 Ga0439436_0016862_44_760 206
170 3300041456 Ga0451795_0676903 Ga0451795_0676903_111_770 206
171 3300041459 Ga0451800_0508465 Ga0451800_0508465_45_746 206
172 3300041512 Ga0451853_0922841 Ga0451853_0922841_2058_2738 206
173 3300041512 Ga0451853_2631856 Ga0451853_2631856_61_741 206
174 3300041512 Ga0451853_3996526 Ga0451853_3996526_1748_2398 206
175 3300042012 Ga0439455_0006273 Ga0439455_0006273_1311_1964 206
176 3300042014 Ga0439457_054950 Ga0439457_054950_45_725 206
177 3300042016 Ga0439463_017093 Ga0439463_017093_1101_1763 206
178 3300042131 Ga0450894_000535 Ga0450894_000535_4062_4742 206
179 3300042134 Ga0450898_000306 Ga0450898_000306_2837_3517 206
180 3300042135 Ga0450899_002036 Ga0450899_002036_262_942 206
181 3300042138 Ga0450903_004729 Ga0450903_004729_1442_2095 206
182 3300042145 Ga0450906_001479 Ga0450906_001479_1979_2659 206
183 3300042184 Ga0450908_032099 Ga0450908_032099_78_758 206
184 3300042436 Ga0439435_0023858 Ga0439435_0023858_534_1223 206
185 3300042438 Ga0439459_0069745 Ga0439459_0069745_110_772 206
186 3300042532 Ga0450893_0041021 Ga0450893_0041021_147_836 206
187 3300042533 Ga0450901_012086 Ga0450901_012086_12_653 206
188 3300042533 Ga0450901_012249 Ga0450901_012249_99_761 206
189 3300044683 Ga0466965_0037952 Ga0466965_0037952_762_1457 206
190 3300044706 Ga0466964_0039089 Ga0466964_0039089_994_1686 206
191 3300044842 Ga0466957_0359394 Ga0466957_0359394_32_724 206
192 3300044901 Ga0466960_0267497 Ga0466960_0267497_121_786 206
193 3300045976 Ga0466967_0060829 Ga0466967_0060829_597_1289 206
194 3300046459 Ga0495629_0405274 Ga0495629_0405274_104_742 206
195 3300046460 Ga0495638_0001977 Ga0495638_0001977_4828_5517 206
196 3300046462 Ga0495651_0022699 Ga0495651_0022699_1740_2378 206
197 3300046463 Ga0495653_0064662 Ga0495653_0064662_237_875 206
198 3300046476 Ga0495662_0100202 Ga0495662_0100202_149_787 206
199 3300046477 Ga0495664_0160537 Ga0495664_0160537_202_840 206
200 3300046511 Ga0495608_0020610 Ga0495608_0020610_2029_2667 206
201 3300046512 Ga0495610_0106538 Ga0495610_0106538_423_1094 206
202 3300046514 Ga0495618_0040711 Ga0495618_0040711_1750_2388 206
203 3300046516 Ga0495628_0024876 Ga0495628_0024876_4178_4816 206
204 3300046517 Ga0495630_0111464 Ga0495630_0111464_1338_1976 206
205 3300046529 Ga0495652_0000390 Ga0495652_0000390_30072_30716 206
206 3300046529 Ga0495652_0094129 Ga0495652_0094129_188_826 206
207 3300046535 Ga0495586_0238738 Ga0495586_0238738_117_755 206
208 3300046543 Ga0495645_0129658 Ga0495645_0129658_869_1507 206
209 3300046559 Ga0495667_0028178 Ga0495667_0028178_1403_2041 206
210 3300046642 Ga0495634_0010946 Ga0495634_0010946_3872_4510 206
211 3300046663 Ga0495635_0045744 Ga0495635_0045744_127_765 206
212 3300046675 Ga0495657_0028766 Ga0495657_0028766_1539_2177 206
213 3300046678 Ga0495599_0057742 Ga0495599_0057742_1353_1991 206
214 3300046679 Ga0495623_0058810 Ga0495623_0058810_691_1329 206
215 3300046679 Ga0495623_0066087 Ga0495623_0066087_1172_1816 206
216 3300046680 Ga0495646_0046831 Ga0495646_0046831_1722_2360 206
217 3300046690 Ga0495624_0122529 Ga0495624_0122529_309_947 206
218 3300046809 Ga0495600_0017533 Ga0495600_0017533_2159_2797 206
219 3300047317 Ga0495604_0037977 Ga0495604_0037977_1997_2635 206
220 3300047319 Ga0495674_0082113 Ga0495674_0082113_814_1452 206
221 3300047322 Ga0495680_0068749 Ga0495680_0068749_1229_1867 206
222 3300047447 Ga0495685_003718 Ga0495685_003718_904_1575 206
223 3300047471 Ga0495684_0025356 Ga0495684_0025356_1787_2425 206
224 3300048088 Ga0495602_0067407 Ga0495602_0067407_2108_2746 206
225 3300048905 Ga0496102_0039397 Ga0496102_0039397_2261_2953 206
226 3300048913 Ga0496110_0088908 Ga0496110_0088908_684_1394 206
227 3300048917 Ga0496114_0030191 Ga0496114_0030191_1526_2185 206
228 3300048928 Ga0496125_0044637 Ga0496125_0044637_2717_3388 206
229 3300049514 Ga0501291_005126 Ga0501291_005126_879_1541 206
230 3300049523 Ga0501300_025025 Ga0501300_025025_48_710 206
231 3300049581 Ga0501047_0000092 Ga0501047_0000092_35247_35939 206
232 3300049581 Ga0501047_0000744 Ga0501047_0000744_21735_22400 206
233 3300049592 Ga0501076_0530268 Ga0501076_0530268_268_936 206
234 3300049652 Ga0501202_033795 Ga0501202_033795_382_1044 206
235 3300049675 Ga0501243_015833 Ga0501243_015833_56_718 206
236 3300049742 Ga0501080_0259158 Ga0501080_0259158_28_693 206
237 3300049768 Ga0501271_010968 Ga0501271_010968_19_681 206
238 3300049822 Ga0501035_0764213 Ga0501035_0764213_15_707 206
239 3300049823 Ga0501044_0067882 Ga0501044_0067882_737_1429 206
240 3300049824 Ga0501045_0293096 Ga0501045_0293096_244_927 206
241 3300050491 nmdc:mga00v17_5799_c1 nmdc:mga00v17_5799_c1_4315_5001 206
242 3300050492 nmdc:mga0yw44_443502_c1 nmdc:mga0yw44_443502_c1_21_707 206
243 3300050495 nmdc:mga04h51_56669_c1 nmdc:mga04h51_56669_c1_176_838 206
244 3300050508 nmdc:mga09592_422114_c1 nmdc:mga09592_422114_c1_222_884 206
245 3300050511 nmdc:mga08y16_6021_c1 nmdc:mga08y16_6021_c1_8974_9636 206
246 3300050512 nmdc:mga0n895_59052_c1 nmdc:mga0n895_59052_c1_2654_3316 206
247 3300050513 nmdc:mga0rr50_12961_c1 nmdc:mga0rr50_12961_c1_3397_4059 206
248 3300050514 nmdc:mga08x19_43371_c1 nmdc:mga08x19_43371_c1_1765_2427 206
249 3300050515 nmdc:mga0a205_6264_c1 nmdc:mga0a205_6264_c1_5438_6100 206
250 3300053077 Ga0495601_0000284 Ga0495601_0000284_4149_4793 206
251 3300053078 Ga0495612_0079765 Ga0495612_0079765_344_988 206
252 3300053079 Ga0500610_0004115 Ga0500610_0004115_3999_4688 206
253 3300053084 Ga0495595_0079927 Ga0495595_0079927_855_1493 206
254 3300053085 Ga0495619_0373494 Ga0495619_0373494_91_729 206
255 3300053108 Ga0500562_010267 Ga0500562_010267_1518_2207 206
256 3300053142 Ga0500577_0051581 Ga0500577_0051581_502_1122 206
257 3300061719 Ga0466962_0035290 Ga0466962_0035290_52_747 206
258 iso_pu_bacteria 2582581314 2585317190 206
259 iso_pu_bacteria 2784746763 2785340303 206
260 iso_pu_bacteria 8048406513 8048410673 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

35

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ooy-assembly1.cif.gz_A succinyl-coa:3-ketoacid coa transferase from pig heart 0.837 6 204
3cdk-assembly1.cif.gz_D crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.8362 6 204
3k6m-assembly2.cif.gz_D dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.8362 6 204
6lp1-assembly1.cif.gz_B crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. 0.8333 6 206
2nrb-assembly2.cif.gz_C c28s mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.8297 6 204
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8204 6 204 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8064 6 204 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7818 6 204 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7782 6 204 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7444 6 206 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A828SP69-F1-model_v4 3-oxoacid CoA-transferase, B subunit 0.8888 106 201 GO:0008410
AF-A0A4Q5UTP2-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.884 107 204 GO:0008410
AF-A0A286E6J9-F1-model_v4 3-oxoadipate CoA-transferase, beta subunit 0.8834 2 206 GO:0008410
AF-A0A1F8VZX9-F1-model_v4 3-oxoadipate CoA-transferase 0.8833 2 206 GO:0008410
AF-W9GBV4-F1-model_v4 3-oxoadipate CoA-transferase 0.8826 2 206 GO:0008410

Feature Viewer

pLDDT pTM Quality
81.18 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map