F368906

General Info

Members Datasets Scaffolds Average Seq Length
259 175 239 179

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10395972|Ga0307515_103959721
Length 207
Sequence MQLMSGKVQLAIAPHSLATARTKLYIKYMVSLRCKMIVKEELIKLGLNFIAIDLGVVEMLGEITSSQRDQLKANLLKSGLELLDDKKSILIEKIKGVIIELIHYSDELPKVNYSDYISEKLNYDYTYLSNVFSEVKGITIQHFIIIHKIERVKELLLYDELNLTEIAFKLHYSSVAHLSNQFKKVTGLSPSYFKQLKQKRKDNLENM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
4 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
5 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
6 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
7 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
8 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
9 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
10 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
11 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
12 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
13 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
14 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
15 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
16 2914759650 Rhizosphaericola mali Isolate Rhizosphere
17 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
18 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
19 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
162 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
163 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
164 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
165 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
166 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
167 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
171 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
172 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.03
Metatranscriptomes 5.02
Isolates 6.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 0
Rhizoplane 1.54
Rhizosphere 81.85
Stem 0
Stem Tuber 0
Unclassified 10.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI24737J22298_10139430 3300001990 Bacteria 716
3 Ga0006758J48902_1029552 3300003300 Bacteria 669
4 rootH1_10010080 3300003316 Bacteria 5637
5 rootH2_10002508 3300003320 Bacteria 42556
6 rootH2_10205943 3300003320 Bacteria 3335
7 rootL2_10010620 3300003322 Bacteria 20251
8 rootL2_10011628 3300003322 Bacteria 7797
9 rootL2_10181321 3300003322 Bacteria 1272
10 rootH1_10013477 3300003323 Bacteria 7020
11 rootH1_10039819 3300003323 Bacteria 1294
12 rootH1_10267515 3300003323 Bacteria 5435
13 Ga0032354_1051284 3300003693 Bacteria 692
14 Ga0055531_10000067 3300003794 Bacteria 114289
15 Ga0058863_10846910 3300004799 Bacteria 837
16 Ga0065165_1000927 3300005262 Bacteria 37617
17 Ga0065704_10070140 3300005289 Bacteria 482257
18 Ga0065704_10079314 3300005289 Bacteria 4197
19 Ga0065704_10085342 3300005289 Bacteria 3231
20 Ga0065704_10089093 3300005289 Bacteria 2886
21 Ga0070658_10406840 3300005327 Bacteria 1169
22 Ga0070683_100087575 3300005329 Bacteria 2921
23 Ga0070683_100093378 3300005329 Bacteria 2827
24 Ga0070690_100167412 3300005330 Bacteria 1510
25 Ga0070666_10025453 3300005335 Bacteria 3858
26 Ga0070680_100212355 3300005336 Unclassified 1633
27 Ga0070682_100000044 3300005337 Bacteria 133653
28 Ga0070682_100000493 3300005337 Bacteria 24795
29 Ga0070682_100027228 3300005337 Bacteria 3429
30 Ga0070660_100005869 3300005339 Bacteria 8498
31 Ga0070661_100006237 3300005344 Bacteria 8221
32 Ga0070661_100037944 3300005344 Bacteria 3506
33 Ga0070661_100179104 3300005344 Bacteria 1612
34 Ga0070675_100143776 3300005354 Bacteria 2040
35 Ga0070673_100048535 3300005364 Bacteria 3310
36 Ga0070659_100004142 3300005366 Bacteria 10339
37 Ga0070713_100339110 3300005436 Bacteria 1392
38 Ga0070662_100033541 3300005457 Bacteria 3615
39 Ga0070681_10038300 3300005458 Bacteria 4808
40 Ga0068867_100357861 3300005459 Bacteria 1220
41 Ga0068867_100755402 3300005459 Bacteria 863
42 Ga0070679_100112401 3300005530 Bacteria 2710
43 Ga0070684_100022651 3300005535 Bacteria 5243
44 Ga0070684_100069084 3300005535 Bacteria 3106
45 Ga0068853_100007902 3300005539 Bacteria 8530
46 Ga0068853_100013250 3300005539 Bacteria 6731
47 Ga0068853_100020744 3300005539 Bacteria 5465
48 Ga0070665_100499725 3300005548 Unclassified 1227
49 Ga0068855_100015279 3300005563 Bacteria 9240
50 Ga0068855_100421324 3300005563 Bacteria 1460
51 Ga0068855_100460237 3300005563 Unclassified 1387
52 Ga0068855_100472754 3300005563 Bacteria 1365
53 Ga0070664_100004993 3300005564 Bacteria 10628
54 Ga0070664_100040969 3300005564 Bacteria 3907
55 Ga0068857_100016824 3300005577 Bacteria 6406
56 Ga0068854_100144117 3300005578 Bacteria 1831
57 Ga0068856_100004592 3300005614 Bacteria 13734
58 Ga0068852_100124660 3300005616 Bacteria 2363
59 Ga0068859_100000551 3300005617 Bacteria 37187
60 Ga0068864_100263356 3300005618 Unclassified 1604
61 Ga0068863_100061870 3300005841 Bacteria 3540
62 Ga0068863_100367732 3300005841 Bacteria 1403
63 Ga0068860_100706267 3300005843 Bacteria 1018
64 Ga0070716_100188362 3300006173 Bacteria 1361
65 Ga0097621_100234761 3300006237 Unclassified 1602
66 Ga0068871_100026123 3300006358 Bacteria 4553
67 Ga0075429_100891809 3300006880 Unclassified 778
68 Ga0097620_100000551 3300006931 Bacteria 37187
69 Ga0105244_10000043 3300009036 Bacteria 150556
70 Ga0105250_10043940 3300009092 Bacteria 1792
71 Ga0105240_10124463 3300009093 Unclassified 3101
72 Ga0111539_10009310 3300009094 Bacteria 12403
73 Ga0111539_10051579 3300009094 Bacteria 4899
74 Ga0105245_10192355 3300009098 Bacteria 1955
75 Ga0105239_10591728 3300010375 Unclassified 1265
76 Ga0157373_10009280 3300013100 Bacteria 7273
77 Ga0157371_10057839 3300013102 Bacteria 2750
78 Ga0157371_10086834 3300013102 Bacteria 2215
79 Ga0157371_10159879 3300013102 Bacteria 1609
80 Ga0157371_10220208 3300013102 Bacteria 1363
81 Ga0157370_10004244 3300013104 Bacteria 16560
82 Ga0157370_10091821 3300013104 Bacteria 2850
83 Ga0157370_10217650 3300013104 Bacteria 1769
84 Ga0157370_10384676 3300013104 Bacteria 1292
85 Ga0157370_11257074 3300013104 Bacteria 667
86 Ga0157369_10006103 3300013105 Bacteria 13988
87 Ga0157374_10058579 3300013296 Bacteria 3599
88 Ga0157378_10187912 3300013297 Bacteria 1947
89 Ga0157378_10468633 3300013297 Unclassified 1253
90 Ga0157378_10549155 3300013297 Unclassified 1160
91 Ga0163162_10005051 3300013306 Bacteria 12711
92 Ga0163162_10297640 3300013306 Unclassified 1745
93 Ga0163162_11800004 3300013306 Bacteria 700
94 Ga0157372_10000250 3300013307 Bacteria 59465
95 Ga0157372_10006422 3300013307 Bacteria 12513
96 Ga0157372_10611461 3300013307 Bacteria 1270
97 Ga0157372_11682694 3300013307 Bacteria 730
98 Ga0157375_10000174 3300013308 Bacteria 59683
99 Ga0157375_10403620 3300013308 Unclassified 1533
100 Ga0157375_10810239 3300013308 Bacteria 1085
101 Ga0157380_10007662 3300014326 Bacteria 7680
102 Ga0157380_10089442 3300014326 Unclassified 2537
103 Ga0157376_10044788 3300014969 Bacteria 3639
104 Ga0157376_10341194 3300014969 Unclassified 1431
105 Ga0163161_10182300 3300017792 Bacteria 1611
106 Ga0163161_10254860 3300017792 Bacteria 1368
107 Ga0163161_10573716 3300017792 Bacteria 927
108 Ga0206356_11733222 3300020070 Bacteria 707
109 Ga0206356_11752955 3300020070 Bacteria 706
110 Ga0206349_1742919 3300020075 Bacteria 1115
111 Ga0206352_10053850 3300020078 Bacteria 1191
112 Ga0206354_10521535 3300020081 Bacteria 979
113 Ga0206353_10943740 3300020082 Bacteria 968
114 Ga0154015_1502011 3300020610 Bacteria 660
115 Ga0224712_10083904 3300022467 Bacteria 1321
116 Ga0209050_1001749 3300025298 Bacteria 21577
117 Ga0209050_1020005 3300025298 Bacteria 2512
118 Ga0209257_1000005 3300025304 Bacteria 1592528
119 Ga0207655_1000225 3300025728 Bacteria 94983
120 Ga0207680_10548490 3300025903 Bacteria 825
121 Ga0207705_10228364 3300025909 Unclassified 1415
122 Ga0207707_10260401 3300025912 Unclassified 1505
123 Ga0207660_10277754 3300025917 Unclassified 1328
124 Ga0207657_10000998 3300025919 Bacteria 30073
125 Ga0207649_10006290 3300025920 Bacteria 6452
126 Ga0207652_10120517 3300025921 Unclassified 2334
127 Ga0207659_10949595 3300025926 Bacteria 739
128 Ga0207700_10646622 3300025928 Unclassified 943
129 Ga0207706_10011699 3300025933 Bacteria 8001
130 Ga0207709_10000217 3300025935 Bacteria 72596
131 Ga0207665_10186279 3300025939 Bacteria 1506
132 Ga0207661_10071975 3300025944 Bacteria 2827
133 Ga0207661_10096932 3300025944 Bacteria 2468
134 Ga0207679_10009351 3300025945 Bacteria 6278
135 Ga0207679_10214647 3300025945 Unclassified 1616
136 Ga0207667_10245517 3300025949 Bacteria 1832
137 Ga0207651_10653115 3300025960 Bacteria 923
138 Ga0207640_10095677 3300025981 Bacteria 2069
139 Ga0207639_10008726 3300026041 Bacteria 6959
140 Ga0207702_10017885 3300026078 Bacteria 5866
141 Ga0207702_10206155 3300026078 Bacteria 1825
142 Ga0207641_10117044 3300026088 Bacteria 2372
143 Ga0207641_10325785 3300026088 Bacteria 1458
144 Ga0207676_10489310 3300026095 Unclassified 1166
145 Ga0207674_10013623 3300026116 Bacteria 9007
146 Ga0207674_10027439 3300026116 Bacteria 6022
147 Ga0207428_10029141 3300027907 Bacteria 4579
148 Ga0268266_10551823 3300028379 Unclassified 1104
149 Ga0307515_10000001 3300028794 Bacteria 4259510
150 Ga0307515_10395972 3300028794 Unclassified 1008
151 Ga0265327_10000577 3300031251 Bacteria 62128
152 Ga0307509_10109494 3300031507 Bacteria 2772
153 Ga0307408_100000346 3300031548 Bacteria 43502
154 Ga0307408_100000626 3300031548 Bacteria 30050
155 Ga0307408_100091365 3300031548 Bacteria 2299
156 Ga0307412_10029618 3300031911 Bacteria 3438
157 Ga0307414_10122450 3300032004 Bacteria 2002
158 Ga0307411_10002911 3300032005 Bacteria 7754
159 Ga0373927_0011544 3300035695 Bacteria 5884
160 Ga0373937_0258298 3300036401 Unclassified 1643
161 Ga0373937_0374656 3300036401 Unclassified 1350
162 Ga0395905_0497358 3300037471 Unclassified 1119
163 Ga0439445_0083368 3300042004 Bacteria 895
164 Ga0451577_0000690 3300042876 Bacteria 52905
165 Ga0451577_0015333 3300042876 Bacteria 7131
166 Ga0451577_0056089 3300042876 Bacteria 3514
167 Ga0451577_0061543 3300042876 Bacteria 3348
168 Ga0451577_0195324 3300042876 Unclassified 1826
169 Ga0451577_0405624 3300042876 Bacteria 1237
170 Ga0451577_1107851 3300042876 Bacteria 708
171 Ga0453683_0095187 3300044673 Bacteria 1868
172 Ga0453684_0001862 3300044712 Bacteria 55001
173 Ga0453684_0003857 3300044712 Bacteria 33022
174 Ga0453684_0007797 3300044712 Bacteria 19527
175 Ga0453684_0009088 3300044712 Bacteria 17520
176 Ga0453684_0014970 3300044712 Bacteria 12326
177 Ga0453684_0081228 3300044712 Bacteria 4044
178 Ga0453684_0091603 3300044712 Bacteria 3752
179 Ga0453684_0194677 3300044712 Unclassified 2368
180 Ga0451576_0001696 3300045051 Bacteria 36431
181 Ga0451576_0087467 3300045051 Bacteria 3241
182 Ga0451576_0142166 3300045051 Bacteria 2502
183 Ga0451576_0169606 3300045051 Unclassified 2278
184 Ga0451576_0204674 3300045051 Bacteria 2061
185 Ga0495592_0139503 3300046454 Bacteria 1688
186 Ga0495638_0000013 3300046460 Bacteria 430133
187 Ga0495596_0000248 3300046500 Bacteria 35866
188 Ga0495616_0014873 3300046513 Bacteria 4342
189 Ga0495643_0001275 3300046522 Bacteria 24157
190 Ga0495645_0095843 3300046543 Unclassified 2115
191 Ga0495625_0112874 3300046660 Bacteria 1856
192 Ga0495657_0506544 3300046675 Bacteria 704
193 Ga0495623_0387776 3300046679 Unclassified 754
194 Ga0495613_0298044 3300046689 Bacteria 1117
195 Ga0495604_0416534 3300047317 Bacteria 882
196 Ga0496104_0225358 3300048907 Bacteria 1787
197 Ga0496110_0802843 3300048913 Bacteria 845
198 Ga0496110_0965279 3300048913 Unclassified 759
199 Ga0496113_0163074 3300048916 Bacteria 1763
200 Ga0496116_0000012 3300048919 Bacteria 611365
201 Ga0496117_0001405 3300048920 Bacteria 34964
202 Ga0496119_0001680 3300048922 Bacteria 25858
203 Ga0496120_0135134 3300048923 Bacteria 1258
204 Ga0496122_0000091 3300048925 Bacteria 204567
205 Ga0496122_0002557 3300048925 Bacteria 25565
206 Ga0496123_0016950 3300048926 Bacteria 5884
207 Ga0496123_0305781 3300048926 Bacteria 757
208 Ga0496124_0006441 3300048927 Bacteria 12794
209 Ga0496124_0315682 3300048927 Bacteria 1122
210 Ga0496125_0010953 3300048928 Bacteria 9111
211 Ga0496125_0017949 3300048928 Bacteria 6727
212 Ga0496126_0001597 3300048929 Bacteria 34515
213 Ga0501306_035674 3300049127 Bacteria 755
214 Ga0501320_023087 3300049536 Bacteria 733
215 Ga0501198_031135 3300049649 Bacteria 891
216 Ga0501210_000188 3300049657 Bacteria 2468
217 Ga0501217_003407 3300049661 Bacteria 3212
218 Ga0501223_004306 3300049663 Bacteria 3058
219 Ga0501223_019800 3300049663 Bacteria 1321
220 Ga0501236_002729 3300049670 Bacteria 2034
221 Ga0501247_005189 3300049677 Bacteria 1444
222 Ga0501257_001997 3300049686 Bacteria 4254
223 Ga0501241_001226 3300049758 Bacteria 5323
224 Ga0501264_001233 3300049761 Bacteria 2899
225 Ga0501271_009975 3300049768 Bacteria 995
226 Ga0501204_002959 3300049850 Bacteria 1754
227 nmdc:mga09592_564090_c1 3300050508 Bacteria 977
228 nmdc:mga08y16_119437_c1 3300050511 Bacteria 2744
229 nmdc:mga08y16_201938_c1 3300050511 Bacteria 2060
230 Ga0500557_124970 3300053105 Bacteria 853
231 Ga0500655_002920 3300053133 Bacteria 3105
232 Ga0500655_039879 3300053133 Bacteria 920
233 Ga0500604_0004000 3300053151 Bacteria 3935
234 Ga0500616_0000013 3300053153 Bacteria 674172
235 Ga0500622_0000024 3300053156 Bacteria 249623
236 Ga0500622_0005910 3300053156 Bacteria 7217
237 Ga0500622_0010736 3300053156 Bacteria 5012
238 Ga0500627_0061699 3300053158 Unclassified 1650
239 Ga0500627_0240581 3300053158 Bacteria 803

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10089093 Ga0065704_100890932 157
2 3300005337 Ga0070682_100000493 Ga0070682_10000049312 157
3 3300025935 Ga0207709_10000217 Ga0207709_1000021748 157
4 3300031548 Ga0307408_100000346 Ga0307408_10000034619 157
5 3300048916 Ga0496113_0163074 Ga0496113_0163074_326_865 157
6 3300048919 Ga0496116_0000012 Ga0496116_0000012_453207_453746 157
7 3300048920 Ga0496117_0001405 Ga0496117_0001405_15456_15995 157
8 3300048922 Ga0496119_0001680 Ga0496119_0001680_15585_16124 157
9 3300048923 Ga0496120_0135134 Ga0496120_0135134_460_999 157
10 3300048925 Ga0496122_0002557 Ga0496122_0002557_21387_21926 157
11 3300048926 Ga0496123_0016950 Ga0496123_0016950_1045_1584 157
12 3300048927 Ga0496124_0006441 Ga0496124_0006441_2398_2937 157
13 3300048928 Ga0496125_0010953 Ga0496125_0010953_4256_4795 157
14 3300005618 Ga0068864_100263356 Ga0068864_1002633562 159
15 3300026095 Ga0207676_10489310 Ga0207676_104893102 159
16 3300049850 Ga0501204_002959 Ga0501204_002959_402_962 159
17 3300003322 rootL2_10011628 rootL2_100116282 160
18 3300005329 Ga0070683_100093378 Ga0070683_1000933783 160
19 3300005344 Ga0070661_100006237 Ga0070661_1000062373 160
20 3300005535 Ga0070684_100069084 Ga0070684_1000690842 160
21 3300005539 Ga0068853_100007902 Ga0068853_1000079023 160
22 3300005564 Ga0070664_100004993 Ga0070664_1000049939 160
23 3300005577 Ga0068857_100016824 Ga0068857_1000168248 160
24 3300025920 Ga0207649_10006290 Ga0207649_100062903 160
25 3300025944 Ga0207661_10071975 Ga0207661_100719753 160
26 3300025945 Ga0207679_10009351 Ga0207679_100093517 160
27 3300026041 Ga0207639_10008726 Ga0207639_100087266 160
28 3300026116 Ga0207674_10013623 Ga0207674_100136234 160
29 3300048925 Ga0496122_0000091 Ga0496122_0000091_133504_134043 160
30 3300048926 Ga0496123_0305781 Ga0496123_0305781_180_719 160
31 3300013297 Ga0157378_10468633 Ga0157378_104686331 161
32 3300006237 Ga0097621_100234761 Ga0097621_1002347611 162
33 3300006358 Ga0068871_100026123 Ga0068871_1000261232 162
34 3300013308 Ga0157375_10403620 Ga0157375_104036202 162
35 3300017792 Ga0163161_10254860 Ga0163161_102548601 162
36 3300005841 Ga0068863_100061870 Ga0068863_1000618703 166
37 3300026088 Ga0207641_10117044 Ga0207641_101170443 166
38 iso_pu_bacteria 2585428060 2587748286 167
39 iso_pu_bacteria 2914759650 2914760663 167
40 3300048907 Ga0496104_0225358 Ga0496104_0225358_936_1469 168
41 3300004799 Ga0058863_10846910 Ga0058863_108469101 169
42 3300005327 Ga0070658_10406840 Ga0070658_104068402 169
43 3300005563 Ga0068855_100460237 Ga0068855_1004602372 169
44 3300009093 Ga0105240_10124463 Ga0105240_101244633 169
45 3300013307 Ga0157372_11682694 Ga0157372_116826941 169
46 3300045051 Ga0451576_0204674 Ga0451576_0204674_775_1287 169
47 3300046513 Ga0495616_0014873 Ga0495616_0014873_1276_1803 169
48 3300046522 Ga0495643_0001275 Ga0495643_0001275_2603_3130 169
49 3300046660 Ga0495625_0112874 Ga0495625_0112874_643_1170 169
50 3300048913 Ga0496110_0965279 Ga0496110_0965279_70_582 169
51 3300049127 Ga0501306_035674 Ga0501306_035674_144_659 169
52 3300049536 Ga0501320_023087 Ga0501320_023087_181_696 169
53 3300049663 Ga0501223_004306 Ga0501223_004306_1024_1539 169
54 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00007420 170
55 3300001990 JGI24737J22298_10139430 JGI24737J22298_101394301 170
56 3300003300 Ga0006758J48902_1029552 Ga0006758J48902_10295521 170
57 3300003316 rootH1_10010080 rootH1_100100804 170
58 3300003320 rootH2_10002508 rootH2_1000250840 170
59 3300003320 rootH2_10205943 rootH2_102059433 170
60 3300003322 rootL2_10010620 rootL2_1001062012 170
61 3300003322 rootL2_10181321 rootL2_101813212 170
62 3300003323 rootH1_10013477 rootH1_100134772 170
63 3300003323 rootH1_10039819 rootH1_100398192 170
64 3300003323 rootH1_10267515 rootH1_102675158 170
65 3300003693 Ga0032354_1051284 Ga0032354_10512841 170
66 3300003794 Ga0055531_10000067 Ga0055531_1000006718 170
67 3300005262 Ga0065165_1000927 Ga0065165_100092712 170
68 3300005289 Ga0065704_10070140 Ga0065704_10070140192 170
69 3300005289 Ga0065704_10079314 Ga0065704_100793143 170
70 3300005289 Ga0065704_10085342 Ga0065704_100853425 170
71 3300005329 Ga0070683_100087575 Ga0070683_1000875755 170
72 3300005330 Ga0070690_100167412 Ga0070690_1001674122 170
73 3300005335 Ga0070666_10025453 Ga0070666_100254535 170
74 3300005336 Ga0070680_100212355 Ga0070680_1002123552 170
75 3300005337 Ga0070682_100000044 Ga0070682_10000004483 170
76 3300005337 Ga0070682_100027228 Ga0070682_1000272284 170
77 3300005339 Ga0070660_100005869 Ga0070660_1000058695 170
78 3300005344 Ga0070661_100037944 Ga0070661_1000379443 170
79 3300005344 Ga0070661_100179104 Ga0070661_1001791043 170
80 3300005354 Ga0070675_100143776 Ga0070675_1001437763 170
81 3300005364 Ga0070673_100048535 Ga0070673_1000485355 170
82 3300005366 Ga0070659_100004142 Ga0070659_1000041426 170
83 3300005436 Ga0070713_100339110 Ga0070713_1003391102 170
84 3300005457 Ga0070662_100033541 Ga0070662_1000335416 170
85 3300005458 Ga0070681_10038300 Ga0070681_100383007 170
86 3300005459 Ga0068867_100357861 Ga0068867_1003578612 170
87 3300005459 Ga0068867_100755402 Ga0068867_1007554021 170
88 3300005530 Ga0070679_100112401 Ga0070679_1001124013 170
89 3300005535 Ga0070684_100022651 Ga0070684_1000226517 170
90 3300005539 Ga0068853_100013250 Ga0068853_1000132503 170
91 3300005539 Ga0068853_100020744 Ga0068853_1000207445 170
92 3300005548 Ga0070665_100499725 Ga0070665_1004997252 170
93 3300005563 Ga0068855_100015279 Ga0068855_10001527920 170
94 3300005563 Ga0068855_100421324 Ga0068855_1004213242 170
95 3300005563 Ga0068855_100472754 Ga0068855_1004727542 170
96 3300005564 Ga0070664_100040969 Ga0070664_1000409696 170
97 3300005578 Ga0068854_100144117 Ga0068854_1001441172 170
98 3300005614 Ga0068856_100004592 Ga0068856_1000045929 170
99 3300005616 Ga0068852_100124660 Ga0068852_1001246605 170
100 3300005617 Ga0068859_100000551 Ga0068859_1000005516 170
101 3300005617 Ga0068859_100000551 Ga0068859_1000005518 170
102 3300005841 Ga0068863_100367732 Ga0068863_1003677323 170
103 3300005843 Ga0068860_100706267 Ga0068860_1007062672 170
104 3300006173 Ga0070716_100188362 Ga0070716_1001883622 170
105 3300006880 Ga0075429_100891809 Ga0075429_1008918091 170
106 3300006931 Ga0097620_100000551 Ga0097620_1000005516 170
107 3300006931 Ga0097620_100000551 Ga0097620_1000005518 170
108 3300009036 Ga0105244_10000043 Ga0105244_10000043143 170
109 3300009092 Ga0105250_10043940 Ga0105250_100439403 170
110 3300009094 Ga0111539_10009310 Ga0111539_100093108 170
111 3300009094 Ga0111539_10051579 Ga0111539_100515796 170
112 3300009098 Ga0105245_10192355 Ga0105245_101923551 170
113 3300010375 Ga0105239_10591728 Ga0105239_105917281 170
114 3300013100 Ga0157373_10009280 Ga0157373_100092804 170
115 3300013102 Ga0157371_10057839 Ga0157371_100578392 170
116 3300013102 Ga0157371_10086834 Ga0157371_100868343 170
117 3300013102 Ga0157371_10159879 Ga0157371_101598793 170
118 3300013102 Ga0157371_10220208 Ga0157371_102202082 170
119 3300013104 Ga0157370_10004244 Ga0157370_1000424413 170
120 3300013104 Ga0157370_10091821 Ga0157370_100918211 170
121 3300013104 Ga0157370_10217650 Ga0157370_102176502 170
122 3300013104 Ga0157370_10384676 Ga0157370_103846762 170
123 3300013104 Ga0157370_11257074 Ga0157370_112570741 170
124 3300013105 Ga0157369_10006103 Ga0157369_1000610310 170
125 3300013296 Ga0157374_10058579 Ga0157374_100585797 170
126 3300013297 Ga0157378_10187912 Ga0157378_101879121 170
127 3300013297 Ga0157378_10549155 Ga0157378_105491552 170
128 3300013306 Ga0163162_10005051 Ga0163162_100050517 170
129 3300013306 Ga0163162_10297640 Ga0163162_102976402 170
130 3300013306 Ga0163162_11800004 Ga0163162_118000041 170
131 3300013307 Ga0157372_10000250 Ga0157372_1000025025 170
132 3300013307 Ga0157372_10006422 Ga0157372_1000642216 170
133 3300013307 Ga0157372_10611461 Ga0157372_106114611 170
134 3300013308 Ga0157375_10000174 Ga0157375_1000017428 170
135 3300013308 Ga0157375_10810239 Ga0157375_108102392 170
136 3300014326 Ga0157380_10007662 Ga0157380_100076622 170
137 3300014326 Ga0157380_10089442 Ga0157380_100894424 170
138 3300014969 Ga0157376_10044788 Ga0157376_100447883 170
139 3300014969 Ga0157376_10341194 Ga0157376_103411943 170
140 3300017792 Ga0163161_10182300 Ga0163161_101823001 170
141 3300017792 Ga0163161_10573716 Ga0163161_105737162 170
142 3300020070 Ga0206356_11733222 Ga0206356_117332221 170
143 3300020070 Ga0206356_11752955 Ga0206356_117529551 170
144 3300020075 Ga0206349_1742919 Ga0206349_17429192 170
145 3300020078 Ga0206352_10053850 Ga0206352_100538501 170
146 3300020081 Ga0206354_10521535 Ga0206354_105215352 170
147 3300020082 Ga0206353_10943740 Ga0206353_109437402 170
148 3300020610 Ga0154015_1502011 Ga0154015_15020111 170
149 3300022467 Ga0224712_10083904 Ga0224712_100839043 170
150 3300025298 Ga0209050_1001749 Ga0209050_10017497 170
151 3300025298 Ga0209050_1020005 Ga0209050_10200053 170
152 3300025304 Ga0209257_1000005 Ga0209257_1000005581 170
153 3300025728 Ga0207655_1000225 Ga0207655_10002259 170
154 3300025903 Ga0207680_10548490 Ga0207680_105484901 170
155 3300025909 Ga0207705_10228364 Ga0207705_102283641 170
156 3300025912 Ga0207707_10260401 Ga0207707_102604012 170
157 3300025917 Ga0207660_10277754 Ga0207660_102777542 170
158 3300025919 Ga0207657_10000998 Ga0207657_1000099811 170
159 3300025921 Ga0207652_10120517 Ga0207652_101205173 170
160 3300025926 Ga0207659_10949595 Ga0207659_109495951 170
161 3300025928 Ga0207700_10646622 Ga0207700_106466221 170
162 3300025933 Ga0207706_10011699 Ga0207706_100116998 170
163 3300025939 Ga0207665_10186279 Ga0207665_101862792 170
164 3300025944 Ga0207661_10096932 Ga0207661_100969321 170
165 3300025945 Ga0207679_10214647 Ga0207679_102146472 170
166 3300025949 Ga0207667_10245517 Ga0207667_102455172 170
167 3300025960 Ga0207651_10653115 Ga0207651_106531151 170
168 3300025981 Ga0207640_10095677 Ga0207640_100956772 170
169 3300026078 Ga0207702_10017885 Ga0207702_100178853 170
170 3300026078 Ga0207702_10206155 Ga0207702_102061551 170
171 3300026088 Ga0207641_10325785 Ga0207641_103257853 170
172 3300026116 Ga0207674_10027439 Ga0207674_100274392 170
173 3300027907 Ga0207428_10029141 Ga0207428_100291414 170
174 3300028379 Ga0268266_10551823 Ga0268266_105518231 170
175 3300028794 Ga0307515_10000001 Ga0307515_100000012532 170
176 3300028794 Ga0307515_10395972 Ga0307515_103959721 170
177 3300031251 Ga0265327_10000577 Ga0265327_100005779 170
178 3300031507 Ga0307509_10109494 Ga0307509_101094943 170
179 3300031548 Ga0307408_100000626 Ga0307408_10000062623 170
180 3300031548 Ga0307408_100091365 Ga0307408_1000913651 170
181 3300031911 Ga0307412_10029618 Ga0307412_100296187 170
182 3300032004 Ga0307414_10122450 Ga0307414_101224501 170
183 3300032005 Ga0307411_10002911 Ga0307411_100029117 170
184 3300035695 Ga0373927_0011544 Ga0373927_0011544_3071_3631 170
185 3300036401 Ga0373937_0258298 Ga0373937_0258298_653_1171 170
186 3300036401 Ga0373937_0374656 Ga0373937_0374656_707_1225 170
187 3300037471 Ga0395905_0497358 Ga0395905_0497358_350_889 170
188 3300042004 Ga0439445_0083368 Ga0439445_0083368_171_710 170
189 3300042876 Ga0451577_0000690 Ga0451577_0000690_24940_25512 170
190 3300042876 Ga0451577_0015333 Ga0451577_0015333_6476_7015 170
191 3300042876 Ga0451577_0056089 Ga0451577_0056089_1199_1747 170
192 3300042876 Ga0451577_0061543 Ga0451577_0061543_2069_2629 170
193 3300042876 Ga0451577_0195324 Ga0451577_0195324_492_1031 170
194 3300042876 Ga0451577_0405624 Ga0451577_0405624_565_1113 170
195 3300042876 Ga0451577_1107851 Ga0451577_1107851_45_563 170
196 3300044673 Ga0453683_0095187 Ga0453683_0095187_476_991 170
197 3300044712 Ga0453684_0001862 Ga0453684_0001862_15234_15758 170
198 3300044712 Ga0453684_0003857 Ga0453684_0003857_15032_15550 170
199 3300044712 Ga0453684_0007797 Ga0453684_0007797_13510_14112 170
200 3300044712 Ga0453684_0009088 Ga0453684_0009088_5826_6365 170
201 3300044712 Ga0453684_0014970 Ga0453684_0014970_9681_10220 170
202 3300044712 Ga0453684_0081228 Ga0453684_0081228_1125_1673 170
203 3300044712 Ga0453684_0091603 Ga0453684_0091603_1028_1651 170
204 3300044712 Ga0453684_0194677 Ga0453684_0194677_836_1354 170
205 3300045051 Ga0451576_0001696 Ga0451576_0001696_19287_19811 170
206 3300045051 Ga0451576_0087467 Ga0451576_0087467_148_663 170
207 3300045051 Ga0451576_0142166 Ga0451576_0142166_1476_2015 170
208 3300045051 Ga0451576_0169606 Ga0451576_0169606_978_1580 170
209 3300046454 Ga0495592_0139503 Ga0495592_0139503_558_1097 170
210 3300046460 Ga0495638_0000013 Ga0495638_0000013_383802_384320 170
211 3300046500 Ga0495596_0000248 Ga0495596_0000248_27956_28474 170
212 3300046543 Ga0495645_0095843 Ga0495645_0095843_306_845 170
213 3300046675 Ga0495657_0506544 Ga0495657_0506544_52_591 170
214 3300046679 Ga0495623_0387776 Ga0495623_0387776_92_631 170
215 3300046689 Ga0495613_0298044 Ga0495613_0298044_353_871 170
216 3300047317 Ga0495604_0416534 Ga0495604_0416534_227_766 170
217 3300048913 Ga0496110_0802843 Ga0496110_0802843_180_695 170
218 3300048927 Ga0496124_0315682 Ga0496124_0315682_316_834 170
219 3300048928 Ga0496125_0017949 Ga0496125_0017949_3682_4200 170
220 3300048929 Ga0496126_0001597 Ga0496126_0001597_22396_22914 170
221 3300049649 Ga0501198_031135 Ga0501198_031135_307_822 170
222 3300049657 Ga0501210_000188 Ga0501210_000188_1392_1931 170
223 3300049661 Ga0501217_003407 Ga0501217_003407_763_1323 170
224 3300049663 Ga0501223_019800 Ga0501223_019800_272_787 170
225 3300049670 Ga0501236_002729 Ga0501236_002729_1299_1838 170
226 3300049677 Ga0501247_005189 Ga0501247_005189_333_893 170
227 3300049686 Ga0501257_001997 Ga0501257_001997_3046_3585 170
228 3300049758 Ga0501241_001226 Ga0501241_001226_1824_2339 170
229 3300049761 Ga0501264_001233 Ga0501264_001233_1381_1920 170
230 3300049768 Ga0501271_009975 Ga0501271_009975_288_848 170
231 3300050508 nmdc:mga09592_564090_c1 nmdc:mga09592_564090_c1_264_803 170
232 3300050511 nmdc:mga08y16_119437_c1 nmdc:mga08y16_119437_c1_1969_2508 170
233 3300050511 nmdc:mga08y16_201938_c1 nmdc:mga08y16_201938_c1_185_724 170
234 3300053105 Ga0500557_124970 Ga0500557_124970_135_704 170
235 3300053133 Ga0500655_002920 Ga0500655_002920_2121_2666 170
236 3300053133 Ga0500655_039879 Ga0500655_039879_278_796 170
237 3300053151 Ga0500604_0004000 Ga0500604_0004000_2163_2756 170
238 3300053153 Ga0500616_0000013 Ga0500616_0000013_402707_403225 170
239 3300053156 Ga0500622_0000024 Ga0500622_0000024_143489_144082 170
240 3300053156 Ga0500622_0005910 Ga0500622_0005910_1587_2126 170
241 3300053156 Ga0500622_0010736 Ga0500622_0010736_10_549 170
242 3300053158 Ga0500627_0061699 Ga0500627_0061699_974_1513 170
243 3300053158 Ga0500627_0240581 Ga0500627_0240581_137_736 170
244 iso_pu_bacteria 2582581278 2585141724 170
245 iso_pu_bacteria 2585428061 2587752995 170
246 iso_pu_bacteria 2585428182 2588207958 170
247 iso_pu_bacteria 2585428183 2588215000 170
248 iso_pu_bacteria 2585428184 2588217377 170
249 iso_pu_bacteria 2585428185 2588223939 170
250 iso_pu_bacteria 2585428187 2588234263 170
251 iso_pu_bacteria 2588253712 2588444672 170
252 iso_pu_bacteria 2588254257 2590612101 170
253 iso_pu_bacteria 2765235839 2765576525 170
254 iso_pu_bacteria 2816332188 2816873257 170
255 iso_pu_bacteria 2889290771 2889292977 170
256 iso_pu_bacteria 2890804823 2890805584 170
257 iso_pu_bacteria 2919399522 2919400153 170
258 iso_pu_bacteria 2919692658 2919694701 170
259 iso_pu_bacteria 2946019816 2946021008 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

117

196

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

157

194

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w5y-assembly1.cif.gz_K cryo-em structure of soxs-dependent transcription activation complex with fpr promoter dna 0.8975 52 159
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8795 52 159
7w5w-assembly1.cif.gz_J cryo-em structure of soxs-dependent transcription activation complex with micf promoter dna 0.8724 50 157
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8687 54 163
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.8652 55 160
ID Description Score Start End Superfamily
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9599 112 159 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9485 116 158 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9417 116 159 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9327 114 158 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9129 114 158 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q6DAG6-F1-model_v4 deleted 0.9648 55 167
AF-A0A522DYU4-F1-model_v4 AraC family transcriptional regulator 0.9583 50 164 GO:0003700
GO:0043565
AF-A0A4Q6CVP3-F1-model_v4 deleted 0.9413 51 163
AF-A0A4Q6DAG6-F1-model_v4 deleted 0.9406 55 167
AF-A0A5M8Q4D7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.939 46 165 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
89.45 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map