F369579

General Info

Members Datasets Scaffolds Average Seq Length
260 204 248 170

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10181740|Ga0163161_101817401
Length 187
Sequence LSTDLLATELLVEAFGRIRETVHCALEGASTEVLTFRADPQANTIAWLVWHLTRVQDDHIAELVGGEQVWTKGDWVDRFQLPFDPGATGYGQGAADVAEVRSDAVQLAGYYDAVHTRTIDYLCTLTEPDFARIVDTAWDPPVTLAVRLVSVLSDDLQHAGQASYVRGLAERAKSEPATTEPGQDAAR

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
3 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
4 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
5 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
6 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
7 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
8 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
9 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
10 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
11 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.62
Metatranscriptomes 5.77
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 5.77
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 8.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025955 3300003203 Bacteria 2267
2 rootL2_10116812 3300003322 Bacteria 2416
3 Ga0070658_10173084 3300005327 Bacteria 1814
4 Ga0070668_100435899 3300005347 Bacteria 1124
5 Ga0070659_100500111 3300005366 Bacteria 1036
6 Ga0070714_100000018 3300005435 Bacteria 173975
7 Ga0070678_100686941 3300005456 Bacteria 921
8 Ga0070706_100077968 3300005467 Bacteria 3067
9 Ga0070698_100000045 3300005471 Bacteria 87520
10 Ga0070684_100867237 3300005535 Bacteria 845
11 Ga0070672_100326583 3300005543 Bacteria 1305
12 Ga0070693_100033605 3300005547 Bacteria 2832
13 Ga0068857_101024813 3300005577 Bacteria 795
14 Ga0068854_100508854 3300005578 Bacteria 1015
15 Ga0070702_100023951 3300005615 Bacteria 3250
16 Ga0070702_100290789 3300005615 Bacteria 1126
17 Ga0068859_100000175 3300005617 Bacteria 62621
18 Ga0068851_10257560 3300005834 Bacteria 991
19 Ga0081455_10030718 3300005937 Bacteria 4875
20 Ga0081455_10086448 3300005937 Bacteria 2554
21 Ga0081538_10000177 3300005981 Bacteria 69143
22 Ga0081539_10044264 3300005985 Bacteria 2571
23 Ga0070717_10048329 3300006028 Bacteria 3489
24 Ga0075365_10297908 3300006038 Bacteria 1135
25 Ga0070712_100726125 3300006175 Bacteria 849
26 Ga0075428_100378679 3300006844 Bacteria 1517
27 Ga0075430_100107312 3300006846 Bacteria 2329
28 Ga0075431_100000655 3300006847 Bacteria 29411
29 Ga0075431_100131016 3300006847 Bacteria 2586
30 Ga0075431_100403644 3300006847 Bacteria 1367
31 Ga0075429_100511851 3300006880 Bacteria 1052
32 Ga0075429_100753942 3300006880 Bacteria 853
33 Ga0068865_100088860 3300006881 Bacteria 2236
34 Ga0105240_10015090 3300009093 Bacteria 10516
35 Ga0105240_10040744 3300009093 Bacteria 5937
36 Ga0105240_10092903 3300009093 Bacteria 3683
37 Ga0111539_10701535 3300009094 Bacteria 1178
38 Ga0105245_11242451 3300009098 Bacteria 793
39 Ga0114129_10134119 3300009147 Bacteria 3399
40 Ga0114129_11663995 3300009147 Bacteria 780
41 Ga0114129_12079293 3300009147 Bacteria 685
42 Ga0105243_10029656 3300009148 Bacteria 4208
43 Ga0105242_10038615 3300009176 Bacteria 3840
44 Ga0105242_11138059 3300009176 Bacteria 796
45 Ga0105237_10329706 3300009545 Bacteria 1530
46 Ga0105238_10085913 3300009551 Bacteria 3134
47 Ga0105238_10431882 3300009551 Bacteria 1313
48 Ga0105249_10074469 3300009553 Bacteria 3143
49 Ga0105246_11771994 3300011119 Bacteria 589
50 Ga0157370_10729910 3300013104 Bacteria 903
51 Ga0157378_10007405 3300013297 Bacteria 9587
52 Ga0163162_10086547 3300013306 Bacteria 3212
53 Ga0157372_10000031 3300013307 Bacteria 178827
54 Ga0157372_10348075 3300013307 Bacteria 1726
55 Ga0157372_10355109 3300013307 Bacteria 1708
56 Ga0157372_10429921 3300013307 Bacteria 1539
57 Ga0157375_10115304 3300013308 Bacteria 2789
58 Ga0157375_11175831 3300013308 Bacteria 899
59 Ga0163163_10202813 3300014325 Bacteria 2032
60 Ga0163163_10289551 3300014325 Bacteria 1690
61 Ga0157380_10026671 3300014326 Bacteria 4388
62 Ga0157380_10069087 3300014326 Bacteria 2849
63 Ga0163161_10172472 3300017792 Bacteria 1655
64 Ga0163161_10181740 3300017792 Bacteria 1613
65 Ga0163161_11117472 3300017792 Bacteria 678
66 Ga0206356_10938220 3300020070 Bacteria 838
67 Ga0206350_11616269 3300020080 Bacteria 621
68 Ga0206353_11219711 3300020082 Bacteria 796
69 Ga0213876_10043023 3300021384 Bacteria 2387
70 Ga0213875_10088915 3300021388 Bacteria 1441
71 Ga0224712_10007939 3300022467 Bacteria 3113
72 Ga0207705_10398895 3300025909 Bacteria 1064
73 Ga0207684_10018431 3300025910 Bacteria 5977
74 Ga0207707_10964359 3300025912 Bacteria 702
75 Ga0207695_10045558 3300025913 Bacteria 4654
76 Ga0207695_10047890 3300025913 Bacteria 4519
77 Ga0207695_10075186 3300025913 Bacteria 3437
78 Ga0207693_10496513 3300025915 Bacteria 953
79 Ga0207681_10795876 3300025923 Bacteria 790
80 Ga0207694_10096262 3300025924 Bacteria 2341
81 Ga0207650_10816966 3300025925 Bacteria 790
82 Ga0207664_10000003 3300025929 Bacteria 510966
83 Ga0207664_10066494 3300025929 Bacteria 2890
84 Ga0207690_10022852 3300025932 Bacteria 3895
85 Ga0207709_10063017 3300025935 Bacteria 2323
86 Ga0207704_10201324 3300025938 Bacteria 1457
87 Ga0207691_10157743 3300025940 Bacteria 1992
88 Ga0207689_11326944 3300025942 Bacteria 604
89 Ga0207661_10395227 3300025944 Bacteria 1253
90 Ga0207668_10105819 3300025972 Bacteria 2101
91 Ga0207668_10518335 3300025972 Bacteria 1028
92 Ga0207678_10929497 3300026067 Bacteria 769
93 Ga0207648_10841125 3300026089 Bacteria 856
94 Ga0207683_10104832 3300026121 Bacteria 2527
95 Ga0207683_10147421 3300026121 Bacteria 2123
96 Ga0207683_11079607 3300026121 Bacteria 745
97 Ga0265338_10008794 3300028800 Bacteria 12193
98 Ga0265338_10074709 3300028800 Bacteria 2881
99 Ga0265327_10024104 3300031251 Bacteria 3584
100 Ga0307513_10022699 3300031456 Bacteria 7364
101 Ga0307513_10494421 3300031456 Bacteria 941
102 Ga0307407_10652044 3300031903 Bacteria 789
103 Ga0307409_100747197 3300031995 Bacteria 982
104 Ga0307414_10434458 3300032004 Bacteria 1148
105 Ga0373923_0110423 3300035111 Bacteria 1220
106 Ga0373936_0008608 3300035113 Bacteria 3842
107 Ga0373945_0350628 3300035116 Bacteria 640
108 Ga0373954_0068753 3300035118 Bacteria 1680
109 Ga0373956_0094818 3300035119 Bacteria 1379
110 Ga0373957_0019524 3300035120 Bacteria 2385
111 Ga0373943_0383046 3300035170 Bacteria 810
112 Ga0373946_0299753 3300035171 Bacteria 794
113 Ga0373955_0121735 3300035172 Bacteria 1517
114 Ga0373962_0014071 3300035242 Bacteria 2034
115 Ga0373924_0008519 3300035410 Bacteria 3730
116 Ga0373935_0013253 3300035692 Bacteria 4972
117 Ga0373935_0074525 3300035692 Bacteria 2194
118 Ga0373935_0120579 3300035692 Bacteria 1752
119 Ga0373933_0093687 3300035724 Bacteria 1856
120 Ga0373933_0221311 3300035724 Bacteria 1214
121 Ga0373947_0087644 3300035725 Bacteria 1936
122 Ga0373937_0113852 3300036401 Bacteria 2517
123 Ga0373925_0071496 3300037068 Bacteria 2624
124 Ga0373925_0209340 3300037068 Bacteria 1553
125 Ga0373925_1073273 3300037068 Bacteria 663
126 Ga0436364_0322466 3300037853 Bacteria 2826
127 Ga0395901_0171355 3300038443 Unclassified 2277
128 Ga0436365_0937182 3300039437 Bacteria 3677
129 Ga0451793_1582834 3300041452 Bacteria 777
130 Ga0451797_1293871 3300041453 Bacteria 717
131 Ga0451833_1043558 3300041491 Bacteria 2110
132 Ga0451837_1089547 3300041494 Bacteria 627
133 Ga0451853_0399390 3300041512 Bacteria 2488
134 Ga0451853_1393791 3300041512 Bacteria 1223
135 Ga0451853_3013677 3300041512 Bacteria 838
136 Ga0451853_3155013 3300041512 Bacteria 577
137 Ga0451853_4079215 3300041512 Bacteria 721
138 Ga0439456_026985 3300042013 Bacteria 1223
139 Ga0466972_0026413 3300044658 Bacteria 2878
140 Ga0466965_0004142 3300044683 Bacteria 6447
141 Ga0466961_0611065 3300044693 Bacteria 655
142 Ga0466963_0053037 3300044694 Bacteria 2692
143 Ga0466971_0024153 3300044719 Bacteria 2711
144 Ga0466971_0077163 3300044719 Bacteria 1516
145 Ga0466957_0038870 3300044842 Bacteria 2869
146 Ga0466960_0005662 3300044901 Bacteria 4959
147 Ga0466960_0006514 3300044901 Bacteria 4686
148 Ga0466960_0076598 3300044901 Bacteria 1675
149 Ga0466958_0312712 3300045836 Bacteria 1009
150 Ga0466958_0481103 3300045836 Bacteria 805
151 Ga0466958_0488065 3300045836 Bacteria 799
152 Ga0466967_0036877 3300045976 Bacteria 4178
153 Ga0466967_0058934 3300045976 Bacteria 3396
154 Ga0466967_0669219 3300045976 Bacteria 1027
155 Ga0466967_0748925 3300045976 Bacteria 969
156 Ga0495629_0059888 3300046459 Bacteria 2661
157 Ga0495641_0049369 3300046461 Bacteria 1926
158 Ga0495651_0022264 3300046462 Bacteria 4925
159 Ga0495582_0174432 3300046473 Bacteria 1224
160 Ga0495639_0029073 3300046475 Bacteria 2452
161 Ga0495664_0334436 3300046477 Bacteria 913
162 Ga0495608_0198066 3300046511 Bacteria 1266
163 Ga0495608_0258780 3300046511 Bacteria 1084
164 Ga0495618_0021256 3300046514 Bacteria 3999
165 Ga0495648_0127526 3300046524 Bacteria 1357
166 Ga0495665_0015782 3300046531 Bacteria 4067
167 Ga0495640_0084969 3300046533 Bacteria 2097
168 Ga0495586_0042571 3300046535 Bacteria 2445
169 Ga0495587_0062670 3300046536 Bacteria 2176
170 Ga0495645_0018434 3300046543 Bacteria 5011
171 Ga0495667_0236344 3300046559 Bacteria 1164
172 Ga0495634_0023623 3300046642 Bacteria 4318
173 Ga0495635_0258282 3300046663 Bacteria 1173
174 Ga0495657_0057075 3300046675 Bacteria 2597
175 Ga0495599_0226091 3300046678 Bacteria 1143
176 Ga0495623_0022597 3300046679 Bacteria 4061
177 Ga0495613_0156612 3300046689 Bacteria 1622
178 Ga0495624_0003859 3300046690 Bacteria 11063
179 Ga0495600_0073252 3300046809 Bacteria 2236
180 Ga0495581_0013242 3300047315 Bacteria 4783
181 Ga0495672_0481240 3300047320 Bacteria 555
182 Ga0495676_0551350 3300047321 Bacteria 753
183 Ga0495675_0018977 3300047444 Bacteria 4367
184 Ga0495684_0068259 3300047471 Bacteria 2703
185 Ga0495684_0648994 3300047471 Bacteria 706
186 Ga0495593_0013583 3300047673 Bacteria 4642
187 Ga0495614_0094274 3300048089 Bacteria 1304
188 Ga0496100_0149471 3300048903 Bacteria 1664
189 Ga0496101_0155245 3300048904 Bacteria 1753
190 Ga0496102_0008346 3300048905 Bacteria 8871
191 Ga0496103_0009527 3300048906 Bacteria 5750
192 Ga0496103_0097208 3300048906 Bacteria 1861
193 Ga0496105_0920859 3300048908 Bacteria 658
194 Ga0496107_0033761 3300048910 Bacteria 3662
195 Ga0496109_0040507 3300048912 Bacteria 4220
196 Ga0496109_0369227 3300048912 Bacteria 1355
197 Ga0496110_0046054 3300048913 Bacteria 3814
198 Ga0496110_0229492 3300048913 Bacteria 1688
199 Ga0496111_1043434 3300048914 Bacteria 584
200 Ga0496113_0059363 3300048916 Bacteria 2881
201 Ga0496126_0000208 3300048929 Bacteria 131604
202 Ga0501033_1021734 3300049570 Bacteria 552
203 Ga0501037_0247449 3300049573 Bacteria 1248
204 Ga0501042_0208920 3300049578 Bacteria 1408
205 Ga0501046_0092082 3300049580 Bacteria 2331
206 Ga0501047_0295222 3300049581 Bacteria 1464
207 Ga0501067_0070393 3300049583 Bacteria 1937
208 Ga0501068_0085591 3300049584 Bacteria 1940
209 Ga0501068_1008244 3300049584 Bacteria 549
210 Ga0501069_0011883 3300049585 Bacteria 4618
211 Ga0501069_0101725 3300049585 Bacteria 1631
212 Ga0501070_0001118 3300049586 Bacteria 24088
213 Ga0501071_0004899 3300049587 Bacteria 8537
214 Ga0501072_0535510 3300049588 Bacteria 925
215 Ga0501073_0053288 3300049589 Bacteria 2832
216 Ga0501074_0041909 3300049590 Bacteria 3313
217 Ga0501079_0002331 3300049741 Bacteria 13760
218 Ga0501080_0141773 3300049742 Bacteria 2221
219 Ga0501083_0000611 3300049744 Bacteria 22984
220 Ga0501035_0508399 3300049822 Bacteria 991
221 Ga0501044_0017584 3300049823 Bacteria 7669
222 nmdc:mga05p37_1456693_c1 3300050507 Bacteria 685
223 nmdc:mga05p37_1896151_c1 3300050507 Bacteria 569
224 nmdc:mga09592_1417063_c1 3300050508 Bacteria 568
225 nmdc:mga09592_445233_c1 3300050508 Bacteria 1118
226 nmdc:mga0qj67_400486_c1 3300050509 Bacteria 1108
227 nmdc:mga06r32_206972_c1 3300050510 Bacteria 1950
228 nmdc:mga06r32_49003_c1 3300050510 Bacteria 4040
229 nmdc:mga06r32_828_c1 3300050510 Bacteria 27433
230 nmdc:mga08y16_525742_c1 3300050511 Bacteria 1199
231 Ga0495601_0011532 3300053077 Bacteria 5293
232 Ga0495612_0037860 3300053078 Bacteria 1959
233 Ga0495595_0008702 3300053084 Bacteria 4177
234 Ga0495619_0017073 3300053085 Bacteria 4601
235 Ga0500616_0004130 3300053153 Bacteria 10512
236 Ga0501084_0000035 3300054114 Bacteria 112926
237 Ga0587066_059315 3300059490 Bacteria 776
238 Ga0587073_0112815 3300059492 Bacteria 723
239 Ga0587083_0124016 3300059505 Bacteria 671
240 Ga0587088_102584 3300059508 Bacteria 641
241 Ga0587092_052543 3300059512 Bacteria 742
242 Ga0587067_087719 3300059640 Bacteria 700
243 Ga0587068_114114 3300059641 Bacteria 580
244 Ga0587069_053844 3300059642 Bacteria 724
245 Ga0587069_069812 3300059642 Bacteria 665
246 Ga0587075_073590 3300059644 Bacteria 639
247 Ga0587110_028425 3300059654 Bacteria 671
248 Ga0466962_0416905 3300061719 Bacteria 673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047673 Ga0495593_0013583 Ga0495593_0013583_4188_4631 144
2 3300014326 Ga0157380_10026671 Ga0157380_100266712 145
3 3300046477 Ga0495664_0334436 Ga0495664_0334436_26_472 145
4 3300046511 Ga0495608_0258780 Ga0495608_0258780_597_1043 145
5 3300017792 Ga0163161_10172472 Ga0163161_101724722 152
6 3300049570 Ga0501033_1021734 Ga0501033_1021734_65_541 153
7 3300028800 Ga0265338_10008794 Ga0265338_100087948 155
8 3300011119 Ga0105246_11771994 Ga0105246_117719941 159
9 3300042013 Ga0439456_026985 Ga0439456_026985_42_548 159
10 3300048929 Ga0496126_0000208 Ga0496126_0000208_112555_113049 159
11 iso_pu_bacteria 2751185782 2753262893 161
12 iso_pu_bacteria 2799112218 2799184185 161
13 iso_pu_bacteria 2862993130 2862993413 161
14 iso_pu_bacteria 2964326757 2964327536 161
15 iso_pu_bacteria 2974315732 2974316276 161
16 iso_pu_bacteria 2984523437 2984524436 161
17 iso_pu_bacteria 2837268691 2837271325 162
18 iso_pu_bacteria 2773857762 2774394163 163
19 iso_pu_bacteria 2808606439 2809194977 163
20 iso_pu_bacteria 2811994878 2812349880 163
21 iso_pu_bacteria 2891968417 2891972542 163
22 3300028800 Ga0265338_10074709 Ga0265338_100747093 164
23 3300031251 Ga0265327_10024104 Ga0265327_100241043 164
24 3300045976 Ga0466967_0748925 Ga0466967_0748925_331_831 164
25 3300048905 Ga0496102_0008346 Ga0496102_0008346_6809_7315 164
26 3300048906 Ga0496103_0097208 Ga0496103_0097208_674_1180 164
27 3300049585 Ga0501069_0101725 Ga0501069_0101725_334_834 164
28 3300049586 Ga0501070_0001118 Ga0501070_0001118_9785_10285 164
29 3300049587 Ga0501071_0004899 Ga0501071_0004899_6976_7476 164
30 3300049589 Ga0501073_0053288 Ga0501073_0053288_1321_1821 164
31 3300049590 Ga0501074_0041909 Ga0501074_0041909_2130_2630 164
32 3300049741 Ga0501079_0002331 Ga0501079_0002331_156_656 164
33 3300049742 Ga0501080_0141773 Ga0501080_0141773_15_515 164
34 3300049744 Ga0501083_0000611 Ga0501083_0000611_4953_5453 164
35 3300054114 Ga0501084_0000035 Ga0501084_0000035_15723_16223 164
36 3300005347 Ga0070668_100435899 Ga0070668_1004358991 165
37 3300005366 Ga0070659_100500111 Ga0070659_1005001111 165
38 3300005456 Ga0070678_100686941 Ga0070678_1006869412 165
39 3300005467 Ga0070706_100077968 Ga0070706_1000779682 165
40 3300005471 Ga0070698_100000045 Ga0070698_10000004570 165
41 3300005535 Ga0070684_100867237 Ga0070684_1008672372 165
42 3300005543 Ga0070672_100326583 Ga0070672_1003265832 165
43 3300005547 Ga0070693_100033605 Ga0070693_1000336052 165
44 3300005578 Ga0068854_100508854 Ga0068854_1005088542 165
45 3300005615 Ga0070702_100023951 Ga0070702_1000239514 165
46 3300005615 Ga0070702_100290789 Ga0070702_1002907892 165
47 3300005834 Ga0068851_10257560 Ga0068851_102575602 165
48 3300005985 Ga0081539_10044264 Ga0081539_100442642 165
49 3300006028 Ga0070717_10048329 Ga0070717_100483292 165
50 3300006038 Ga0075365_10297908 Ga0075365_102979082 165
51 3300006881 Ga0068865_100088860 Ga0068865_1000888602 165
52 3300009093 Ga0105240_10015090 Ga0105240_100150907 165
53 3300009093 Ga0105240_10040744 Ga0105240_100407442 165
54 3300009094 Ga0111539_10701535 Ga0111539_107015352 165
55 3300009098 Ga0105245_11242451 Ga0105245_112424511 165
56 3300009147 Ga0114129_11663995 Ga0114129_116639951 165
57 3300009147 Ga0114129_12079293 Ga0114129_120792931 165
58 3300009148 Ga0105243_10029656 Ga0105243_100296563 165
59 3300009176 Ga0105242_10038615 Ga0105242_100386153 165
60 3300009176 Ga0105242_11138059 Ga0105242_111380591 165
61 3300009545 Ga0105237_10329706 Ga0105237_103297064 165
62 3300009551 Ga0105238_10085913 Ga0105238_100859132 165
63 3300009553 Ga0105249_10074469 Ga0105249_100744692 165
64 3300013104 Ga0157370_10729910 Ga0157370_107299102 165
65 3300013297 Ga0157378_10007405 Ga0157378_100074052 165
66 3300013306 Ga0163162_10086547 Ga0163162_100865472 165
67 3300013307 Ga0157372_10348075 Ga0157372_103480752 165
68 3300013307 Ga0157372_10355109 Ga0157372_103551092 165
69 3300013307 Ga0157372_10429921 Ga0157372_104299212 165
70 3300013308 Ga0157375_10115304 Ga0157375_101153042 165
71 3300013308 Ga0157375_11175831 Ga0157375_111758312 165
72 3300014325 Ga0163163_10202813 Ga0163163_102028132 165
73 3300014325 Ga0163163_10289551 Ga0163163_102895512 165
74 3300014326 Ga0157380_10069087 Ga0157380_100690874 165
75 3300017792 Ga0163161_10181740 Ga0163161_101817401 165
76 3300017792 Ga0163161_11117472 Ga0163161_111174721 165
77 3300020070 Ga0206356_10938220 Ga0206356_109382202 165
78 3300020080 Ga0206350_11616269 Ga0206350_116162691 165
79 3300020082 Ga0206353_11219711 Ga0206353_112197112 165
80 3300021384 Ga0213876_10043023 Ga0213876_100430234 165
81 3300021388 Ga0213875_10088915 Ga0213875_100889152 165
82 3300022467 Ga0224712_10007939 Ga0224712_100079392 165
83 3300025910 Ga0207684_10018431 Ga0207684_100184314 165
84 3300025912 Ga0207707_10964359 Ga0207707_109643591 165
85 3300025913 Ga0207695_10045558 Ga0207695_100455584 165
86 3300025913 Ga0207695_10047890 Ga0207695_100478902 165
87 3300025923 Ga0207681_10795876 Ga0207681_107958761 165
88 3300025925 Ga0207650_10816966 Ga0207650_108169661 165
89 3300025929 Ga0207664_10066494 Ga0207664_100664943 165
90 3300025932 Ga0207690_10022852 Ga0207690_100228525 165
91 3300025935 Ga0207709_10063017 Ga0207709_100630172 165
92 3300025938 Ga0207704_10201324 Ga0207704_102013242 165
93 3300025940 Ga0207691_10157743 Ga0207691_101577433 165
94 3300025942 Ga0207689_11326944 Ga0207689_113269441 165
95 3300025944 Ga0207661_10395227 Ga0207661_103952272 165
96 3300025972 Ga0207668_10105819 Ga0207668_101058192 165
97 3300026067 Ga0207678_10929497 Ga0207678_109294972 165
98 3300026089 Ga0207648_10841125 Ga0207648_108411251 165
99 3300026121 Ga0207683_10104832 Ga0207683_101048322 165
100 3300026121 Ga0207683_10147421 Ga0207683_101474212 165
101 3300026121 Ga0207683_11079607 Ga0207683_110796071 165
102 3300037853 Ga0436364_0322466 Ga0436364_0322466_1315_1833 165
103 3300038443 Ga0395901_0171355 Ga0395901_0171355_1627_2130 165
104 3300039437 Ga0436365_0937182 Ga0436365_0937182_554_1069 165
105 3300041452 Ga0451793_1582834 Ga0451793_1582834_183_689 165
106 3300041453 Ga0451797_1293871 Ga0451797_1293871_48_557 165
107 3300041512 Ga0451853_1393791 Ga0451853_1393791_524_1069 165
108 3300041512 Ga0451853_3013677 Ga0451853_3013677_51_563 165
109 3300041512 Ga0451853_3155013 Ga0451853_3155013_21_530 165
110 3300041512 Ga0451853_4079215 Ga0451853_4079215_46_555 165
111 3300044658 Ga0466972_0026413 Ga0466972_0026413_65_580 165
112 3300044683 Ga0466965_0004142 Ga0466965_0004142_4182_4697 165
113 3300044694 Ga0466963_0053037 Ga0466963_0053037_1172_1687 165
114 3300044719 Ga0466971_0077163 Ga0466971_0077163_969_1484 165
115 3300044842 Ga0466957_0038870 Ga0466957_0038870_2007_2522 165
116 3300044901 Ga0466960_0005662 Ga0466960_0005662_4294_4806 165
117 3300044901 Ga0466960_0006514 Ga0466960_0006514_2748_3245 165
118 3300044901 Ga0466960_0076598 Ga0466960_0076598_432_947 165
119 3300045836 Ga0466958_0481103 Ga0466958_0481103_136_657 165
120 3300045976 Ga0466967_0036877 Ga0466967_0036877_263_775 165
121 3300045976 Ga0466967_0058934 Ga0466967_0058934_71_586 165
122 3300048903 Ga0496100_0149471 Ga0496100_0149471_852_1379 165
123 3300048904 Ga0496101_0155245 Ga0496101_0155245_83_610 165
124 3300048906 Ga0496103_0009527 Ga0496103_0009527_4059_4586 165
125 3300048908 Ga0496105_0920859 Ga0496105_0920859_94_621 165
126 3300048910 Ga0496107_0033761 Ga0496107_0033761_945_1472 165
127 3300048912 Ga0496109_0369227 Ga0496109_0369227_577_1104 165
128 3300048913 Ga0496110_0046054 Ga0496110_0046054_1879_2406 165
129 3300048913 Ga0496110_0229492 Ga0496110_0229492_655_1173 165
130 3300048914 Ga0496111_1043434 Ga0496111_1043434_46_573 165
131 3300049573 Ga0501037_0247449 Ga0501037_0247449_175_687 165
132 3300049580 Ga0501046_0092082 Ga0501046_0092082_1757_2269 165
133 3300049581 Ga0501047_0295222 Ga0501047_0295222_506_1018 165
134 3300049583 Ga0501067_0070393 Ga0501067_0070393_732_1247 165
135 3300049584 Ga0501068_0085591 Ga0501068_0085591_133_642 165
136 3300049584 Ga0501068_1008244 Ga0501068_1008244_12_539 165
137 3300049585 Ga0501069_0011883 Ga0501069_0011883_381_890 165
138 3300049822 Ga0501035_0508399 Ga0501035_0508399_176_688 165
139 3300049823 Ga0501044_0017584 Ga0501044_0017584_6036_6548 165
140 3300050507 nmdc:mga05p37_1456693_c1 nmdc:mga05p37_1456693_c1_74_580 165
141 3300050507 nmdc:mga05p37_1896151_c1 nmdc:mga05p37_1896151_c1_33_542 165
142 3300050511 nmdc:mga08y16_525742_c1 nmdc:mga08y16_525742_c1_97_624 165
143 3300061719 Ga0466962_0416905 Ga0466962_0416905_100_615 165
144 iso_pu_bacteria 8047710418 8047716429 165
145 3300003203 JGI25406J46586_10025955 JGI25406J46586_100259553 166
146 3300003322 rootL2_10116812 rootL2_101168123 166
147 3300005327 Ga0070658_10173084 Ga0070658_101730842 166
148 3300005435 Ga0070714_100000018 Ga0070714_10000001829 166
149 3300005577 Ga0068857_101024813 Ga0068857_1010248131 166
150 3300005617 Ga0068859_100000175 Ga0068859_10000017527 166
151 3300005937 Ga0081455_10030718 Ga0081455_100307181 166
152 3300005937 Ga0081455_10086448 Ga0081455_100864482 166
153 3300005981 Ga0081538_10000177 Ga0081538_1000017759 166
154 3300006175 Ga0070712_100726125 Ga0070712_1007261252 166
155 3300006844 Ga0075428_100378679 Ga0075428_1003786792 166
156 3300006846 Ga0075430_100107312 Ga0075430_1001073122 166
157 3300006847 Ga0075431_100000655 Ga0075431_1000006556 166
158 3300006847 Ga0075431_100131016 Ga0075431_1001310162 166
159 3300006847 Ga0075431_100403644 Ga0075431_1004036442 166
160 3300006880 Ga0075429_100511851 Ga0075429_1005118512 166
161 3300006880 Ga0075429_100753942 Ga0075429_1007539421 166
162 3300009093 Ga0105240_10092903 Ga0105240_100929032 166
163 3300009147 Ga0114129_10134119 Ga0114129_101341193 166
164 3300009551 Ga0105238_10431882 Ga0105238_104318822 166
165 3300013307 Ga0157372_10000031 Ga0157372_1000003125 166
166 3300025909 Ga0207705_10398895 Ga0207705_103988951 166
167 3300025913 Ga0207695_10075186 Ga0207695_100751861 166
168 3300025915 Ga0207693_10496513 Ga0207693_104965132 166
169 3300025924 Ga0207694_10096262 Ga0207694_100962622 166
170 3300025929 Ga0207664_10000003 Ga0207664_10000003427 166
171 3300025972 Ga0207668_10518335 Ga0207668_105183352 166
172 3300031456 Ga0307513_10022699 Ga0307513_100226997 166
173 3300031456 Ga0307513_10494421 Ga0307513_104944211 166
174 3300031903 Ga0307407_10652044 Ga0307407_106520442 166
175 3300031995 Ga0307409_100747197 Ga0307409_1007471972 166
176 3300032004 Ga0307414_10434458 Ga0307414_104344582 166
177 3300035111 Ga0373923_0110423 Ga0373923_0110423_154_690 166
178 3300035113 Ga0373936_0008608 Ga0373936_0008608_1914_2450 166
179 3300035116 Ga0373945_0350628 Ga0373945_0350628_40_549 166
180 3300035118 Ga0373954_0068753 Ga0373954_0068753_614_1150 166
181 3300035119 Ga0373956_0094818 Ga0373956_0094818_690_1226 166
182 3300035120 Ga0373957_0019524 Ga0373957_0019524_715_1251 166
183 3300035170 Ga0373943_0383046 Ga0373943_0383046_219_728 166
184 3300035171 Ga0373946_0299753 Ga0373946_0299753_204_713 166
185 3300035172 Ga0373955_0121735 Ga0373955_0121735_817_1353 166
186 3300035242 Ga0373962_0014071 Ga0373962_0014071_609_1322 166
187 3300035410 Ga0373924_0008519 Ga0373924_0008519_40_549 166
188 3300035692 Ga0373935_0013253 Ga0373935_0013253_2932_3441 166
189 3300035692 Ga0373935_0074525 Ga0373935_0074525_905_1405 166
190 3300035692 Ga0373935_0120579 Ga0373935_0120579_339_848 166
191 3300035724 Ga0373933_0093687 Ga0373933_0093687_127_636 166
192 3300035724 Ga0373933_0221311 Ga0373933_0221311_655_1191 166
193 3300035725 Ga0373947_0087644 Ga0373947_0087644_992_1528 166
194 3300036401 Ga0373937_0113852 Ga0373937_0113852_209_745 166
195 3300037068 Ga0373925_0071496 Ga0373925_0071496_1513_2049 166
196 3300037068 Ga0373925_0209340 Ga0373925_0209340_403_912 166
197 3300037068 Ga0373925_1073273 Ga0373925_1073273_97_609 166
198 3300041491 Ga0451833_1043558 Ga0451833_1043558_206_715 166
199 3300041494 Ga0451837_1089547 Ga0451837_1089547_57_572 166
200 3300041512 Ga0451853_0399390 Ga0451853_0399390_494_997 166
201 3300044693 Ga0466961_0611065 Ga0466961_0611065_66_587 166
202 3300044719 Ga0466971_0024153 Ga0466971_0024153_1025_1540 166
203 3300045836 Ga0466958_0312712 Ga0466958_0312712_186_695 166
204 3300045836 Ga0466958_0488065 Ga0466958_0488065_267_779 166
205 3300045976 Ga0466967_0669219 Ga0466967_0669219_319_834 166
206 3300046459 Ga0495629_0059888 Ga0495629_0059888_658_1167 166
207 3300046461 Ga0495641_0049369 Ga0495641_0049369_1160_1696 166
208 3300046462 Ga0495651_0022264 Ga0495651_0022264_4400_4909 166
209 3300046473 Ga0495582_0174432 Ga0495582_0174432_185_694 166
210 3300046475 Ga0495639_0029073 Ga0495639_0029073_559_1068 166
211 3300046511 Ga0495608_0198066 Ga0495608_0198066_227_736 166
212 3300046514 Ga0495618_0021256 Ga0495618_0021256_320_829 166
213 3300046524 Ga0495648_0127526 Ga0495648_0127526_141_665 166
214 3300046531 Ga0495665_0015782 Ga0495665_0015782_3240_3749 166
215 3300046533 Ga0495640_0084969 Ga0495640_0084969_716_1225 166
216 3300046535 Ga0495586_0042571 Ga0495586_0042571_1756_2265 166
217 3300046536 Ga0495587_0062670 Ga0495587_0062670_292_828 166
218 3300046543 Ga0495645_0018434 Ga0495645_0018434_1380_1916 166
219 3300046559 Ga0495667_0236344 Ga0495667_0236344_125_634 166
220 3300046642 Ga0495634_0023623 Ga0495634_0023623_1933_2442 166
221 3300046663 Ga0495635_0258282 Ga0495635_0258282_107_643 166
222 3300046675 Ga0495657_0057075 Ga0495657_0057075_531_1067 166
223 3300046678 Ga0495599_0226091 Ga0495599_0226091_531_1067 166
224 3300046679 Ga0495623_0022597 Ga0495623_0022597_1589_2125 166
225 3300046689 Ga0495613_0156612 Ga0495613_0156612_602_1138 166
226 3300046690 Ga0495624_0003859 Ga0495624_0003859_9035_9544 166
227 3300046809 Ga0495600_0073252 Ga0495600_0073252_112_648 166
228 3300047315 Ga0495581_0013242 Ga0495581_0013242_4235_4744 166
229 3300047320 Ga0495672_0481240 Ga0495672_0481240_17_526 166
230 3300047321 Ga0495676_0551350 Ga0495676_0551350_157_666 166
231 3300047444 Ga0495675_0018977 Ga0495675_0018977_1605_2141 166
232 3300047471 Ga0495684_0068259 Ga0495684_0068259_2014_2550 166
233 3300047471 Ga0495684_0648994 Ga0495684_0648994_97_606 166
234 3300048089 Ga0495614_0094274 Ga0495614_0094274_158_694 166
235 3300048912 Ga0496109_0040507 Ga0496109_0040507_49_564 166
236 3300048916 Ga0496113_0059363 Ga0496113_0059363_104_619 166
237 3300049578 Ga0501042_0208920 Ga0501042_0208920_482_997 166
238 3300049588 Ga0501072_0535510 Ga0501072_0535510_129_644 166
239 3300050508 nmdc:mga09592_1417063_c1 nmdc:mga09592_1417063_c1_33_542 166
240 3300050508 nmdc:mga09592_445233_c1 nmdc:mga09592_445233_c1_246_755 166
241 3300050509 nmdc:mga0qj67_400486_c1 nmdc:mga0qj67_400486_c1_172_681 166
242 3300050510 nmdc:mga06r32_206972_c1 nmdc:mga06r32_206972_c1_436_945 166
243 3300050510 nmdc:mga06r32_49003_c1 nmdc:mga06r32_49003_c1_2959_3468 166
244 3300050510 nmdc:mga06r32_828_c1 nmdc:mga06r32_828_c1_20197_20706 166
245 3300053077 Ga0495601_0011532 Ga0495601_0011532_1417_1926 166
246 3300053078 Ga0495612_0037860 Ga0495612_0037860_1411_1920 166
247 3300053084 Ga0495595_0008702 Ga0495595_0008702_1582_2091 166
248 3300053085 Ga0495619_0017073 Ga0495619_0017073_2071_2607 166
249 3300053153 Ga0500616_0004130 Ga0500616_0004130_3428_3937 166
250 3300059490 Ga0587066_059315 Ga0587066_059315_114_623 166
251 3300059492 Ga0587073_0112815 Ga0587073_0112815_101_610 166
252 3300059505 Ga0587083_0124016 Ga0587083_0124016_50_559 166
253 3300059508 Ga0587088_102584 Ga0587088_102584_42_551 166
254 3300059512 Ga0587092_052543 Ga0587092_052543_149_658 166
255 3300059640 Ga0587067_087719 Ga0587067_087719_83_592 166
256 3300059641 Ga0587068_114114 Ga0587068_114114_59_568 166
257 3300059642 Ga0587069_053844 Ga0587069_053844_58_567 166
258 3300059642 Ga0587069_069812 Ga0587069_069812_59_568 166
259 3300059644 Ga0587075_073590 Ga0587075_073590_40_549 166
260 3300059654 Ga0587110_028425 Ga0587110_028425_101_610 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

10

170

0.86

PF12867

DinB_2

DinB superfamily

14

162

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.9516 3 166
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9481 3 166
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.9296 3 166
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9261 3 166
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.9058 1 163
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9558 3 165 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.928 3 165 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9048 1 163 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.869 1 163 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7505 5 159 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A4P8RD88-F1-model_v4 DinB-like domain-containing protein 0.9906 1 165
AF-C4RFH8-F1-model_v4 DinB-like domain-containing protein 0.9882 2 165
AF-A0A1I2FHZ2-F1-model_v4 Uncharacterized damage-inducible protein DinB (Forms a four-helix bundle) 0.9879 1 165
AF-A0A316GAE1-F1-model_v4 Putative damage-inducible protein DinB 0.9874 1 166
AF-A0A010Z2B5-F1-model_v4 DinB-like domain-containing protein 0.9847 1 166

Feature Viewer

pLDDT pTM Quality
97.01 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map