F368906
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 259 | 175 | 239 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10395972|Ga0307515_103959721 |
| Length | 207 |
| Sequence | MQLMSGKVQLAIAPHSLATARTKLYIKYMVSLRCKMIVKEELIKLGLNFIAIDLGVVEMLGEITSSQRDQLKANLLKSGLELLDDKKSILIEKIKGVIIELIHYSDELPKVNYSDYISEKLNYDYTYLSNVFSEVKGITIQHFIIIHKIERVKELLLYDELNLTEIAFKLHYSSVAHLSNQFKKVTGLSPSYFKQLKQKRKDNLENM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 3 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 4 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 5 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 6 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 7 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 8 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 9 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 10 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 11 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 12 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 13 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 14 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 15 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 16 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 17 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 18 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 19 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 147 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 148 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 149 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 150 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 151 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 152 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 153 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 154 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 155 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 158 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 159 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 160 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 163 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 164 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 165 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 166 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 167 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 168 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 171 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 172 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 173 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 175 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.03 |
| Metatranscriptomes | 5.02 |
| Isolates | 6.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.79 |
| Nodule | 0 |
| Rhizoplane | 1.54 |
| Rhizosphere | 81.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 2 | JGI24737J22298_10139430 | 3300001990 | Bacteria | 716 |
| 3 | Ga0006758J48902_1029552 | 3300003300 | Bacteria | 669 |
| 4 | rootH1_10010080 | 3300003316 | Bacteria | 5637 |
| 5 | rootH2_10002508 | 3300003320 | Bacteria | 42556 |
| 6 | rootH2_10205943 | 3300003320 | Bacteria | 3335 |
| 7 | rootL2_10010620 | 3300003322 | Bacteria | 20251 |
| 8 | rootL2_10011628 | 3300003322 | Bacteria | 7797 |
| 9 | rootL2_10181321 | 3300003322 | Bacteria | 1272 |
| 10 | rootH1_10013477 | 3300003323 | Bacteria | 7020 |
| 11 | rootH1_10039819 | 3300003323 | Bacteria | 1294 |
| 12 | rootH1_10267515 | 3300003323 | Bacteria | 5435 |
| 13 | Ga0032354_1051284 | 3300003693 | Bacteria | 692 |
| 14 | Ga0055531_10000067 | 3300003794 | Bacteria | 114289 |
| 15 | Ga0058863_10846910 | 3300004799 | Bacteria | 837 |
| 16 | Ga0065165_1000927 | 3300005262 | Bacteria | 37617 |
| 17 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 18 | Ga0065704_10079314 | 3300005289 | Bacteria | 4197 |
| 19 | Ga0065704_10085342 | 3300005289 | Bacteria | 3231 |
| 20 | Ga0065704_10089093 | 3300005289 | Bacteria | 2886 |
| 21 | Ga0070658_10406840 | 3300005327 | Bacteria | 1169 |
| 22 | Ga0070683_100087575 | 3300005329 | Bacteria | 2921 |
| 23 | Ga0070683_100093378 | 3300005329 | Bacteria | 2827 |
| 24 | Ga0070690_100167412 | 3300005330 | Bacteria | 1510 |
| 25 | Ga0070666_10025453 | 3300005335 | Bacteria | 3858 |
| 26 | Ga0070680_100212355 | 3300005336 | Unclassified | 1633 |
| 27 | Ga0070682_100000044 | 3300005337 | Bacteria | 133653 |
| 28 | Ga0070682_100000493 | 3300005337 | Bacteria | 24795 |
| 29 | Ga0070682_100027228 | 3300005337 | Bacteria | 3429 |
| 30 | Ga0070660_100005869 | 3300005339 | Bacteria | 8498 |
| 31 | Ga0070661_100006237 | 3300005344 | Bacteria | 8221 |
| 32 | Ga0070661_100037944 | 3300005344 | Bacteria | 3506 |
| 33 | Ga0070661_100179104 | 3300005344 | Bacteria | 1612 |
| 34 | Ga0070675_100143776 | 3300005354 | Bacteria | 2040 |
| 35 | Ga0070673_100048535 | 3300005364 | Bacteria | 3310 |
| 36 | Ga0070659_100004142 | 3300005366 | Bacteria | 10339 |
| 37 | Ga0070713_100339110 | 3300005436 | Bacteria | 1392 |
| 38 | Ga0070662_100033541 | 3300005457 | Bacteria | 3615 |
| 39 | Ga0070681_10038300 | 3300005458 | Bacteria | 4808 |
| 40 | Ga0068867_100357861 | 3300005459 | Bacteria | 1220 |
| 41 | Ga0068867_100755402 | 3300005459 | Bacteria | 863 |
| 42 | Ga0070679_100112401 | 3300005530 | Bacteria | 2710 |
| 43 | Ga0070684_100022651 | 3300005535 | Bacteria | 5243 |
| 44 | Ga0070684_100069084 | 3300005535 | Bacteria | 3106 |
| 45 | Ga0068853_100007902 | 3300005539 | Bacteria | 8530 |
| 46 | Ga0068853_100013250 | 3300005539 | Bacteria | 6731 |
| 47 | Ga0068853_100020744 | 3300005539 | Bacteria | 5465 |
| 48 | Ga0070665_100499725 | 3300005548 | Unclassified | 1227 |
| 49 | Ga0068855_100015279 | 3300005563 | Bacteria | 9240 |
| 50 | Ga0068855_100421324 | 3300005563 | Bacteria | 1460 |
| 51 | Ga0068855_100460237 | 3300005563 | Unclassified | 1387 |
| 52 | Ga0068855_100472754 | 3300005563 | Bacteria | 1365 |
| 53 | Ga0070664_100004993 | 3300005564 | Bacteria | 10628 |
| 54 | Ga0070664_100040969 | 3300005564 | Bacteria | 3907 |
| 55 | Ga0068857_100016824 | 3300005577 | Bacteria | 6406 |
| 56 | Ga0068854_100144117 | 3300005578 | Bacteria | 1831 |
| 57 | Ga0068856_100004592 | 3300005614 | Bacteria | 13734 |
| 58 | Ga0068852_100124660 | 3300005616 | Bacteria | 2363 |
| 59 | Ga0068859_100000551 | 3300005617 | Bacteria | 37187 |
| 60 | Ga0068864_100263356 | 3300005618 | Unclassified | 1604 |
| 61 | Ga0068863_100061870 | 3300005841 | Bacteria | 3540 |
| 62 | Ga0068863_100367732 | 3300005841 | Bacteria | 1403 |
| 63 | Ga0068860_100706267 | 3300005843 | Bacteria | 1018 |
| 64 | Ga0070716_100188362 | 3300006173 | Bacteria | 1361 |
| 65 | Ga0097621_100234761 | 3300006237 | Unclassified | 1602 |
| 66 | Ga0068871_100026123 | 3300006358 | Bacteria | 4553 |
| 67 | Ga0075429_100891809 | 3300006880 | Unclassified | 778 |
| 68 | Ga0097620_100000551 | 3300006931 | Bacteria | 37187 |
| 69 | Ga0105244_10000043 | 3300009036 | Bacteria | 150556 |
| 70 | Ga0105250_10043940 | 3300009092 | Bacteria | 1792 |
| 71 | Ga0105240_10124463 | 3300009093 | Unclassified | 3101 |
| 72 | Ga0111539_10009310 | 3300009094 | Bacteria | 12403 |
| 73 | Ga0111539_10051579 | 3300009094 | Bacteria | 4899 |
| 74 | Ga0105245_10192355 | 3300009098 | Bacteria | 1955 |
| 75 | Ga0105239_10591728 | 3300010375 | Unclassified | 1265 |
| 76 | Ga0157373_10009280 | 3300013100 | Bacteria | 7273 |
| 77 | Ga0157371_10057839 | 3300013102 | Bacteria | 2750 |
| 78 | Ga0157371_10086834 | 3300013102 | Bacteria | 2215 |
| 79 | Ga0157371_10159879 | 3300013102 | Bacteria | 1609 |
| 80 | Ga0157371_10220208 | 3300013102 | Bacteria | 1363 |
| 81 | Ga0157370_10004244 | 3300013104 | Bacteria | 16560 |
| 82 | Ga0157370_10091821 | 3300013104 | Bacteria | 2850 |
| 83 | Ga0157370_10217650 | 3300013104 | Bacteria | 1769 |
| 84 | Ga0157370_10384676 | 3300013104 | Bacteria | 1292 |
| 85 | Ga0157370_11257074 | 3300013104 | Bacteria | 667 |
| 86 | Ga0157369_10006103 | 3300013105 | Bacteria | 13988 |
| 87 | Ga0157374_10058579 | 3300013296 | Bacteria | 3599 |
| 88 | Ga0157378_10187912 | 3300013297 | Bacteria | 1947 |
| 89 | Ga0157378_10468633 | 3300013297 | Unclassified | 1253 |
| 90 | Ga0157378_10549155 | 3300013297 | Unclassified | 1160 |
| 91 | Ga0163162_10005051 | 3300013306 | Bacteria | 12711 |
| 92 | Ga0163162_10297640 | 3300013306 | Unclassified | 1745 |
| 93 | Ga0163162_11800004 | 3300013306 | Bacteria | 700 |
| 94 | Ga0157372_10000250 | 3300013307 | Bacteria | 59465 |
| 95 | Ga0157372_10006422 | 3300013307 | Bacteria | 12513 |
| 96 | Ga0157372_10611461 | 3300013307 | Bacteria | 1270 |
| 97 | Ga0157372_11682694 | 3300013307 | Bacteria | 730 |
| 98 | Ga0157375_10000174 | 3300013308 | Bacteria | 59683 |
| 99 | Ga0157375_10403620 | 3300013308 | Unclassified | 1533 |
| 100 | Ga0157375_10810239 | 3300013308 | Bacteria | 1085 |
| 101 | Ga0157380_10007662 | 3300014326 | Bacteria | 7680 |
| 102 | Ga0157380_10089442 | 3300014326 | Unclassified | 2537 |
| 103 | Ga0157376_10044788 | 3300014969 | Bacteria | 3639 |
| 104 | Ga0157376_10341194 | 3300014969 | Unclassified | 1431 |
| 105 | Ga0163161_10182300 | 3300017792 | Bacteria | 1611 |
| 106 | Ga0163161_10254860 | 3300017792 | Bacteria | 1368 |
| 107 | Ga0163161_10573716 | 3300017792 | Bacteria | 927 |
| 108 | Ga0206356_11733222 | 3300020070 | Bacteria | 707 |
| 109 | Ga0206356_11752955 | 3300020070 | Bacteria | 706 |
| 110 | Ga0206349_1742919 | 3300020075 | Bacteria | 1115 |
| 111 | Ga0206352_10053850 | 3300020078 | Bacteria | 1191 |
| 112 | Ga0206354_10521535 | 3300020081 | Bacteria | 979 |
| 113 | Ga0206353_10943740 | 3300020082 | Bacteria | 968 |
| 114 | Ga0154015_1502011 | 3300020610 | Bacteria | 660 |
| 115 | Ga0224712_10083904 | 3300022467 | Bacteria | 1321 |
| 116 | Ga0209050_1001749 | 3300025298 | Bacteria | 21577 |
| 117 | Ga0209050_1020005 | 3300025298 | Bacteria | 2512 |
| 118 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 119 | Ga0207655_1000225 | 3300025728 | Bacteria | 94983 |
| 120 | Ga0207680_10548490 | 3300025903 | Bacteria | 825 |
| 121 | Ga0207705_10228364 | 3300025909 | Unclassified | 1415 |
| 122 | Ga0207707_10260401 | 3300025912 | Unclassified | 1505 |
| 123 | Ga0207660_10277754 | 3300025917 | Unclassified | 1328 |
| 124 | Ga0207657_10000998 | 3300025919 | Bacteria | 30073 |
| 125 | Ga0207649_10006290 | 3300025920 | Bacteria | 6452 |
| 126 | Ga0207652_10120517 | 3300025921 | Unclassified | 2334 |
| 127 | Ga0207659_10949595 | 3300025926 | Bacteria | 739 |
| 128 | Ga0207700_10646622 | 3300025928 | Unclassified | 943 |
| 129 | Ga0207706_10011699 | 3300025933 | Bacteria | 8001 |
| 130 | Ga0207709_10000217 | 3300025935 | Bacteria | 72596 |
| 131 | Ga0207665_10186279 | 3300025939 | Bacteria | 1506 |
| 132 | Ga0207661_10071975 | 3300025944 | Bacteria | 2827 |
| 133 | Ga0207661_10096932 | 3300025944 | Bacteria | 2468 |
| 134 | Ga0207679_10009351 | 3300025945 | Bacteria | 6278 |
| 135 | Ga0207679_10214647 | 3300025945 | Unclassified | 1616 |
| 136 | Ga0207667_10245517 | 3300025949 | Bacteria | 1832 |
| 137 | Ga0207651_10653115 | 3300025960 | Bacteria | 923 |
| 138 | Ga0207640_10095677 | 3300025981 | Bacteria | 2069 |
| 139 | Ga0207639_10008726 | 3300026041 | Bacteria | 6959 |
| 140 | Ga0207702_10017885 | 3300026078 | Bacteria | 5866 |
| 141 | Ga0207702_10206155 | 3300026078 | Bacteria | 1825 |
| 142 | Ga0207641_10117044 | 3300026088 | Bacteria | 2372 |
| 143 | Ga0207641_10325785 | 3300026088 | Bacteria | 1458 |
| 144 | Ga0207676_10489310 | 3300026095 | Unclassified | 1166 |
| 145 | Ga0207674_10013623 | 3300026116 | Bacteria | 9007 |
| 146 | Ga0207674_10027439 | 3300026116 | Bacteria | 6022 |
| 147 | Ga0207428_10029141 | 3300027907 | Bacteria | 4579 |
| 148 | Ga0268266_10551823 | 3300028379 | Unclassified | 1104 |
| 149 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 150 | Ga0307515_10395972 | 3300028794 | Unclassified | 1008 |
| 151 | Ga0265327_10000577 | 3300031251 | Bacteria | 62128 |
| 152 | Ga0307509_10109494 | 3300031507 | Bacteria | 2772 |
| 153 | Ga0307408_100000346 | 3300031548 | Bacteria | 43502 |
| 154 | Ga0307408_100000626 | 3300031548 | Bacteria | 30050 |
| 155 | Ga0307408_100091365 | 3300031548 | Bacteria | 2299 |
| 156 | Ga0307412_10029618 | 3300031911 | Bacteria | 3438 |
| 157 | Ga0307414_10122450 | 3300032004 | Bacteria | 2002 |
| 158 | Ga0307411_10002911 | 3300032005 | Bacteria | 7754 |
| 159 | Ga0373927_0011544 | 3300035695 | Bacteria | 5884 |
| 160 | Ga0373937_0258298 | 3300036401 | Unclassified | 1643 |
| 161 | Ga0373937_0374656 | 3300036401 | Unclassified | 1350 |
| 162 | Ga0395905_0497358 | 3300037471 | Unclassified | 1119 |
| 163 | Ga0439445_0083368 | 3300042004 | Bacteria | 895 |
| 164 | Ga0451577_0000690 | 3300042876 | Bacteria | 52905 |
| 165 | Ga0451577_0015333 | 3300042876 | Bacteria | 7131 |
| 166 | Ga0451577_0056089 | 3300042876 | Bacteria | 3514 |
| 167 | Ga0451577_0061543 | 3300042876 | Bacteria | 3348 |
| 168 | Ga0451577_0195324 | 3300042876 | Unclassified | 1826 |
| 169 | Ga0451577_0405624 | 3300042876 | Bacteria | 1237 |
| 170 | Ga0451577_1107851 | 3300042876 | Bacteria | 708 |
| 171 | Ga0453683_0095187 | 3300044673 | Bacteria | 1868 |
| 172 | Ga0453684_0001862 | 3300044712 | Bacteria | 55001 |
| 173 | Ga0453684_0003857 | 3300044712 | Bacteria | 33022 |
| 174 | Ga0453684_0007797 | 3300044712 | Bacteria | 19527 |
| 175 | Ga0453684_0009088 | 3300044712 | Bacteria | 17520 |
| 176 | Ga0453684_0014970 | 3300044712 | Bacteria | 12326 |
| 177 | Ga0453684_0081228 | 3300044712 | Bacteria | 4044 |
| 178 | Ga0453684_0091603 | 3300044712 | Bacteria | 3752 |
| 179 | Ga0453684_0194677 | 3300044712 | Unclassified | 2368 |
| 180 | Ga0451576_0001696 | 3300045051 | Bacteria | 36431 |
| 181 | Ga0451576_0087467 | 3300045051 | Bacteria | 3241 |
| 182 | Ga0451576_0142166 | 3300045051 | Bacteria | 2502 |
| 183 | Ga0451576_0169606 | 3300045051 | Unclassified | 2278 |
| 184 | Ga0451576_0204674 | 3300045051 | Bacteria | 2061 |
| 185 | Ga0495592_0139503 | 3300046454 | Bacteria | 1688 |
| 186 | Ga0495638_0000013 | 3300046460 | Bacteria | 430133 |
| 187 | Ga0495596_0000248 | 3300046500 | Bacteria | 35866 |
| 188 | Ga0495616_0014873 | 3300046513 | Bacteria | 4342 |
| 189 | Ga0495643_0001275 | 3300046522 | Bacteria | 24157 |
| 190 | Ga0495645_0095843 | 3300046543 | Unclassified | 2115 |
| 191 | Ga0495625_0112874 | 3300046660 | Bacteria | 1856 |
| 192 | Ga0495657_0506544 | 3300046675 | Bacteria | 704 |
| 193 | Ga0495623_0387776 | 3300046679 | Unclassified | 754 |
| 194 | Ga0495613_0298044 | 3300046689 | Bacteria | 1117 |
| 195 | Ga0495604_0416534 | 3300047317 | Bacteria | 882 |
| 196 | Ga0496104_0225358 | 3300048907 | Bacteria | 1787 |
| 197 | Ga0496110_0802843 | 3300048913 | Bacteria | 845 |
| 198 | Ga0496110_0965279 | 3300048913 | Unclassified | 759 |
| 199 | Ga0496113_0163074 | 3300048916 | Bacteria | 1763 |
| 200 | Ga0496116_0000012 | 3300048919 | Bacteria | 611365 |
| 201 | Ga0496117_0001405 | 3300048920 | Bacteria | 34964 |
| 202 | Ga0496119_0001680 | 3300048922 | Bacteria | 25858 |
| 203 | Ga0496120_0135134 | 3300048923 | Bacteria | 1258 |
| 204 | Ga0496122_0000091 | 3300048925 | Bacteria | 204567 |
| 205 | Ga0496122_0002557 | 3300048925 | Bacteria | 25565 |
| 206 | Ga0496123_0016950 | 3300048926 | Bacteria | 5884 |
| 207 | Ga0496123_0305781 | 3300048926 | Bacteria | 757 |
| 208 | Ga0496124_0006441 | 3300048927 | Bacteria | 12794 |
| 209 | Ga0496124_0315682 | 3300048927 | Bacteria | 1122 |
| 210 | Ga0496125_0010953 | 3300048928 | Bacteria | 9111 |
| 211 | Ga0496125_0017949 | 3300048928 | Bacteria | 6727 |
| 212 | Ga0496126_0001597 | 3300048929 | Bacteria | 34515 |
| 213 | Ga0501306_035674 | 3300049127 | Bacteria | 755 |
| 214 | Ga0501320_023087 | 3300049536 | Bacteria | 733 |
| 215 | Ga0501198_031135 | 3300049649 | Bacteria | 891 |
| 216 | Ga0501210_000188 | 3300049657 | Bacteria | 2468 |
| 217 | Ga0501217_003407 | 3300049661 | Bacteria | 3212 |
| 218 | Ga0501223_004306 | 3300049663 | Bacteria | 3058 |
| 219 | Ga0501223_019800 | 3300049663 | Bacteria | 1321 |
| 220 | Ga0501236_002729 | 3300049670 | Bacteria | 2034 |
| 221 | Ga0501247_005189 | 3300049677 | Bacteria | 1444 |
| 222 | Ga0501257_001997 | 3300049686 | Bacteria | 4254 |
| 223 | Ga0501241_001226 | 3300049758 | Bacteria | 5323 |
| 224 | Ga0501264_001233 | 3300049761 | Bacteria | 2899 |
| 225 | Ga0501271_009975 | 3300049768 | Bacteria | 995 |
| 226 | Ga0501204_002959 | 3300049850 | Bacteria | 1754 |
| 227 | nmdc:mga09592_564090_c1 | 3300050508 | Bacteria | 977 |
| 228 | nmdc:mga08y16_119437_c1 | 3300050511 | Bacteria | 2744 |
| 229 | nmdc:mga08y16_201938_c1 | 3300050511 | Bacteria | 2060 |
| 230 | Ga0500557_124970 | 3300053105 | Bacteria | 853 |
| 231 | Ga0500655_002920 | 3300053133 | Bacteria | 3105 |
| 232 | Ga0500655_039879 | 3300053133 | Bacteria | 920 |
| 233 | Ga0500604_0004000 | 3300053151 | Bacteria | 3935 |
| 234 | Ga0500616_0000013 | 3300053153 | Bacteria | 674172 |
| 235 | Ga0500622_0000024 | 3300053156 | Bacteria | 249623 |
| 236 | Ga0500622_0005910 | 3300053156 | Bacteria | 7217 |
| 237 | Ga0500622_0010736 | 3300053156 | Bacteria | 5012 |
| 238 | Ga0500627_0061699 | 3300053158 | Unclassified | 1650 |
| 239 | Ga0500627_0240581 | 3300053158 | Bacteria | 803 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10089093 | Ga0065704_100890932 | 157 |
| 2 | 3300005337 | Ga0070682_100000493 | Ga0070682_10000049312 | 157 |
| 3 | 3300025935 | Ga0207709_10000217 | Ga0207709_1000021748 | 157 |
| 4 | 3300031548 | Ga0307408_100000346 | Ga0307408_10000034619 | 157 |
| 5 | 3300048916 | Ga0496113_0163074 | Ga0496113_0163074_326_865 | 157 |
| 6 | 3300048919 | Ga0496116_0000012 | Ga0496116_0000012_453207_453746 | 157 |
| 7 | 3300048920 | Ga0496117_0001405 | Ga0496117_0001405_15456_15995 | 157 |
| 8 | 3300048922 | Ga0496119_0001680 | Ga0496119_0001680_15585_16124 | 157 |
| 9 | 3300048923 | Ga0496120_0135134 | Ga0496120_0135134_460_999 | 157 |
| 10 | 3300048925 | Ga0496122_0002557 | Ga0496122_0002557_21387_21926 | 157 |
| 11 | 3300048926 | Ga0496123_0016950 | Ga0496123_0016950_1045_1584 | 157 |
| 12 | 3300048927 | Ga0496124_0006441 | Ga0496124_0006441_2398_2937 | 157 |
| 13 | 3300048928 | Ga0496125_0010953 | Ga0496125_0010953_4256_4795 | 157 |
| 14 | 3300005618 | Ga0068864_100263356 | Ga0068864_1002633562 | 159 |
| 15 | 3300026095 | Ga0207676_10489310 | Ga0207676_104893102 | 159 |
| 16 | 3300049850 | Ga0501204_002959 | Ga0501204_002959_402_962 | 159 |
| 17 | 3300003322 | rootL2_10011628 | rootL2_100116282 | 160 |
| 18 | 3300005329 | Ga0070683_100093378 | Ga0070683_1000933783 | 160 |
| 19 | 3300005344 | Ga0070661_100006237 | Ga0070661_1000062373 | 160 |
| 20 | 3300005535 | Ga0070684_100069084 | Ga0070684_1000690842 | 160 |
| 21 | 3300005539 | Ga0068853_100007902 | Ga0068853_1000079023 | 160 |
| 22 | 3300005564 | Ga0070664_100004993 | Ga0070664_1000049939 | 160 |
| 23 | 3300005577 | Ga0068857_100016824 | Ga0068857_1000168248 | 160 |
| 24 | 3300025920 | Ga0207649_10006290 | Ga0207649_100062903 | 160 |
| 25 | 3300025944 | Ga0207661_10071975 | Ga0207661_100719753 | 160 |
| 26 | 3300025945 | Ga0207679_10009351 | Ga0207679_100093517 | 160 |
| 27 | 3300026041 | Ga0207639_10008726 | Ga0207639_100087266 | 160 |
| 28 | 3300026116 | Ga0207674_10013623 | Ga0207674_100136234 | 160 |
| 29 | 3300048925 | Ga0496122_0000091 | Ga0496122_0000091_133504_134043 | 160 |
| 30 | 3300048926 | Ga0496123_0305781 | Ga0496123_0305781_180_719 | 160 |
| 31 | 3300013297 | Ga0157378_10468633 | Ga0157378_104686331 | 161 |
| 32 | 3300006237 | Ga0097621_100234761 | Ga0097621_1002347611 | 162 |
| 33 | 3300006358 | Ga0068871_100026123 | Ga0068871_1000261232 | 162 |
| 34 | 3300013308 | Ga0157375_10403620 | Ga0157375_104036202 | 162 |
| 35 | 3300017792 | Ga0163161_10254860 | Ga0163161_102548601 | 162 |
| 36 | 3300005841 | Ga0068863_100061870 | Ga0068863_1000618703 | 166 |
| 37 | 3300026088 | Ga0207641_10117044 | Ga0207641_101170443 | 166 |
| 38 | iso_pu_bacteria | 2585428060 | 2587748286 | 167 |
| 39 | iso_pu_bacteria | 2914759650 | 2914760663 | 167 |
| 40 | 3300048907 | Ga0496104_0225358 | Ga0496104_0225358_936_1469 | 168 |
| 41 | 3300004799 | Ga0058863_10846910 | Ga0058863_108469101 | 169 |
| 42 | 3300005327 | Ga0070658_10406840 | Ga0070658_104068402 | 169 |
| 43 | 3300005563 | Ga0068855_100460237 | Ga0068855_1004602372 | 169 |
| 44 | 3300009093 | Ga0105240_10124463 | Ga0105240_101244633 | 169 |
| 45 | 3300013307 | Ga0157372_11682694 | Ga0157372_116826941 | 169 |
| 46 | 3300045051 | Ga0451576_0204674 | Ga0451576_0204674_775_1287 | 169 |
| 47 | 3300046513 | Ga0495616_0014873 | Ga0495616_0014873_1276_1803 | 169 |
| 48 | 3300046522 | Ga0495643_0001275 | Ga0495643_0001275_2603_3130 | 169 |
| 49 | 3300046660 | Ga0495625_0112874 | Ga0495625_0112874_643_1170 | 169 |
| 50 | 3300048913 | Ga0496110_0965279 | Ga0496110_0965279_70_582 | 169 |
| 51 | 3300049127 | Ga0501306_035674 | Ga0501306_035674_144_659 | 169 |
| 52 | 3300049536 | Ga0501320_023087 | Ga0501320_023087_181_696 | 169 |
| 53 | 3300049663 | Ga0501223_004306 | Ga0501223_004306_1024_1539 | 169 |
| 54 | 2162886007 | SwRhRL2b_contig_1663050 | SwRhRL2b_0644.00007420 | 170 |
| 55 | 3300001990 | JGI24737J22298_10139430 | JGI24737J22298_101394301 | 170 |
| 56 | 3300003300 | Ga0006758J48902_1029552 | Ga0006758J48902_10295521 | 170 |
| 57 | 3300003316 | rootH1_10010080 | rootH1_100100804 | 170 |
| 58 | 3300003320 | rootH2_10002508 | rootH2_1000250840 | 170 |
| 59 | 3300003320 | rootH2_10205943 | rootH2_102059433 | 170 |
| 60 | 3300003322 | rootL2_10010620 | rootL2_1001062012 | 170 |
| 61 | 3300003322 | rootL2_10181321 | rootL2_101813212 | 170 |
| 62 | 3300003323 | rootH1_10013477 | rootH1_100134772 | 170 |
| 63 | 3300003323 | rootH1_10039819 | rootH1_100398192 | 170 |
| 64 | 3300003323 | rootH1_10267515 | rootH1_102675158 | 170 |
| 65 | 3300003693 | Ga0032354_1051284 | Ga0032354_10512841 | 170 |
| 66 | 3300003794 | Ga0055531_10000067 | Ga0055531_1000006718 | 170 |
| 67 | 3300005262 | Ga0065165_1000927 | Ga0065165_100092712 | 170 |
| 68 | 3300005289 | Ga0065704_10070140 | Ga0065704_10070140192 | 170 |
| 69 | 3300005289 | Ga0065704_10079314 | Ga0065704_100793143 | 170 |
| 70 | 3300005289 | Ga0065704_10085342 | Ga0065704_100853425 | 170 |
| 71 | 3300005329 | Ga0070683_100087575 | Ga0070683_1000875755 | 170 |
| 72 | 3300005330 | Ga0070690_100167412 | Ga0070690_1001674122 | 170 |
| 73 | 3300005335 | Ga0070666_10025453 | Ga0070666_100254535 | 170 |
| 74 | 3300005336 | Ga0070680_100212355 | Ga0070680_1002123552 | 170 |
| 75 | 3300005337 | Ga0070682_100000044 | Ga0070682_10000004483 | 170 |
| 76 | 3300005337 | Ga0070682_100027228 | Ga0070682_1000272284 | 170 |
| 77 | 3300005339 | Ga0070660_100005869 | Ga0070660_1000058695 | 170 |
| 78 | 3300005344 | Ga0070661_100037944 | Ga0070661_1000379443 | 170 |
| 79 | 3300005344 | Ga0070661_100179104 | Ga0070661_1001791043 | 170 |
| 80 | 3300005354 | Ga0070675_100143776 | Ga0070675_1001437763 | 170 |
| 81 | 3300005364 | Ga0070673_100048535 | Ga0070673_1000485355 | 170 |
| 82 | 3300005366 | Ga0070659_100004142 | Ga0070659_1000041426 | 170 |
| 83 | 3300005436 | Ga0070713_100339110 | Ga0070713_1003391102 | 170 |
| 84 | 3300005457 | Ga0070662_100033541 | Ga0070662_1000335416 | 170 |
| 85 | 3300005458 | Ga0070681_10038300 | Ga0070681_100383007 | 170 |
| 86 | 3300005459 | Ga0068867_100357861 | Ga0068867_1003578612 | 170 |
| 87 | 3300005459 | Ga0068867_100755402 | Ga0068867_1007554021 | 170 |
| 88 | 3300005530 | Ga0070679_100112401 | Ga0070679_1001124013 | 170 |
| 89 | 3300005535 | Ga0070684_100022651 | Ga0070684_1000226517 | 170 |
| 90 | 3300005539 | Ga0068853_100013250 | Ga0068853_1000132503 | 170 |
| 91 | 3300005539 | Ga0068853_100020744 | Ga0068853_1000207445 | 170 |
| 92 | 3300005548 | Ga0070665_100499725 | Ga0070665_1004997252 | 170 |
| 93 | 3300005563 | Ga0068855_100015279 | Ga0068855_10001527920 | 170 |
| 94 | 3300005563 | Ga0068855_100421324 | Ga0068855_1004213242 | 170 |
| 95 | 3300005563 | Ga0068855_100472754 | Ga0068855_1004727542 | 170 |
| 96 | 3300005564 | Ga0070664_100040969 | Ga0070664_1000409696 | 170 |
| 97 | 3300005578 | Ga0068854_100144117 | Ga0068854_1001441172 | 170 |
| 98 | 3300005614 | Ga0068856_100004592 | Ga0068856_1000045929 | 170 |
| 99 | 3300005616 | Ga0068852_100124660 | Ga0068852_1001246605 | 170 |
| 100 | 3300005617 | Ga0068859_100000551 | Ga0068859_1000005516 | 170 |
| 101 | 3300005617 | Ga0068859_100000551 | Ga0068859_1000005518 | 170 |
| 102 | 3300005841 | Ga0068863_100367732 | Ga0068863_1003677323 | 170 |
| 103 | 3300005843 | Ga0068860_100706267 | Ga0068860_1007062672 | 170 |
| 104 | 3300006173 | Ga0070716_100188362 | Ga0070716_1001883622 | 170 |
| 105 | 3300006880 | Ga0075429_100891809 | Ga0075429_1008918091 | 170 |
| 106 | 3300006931 | Ga0097620_100000551 | Ga0097620_1000005516 | 170 |
| 107 | 3300006931 | Ga0097620_100000551 | Ga0097620_1000005518 | 170 |
| 108 | 3300009036 | Ga0105244_10000043 | Ga0105244_10000043143 | 170 |
| 109 | 3300009092 | Ga0105250_10043940 | Ga0105250_100439403 | 170 |
| 110 | 3300009094 | Ga0111539_10009310 | Ga0111539_100093108 | 170 |
| 111 | 3300009094 | Ga0111539_10051579 | Ga0111539_100515796 | 170 |
| 112 | 3300009098 | Ga0105245_10192355 | Ga0105245_101923551 | 170 |
| 113 | 3300010375 | Ga0105239_10591728 | Ga0105239_105917281 | 170 |
| 114 | 3300013100 | Ga0157373_10009280 | Ga0157373_100092804 | 170 |
| 115 | 3300013102 | Ga0157371_10057839 | Ga0157371_100578392 | 170 |
| 116 | 3300013102 | Ga0157371_10086834 | Ga0157371_100868343 | 170 |
| 117 | 3300013102 | Ga0157371_10159879 | Ga0157371_101598793 | 170 |
| 118 | 3300013102 | Ga0157371_10220208 | Ga0157371_102202082 | 170 |
| 119 | 3300013104 | Ga0157370_10004244 | Ga0157370_1000424413 | 170 |
| 120 | 3300013104 | Ga0157370_10091821 | Ga0157370_100918211 | 170 |
| 121 | 3300013104 | Ga0157370_10217650 | Ga0157370_102176502 | 170 |
| 122 | 3300013104 | Ga0157370_10384676 | Ga0157370_103846762 | 170 |
| 123 | 3300013104 | Ga0157370_11257074 | Ga0157370_112570741 | 170 |
| 124 | 3300013105 | Ga0157369_10006103 | Ga0157369_1000610310 | 170 |
| 125 | 3300013296 | Ga0157374_10058579 | Ga0157374_100585797 | 170 |
| 126 | 3300013297 | Ga0157378_10187912 | Ga0157378_101879121 | 170 |
| 127 | 3300013297 | Ga0157378_10549155 | Ga0157378_105491552 | 170 |
| 128 | 3300013306 | Ga0163162_10005051 | Ga0163162_100050517 | 170 |
| 129 | 3300013306 | Ga0163162_10297640 | Ga0163162_102976402 | 170 |
| 130 | 3300013306 | Ga0163162_11800004 | Ga0163162_118000041 | 170 |
| 131 | 3300013307 | Ga0157372_10000250 | Ga0157372_1000025025 | 170 |
| 132 | 3300013307 | Ga0157372_10006422 | Ga0157372_1000642216 | 170 |
| 133 | 3300013307 | Ga0157372_10611461 | Ga0157372_106114611 | 170 |
| 134 | 3300013308 | Ga0157375_10000174 | Ga0157375_1000017428 | 170 |
| 135 | 3300013308 | Ga0157375_10810239 | Ga0157375_108102392 | 170 |
| 136 | 3300014326 | Ga0157380_10007662 | Ga0157380_100076622 | 170 |
| 137 | 3300014326 | Ga0157380_10089442 | Ga0157380_100894424 | 170 |
| 138 | 3300014969 | Ga0157376_10044788 | Ga0157376_100447883 | 170 |
| 139 | 3300014969 | Ga0157376_10341194 | Ga0157376_103411943 | 170 |
| 140 | 3300017792 | Ga0163161_10182300 | Ga0163161_101823001 | 170 |
| 141 | 3300017792 | Ga0163161_10573716 | Ga0163161_105737162 | 170 |
| 142 | 3300020070 | Ga0206356_11733222 | Ga0206356_117332221 | 170 |
| 143 | 3300020070 | Ga0206356_11752955 | Ga0206356_117529551 | 170 |
| 144 | 3300020075 | Ga0206349_1742919 | Ga0206349_17429192 | 170 |
| 145 | 3300020078 | Ga0206352_10053850 | Ga0206352_100538501 | 170 |
| 146 | 3300020081 | Ga0206354_10521535 | Ga0206354_105215352 | 170 |
| 147 | 3300020082 | Ga0206353_10943740 | Ga0206353_109437402 | 170 |
| 148 | 3300020610 | Ga0154015_1502011 | Ga0154015_15020111 | 170 |
| 149 | 3300022467 | Ga0224712_10083904 | Ga0224712_100839043 | 170 |
| 150 | 3300025298 | Ga0209050_1001749 | Ga0209050_10017497 | 170 |
| 151 | 3300025298 | Ga0209050_1020005 | Ga0209050_10200053 | 170 |
| 152 | 3300025304 | Ga0209257_1000005 | Ga0209257_1000005581 | 170 |
| 153 | 3300025728 | Ga0207655_1000225 | Ga0207655_10002259 | 170 |
| 154 | 3300025903 | Ga0207680_10548490 | Ga0207680_105484901 | 170 |
| 155 | 3300025909 | Ga0207705_10228364 | Ga0207705_102283641 | 170 |
| 156 | 3300025912 | Ga0207707_10260401 | Ga0207707_102604012 | 170 |
| 157 | 3300025917 | Ga0207660_10277754 | Ga0207660_102777542 | 170 |
| 158 | 3300025919 | Ga0207657_10000998 | Ga0207657_1000099811 | 170 |
| 159 | 3300025921 | Ga0207652_10120517 | Ga0207652_101205173 | 170 |
| 160 | 3300025926 | Ga0207659_10949595 | Ga0207659_109495951 | 170 |
| 161 | 3300025928 | Ga0207700_10646622 | Ga0207700_106466221 | 170 |
| 162 | 3300025933 | Ga0207706_10011699 | Ga0207706_100116998 | 170 |
| 163 | 3300025939 | Ga0207665_10186279 | Ga0207665_101862792 | 170 |
| 164 | 3300025944 | Ga0207661_10096932 | Ga0207661_100969321 | 170 |
| 165 | 3300025945 | Ga0207679_10214647 | Ga0207679_102146472 | 170 |
| 166 | 3300025949 | Ga0207667_10245517 | Ga0207667_102455172 | 170 |
| 167 | 3300025960 | Ga0207651_10653115 | Ga0207651_106531151 | 170 |
| 168 | 3300025981 | Ga0207640_10095677 | Ga0207640_100956772 | 170 |
| 169 | 3300026078 | Ga0207702_10017885 | Ga0207702_100178853 | 170 |
| 170 | 3300026078 | Ga0207702_10206155 | Ga0207702_102061551 | 170 |
| 171 | 3300026088 | Ga0207641_10325785 | Ga0207641_103257853 | 170 |
| 172 | 3300026116 | Ga0207674_10027439 | Ga0207674_100274392 | 170 |
| 173 | 3300027907 | Ga0207428_10029141 | Ga0207428_100291414 | 170 |
| 174 | 3300028379 | Ga0268266_10551823 | Ga0268266_105518231 | 170 |
| 175 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012532 | 170 |
| 176 | 3300028794 | Ga0307515_10395972 | Ga0307515_103959721 | 170 |
| 177 | 3300031251 | Ga0265327_10000577 | Ga0265327_100005779 | 170 |
| 178 | 3300031507 | Ga0307509_10109494 | Ga0307509_101094943 | 170 |
| 179 | 3300031548 | Ga0307408_100000626 | Ga0307408_10000062623 | 170 |
| 180 | 3300031548 | Ga0307408_100091365 | Ga0307408_1000913651 | 170 |
| 181 | 3300031911 | Ga0307412_10029618 | Ga0307412_100296187 | 170 |
| 182 | 3300032004 | Ga0307414_10122450 | Ga0307414_101224501 | 170 |
| 183 | 3300032005 | Ga0307411_10002911 | Ga0307411_100029117 | 170 |
| 184 | 3300035695 | Ga0373927_0011544 | Ga0373927_0011544_3071_3631 | 170 |
| 185 | 3300036401 | Ga0373937_0258298 | Ga0373937_0258298_653_1171 | 170 |
| 186 | 3300036401 | Ga0373937_0374656 | Ga0373937_0374656_707_1225 | 170 |
| 187 | 3300037471 | Ga0395905_0497358 | Ga0395905_0497358_350_889 | 170 |
| 188 | 3300042004 | Ga0439445_0083368 | Ga0439445_0083368_171_710 | 170 |
| 189 | 3300042876 | Ga0451577_0000690 | Ga0451577_0000690_24940_25512 | 170 |
| 190 | 3300042876 | Ga0451577_0015333 | Ga0451577_0015333_6476_7015 | 170 |
| 191 | 3300042876 | Ga0451577_0056089 | Ga0451577_0056089_1199_1747 | 170 |
| 192 | 3300042876 | Ga0451577_0061543 | Ga0451577_0061543_2069_2629 | 170 |
| 193 | 3300042876 | Ga0451577_0195324 | Ga0451577_0195324_492_1031 | 170 |
| 194 | 3300042876 | Ga0451577_0405624 | Ga0451577_0405624_565_1113 | 170 |
| 195 | 3300042876 | Ga0451577_1107851 | Ga0451577_1107851_45_563 | 170 |
| 196 | 3300044673 | Ga0453683_0095187 | Ga0453683_0095187_476_991 | 170 |
| 197 | 3300044712 | Ga0453684_0001862 | Ga0453684_0001862_15234_15758 | 170 |
| 198 | 3300044712 | Ga0453684_0003857 | Ga0453684_0003857_15032_15550 | 170 |
| 199 | 3300044712 | Ga0453684_0007797 | Ga0453684_0007797_13510_14112 | 170 |
| 200 | 3300044712 | Ga0453684_0009088 | Ga0453684_0009088_5826_6365 | 170 |
| 201 | 3300044712 | Ga0453684_0014970 | Ga0453684_0014970_9681_10220 | 170 |
| 202 | 3300044712 | Ga0453684_0081228 | Ga0453684_0081228_1125_1673 | 170 |
| 203 | 3300044712 | Ga0453684_0091603 | Ga0453684_0091603_1028_1651 | 170 |
| 204 | 3300044712 | Ga0453684_0194677 | Ga0453684_0194677_836_1354 | 170 |
| 205 | 3300045051 | Ga0451576_0001696 | Ga0451576_0001696_19287_19811 | 170 |
| 206 | 3300045051 | Ga0451576_0087467 | Ga0451576_0087467_148_663 | 170 |
| 207 | 3300045051 | Ga0451576_0142166 | Ga0451576_0142166_1476_2015 | 170 |
| 208 | 3300045051 | Ga0451576_0169606 | Ga0451576_0169606_978_1580 | 170 |
| 209 | 3300046454 | Ga0495592_0139503 | Ga0495592_0139503_558_1097 | 170 |
| 210 | 3300046460 | Ga0495638_0000013 | Ga0495638_0000013_383802_384320 | 170 |
| 211 | 3300046500 | Ga0495596_0000248 | Ga0495596_0000248_27956_28474 | 170 |
| 212 | 3300046543 | Ga0495645_0095843 | Ga0495645_0095843_306_845 | 170 |
| 213 | 3300046675 | Ga0495657_0506544 | Ga0495657_0506544_52_591 | 170 |
| 214 | 3300046679 | Ga0495623_0387776 | Ga0495623_0387776_92_631 | 170 |
| 215 | 3300046689 | Ga0495613_0298044 | Ga0495613_0298044_353_871 | 170 |
| 216 | 3300047317 | Ga0495604_0416534 | Ga0495604_0416534_227_766 | 170 |
| 217 | 3300048913 | Ga0496110_0802843 | Ga0496110_0802843_180_695 | 170 |
| 218 | 3300048927 | Ga0496124_0315682 | Ga0496124_0315682_316_834 | 170 |
| 219 | 3300048928 | Ga0496125_0017949 | Ga0496125_0017949_3682_4200 | 170 |
| 220 | 3300048929 | Ga0496126_0001597 | Ga0496126_0001597_22396_22914 | 170 |
| 221 | 3300049649 | Ga0501198_031135 | Ga0501198_031135_307_822 | 170 |
| 222 | 3300049657 | Ga0501210_000188 | Ga0501210_000188_1392_1931 | 170 |
| 223 | 3300049661 | Ga0501217_003407 | Ga0501217_003407_763_1323 | 170 |
| 224 | 3300049663 | Ga0501223_019800 | Ga0501223_019800_272_787 | 170 |
| 225 | 3300049670 | Ga0501236_002729 | Ga0501236_002729_1299_1838 | 170 |
| 226 | 3300049677 | Ga0501247_005189 | Ga0501247_005189_333_893 | 170 |
| 227 | 3300049686 | Ga0501257_001997 | Ga0501257_001997_3046_3585 | 170 |
| 228 | 3300049758 | Ga0501241_001226 | Ga0501241_001226_1824_2339 | 170 |
| 229 | 3300049761 | Ga0501264_001233 | Ga0501264_001233_1381_1920 | 170 |
| 230 | 3300049768 | Ga0501271_009975 | Ga0501271_009975_288_848 | 170 |
| 231 | 3300050508 | nmdc:mga09592_564090_c1 | nmdc:mga09592_564090_c1_264_803 | 170 |
| 232 | 3300050511 | nmdc:mga08y16_119437_c1 | nmdc:mga08y16_119437_c1_1969_2508 | 170 |
| 233 | 3300050511 | nmdc:mga08y16_201938_c1 | nmdc:mga08y16_201938_c1_185_724 | 170 |
| 234 | 3300053105 | Ga0500557_124970 | Ga0500557_124970_135_704 | 170 |
| 235 | 3300053133 | Ga0500655_002920 | Ga0500655_002920_2121_2666 | 170 |
| 236 | 3300053133 | Ga0500655_039879 | Ga0500655_039879_278_796 | 170 |
| 237 | 3300053151 | Ga0500604_0004000 | Ga0500604_0004000_2163_2756 | 170 |
| 238 | 3300053153 | Ga0500616_0000013 | Ga0500616_0000013_402707_403225 | 170 |
| 239 | 3300053156 | Ga0500622_0000024 | Ga0500622_0000024_143489_144082 | 170 |
| 240 | 3300053156 | Ga0500622_0005910 | Ga0500622_0005910_1587_2126 | 170 |
| 241 | 3300053156 | Ga0500622_0010736 | Ga0500622_0010736_10_549 | 170 |
| 242 | 3300053158 | Ga0500627_0061699 | Ga0500627_0061699_974_1513 | 170 |
| 243 | 3300053158 | Ga0500627_0240581 | Ga0500627_0240581_137_736 | 170 |
| 244 | iso_pu_bacteria | 2582581278 | 2585141724 | 170 |
| 245 | iso_pu_bacteria | 2585428061 | 2587752995 | 170 |
| 246 | iso_pu_bacteria | 2585428182 | 2588207958 | 170 |
| 247 | iso_pu_bacteria | 2585428183 | 2588215000 | 170 |
| 248 | iso_pu_bacteria | 2585428184 | 2588217377 | 170 |
| 249 | iso_pu_bacteria | 2585428185 | 2588223939 | 170 |
| 250 | iso_pu_bacteria | 2585428187 | 2588234263 | 170 |
| 251 | iso_pu_bacteria | 2588253712 | 2588444672 | 170 |
| 252 | iso_pu_bacteria | 2588254257 | 2590612101 | 170 |
| 253 | iso_pu_bacteria | 2765235839 | 2765576525 | 170 |
| 254 | iso_pu_bacteria | 2816332188 | 2816873257 | 170 |
| 255 | iso_pu_bacteria | 2889290771 | 2889292977 | 170 |
| 256 | iso_pu_bacteria | 2890804823 | 2890805584 | 170 |
| 257 | iso_pu_bacteria | 2919399522 | 2919400153 | 170 |
| 258 | iso_pu_bacteria | 2919692658 | 2919694701 | 170 |
| 259 | iso_pu_bacteria | 2946019816 | 2946021008 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w5y-assembly1.cif.gz_K | cryo-em structure of soxs-dependent transcription activation complex with fpr promoter dna | 0.8975 | 52 | 159 |
| 3oio-assembly1.cif.gz_A | crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum | 0.8795 | 52 | 159 |
| 7w5w-assembly1.cif.gz_J | cryo-em structure of soxs-dependent transcription activation complex with micf promoter dna | 0.8724 | 50 | 157 |
| 3mkl-assembly2.cif.gz_B | crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 | 0.8687 | 54 | 163 |
| 3oou-assembly1.cif.gz_A | the structure of a protein with unkown function from listeria innocua | 0.8652 | 55 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1d5yD02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9599 | 112 | 159 | 1.10.10.60 |
| 1bl0A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9485 | 116 | 158 | 1.10.10.60 |
| 1xs9A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9417 | 116 | 159 | 1.10.10.60 |
| 3lsgA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9327 | 114 | 158 | 1.10.10.60 |
| 3lsgB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9129 | 114 | 158 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6DAG6-F1-model_v4 | deleted | 0.9648 | 55 | 167 |
|
| AF-A0A522DYU4-F1-model_v4 | AraC family transcriptional regulator | 0.9583 | 50 | 164 |
GO:0003700
GO:0043565 |
| AF-A0A4Q6CVP3-F1-model_v4 | deleted | 0.9413 | 51 | 163 |
|
| AF-A0A4Q6DAG6-F1-model_v4 | deleted | 0.9406 | 55 | 167 |
|
| AF-A0A5M8Q4D7-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.939 | 46 | 165 |
GO:0003700
GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar