F368733

General Info

Members Datasets Scaffolds Average Seq Length
259 188 518 153

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100017831|Ga0075428_1000178313
Length 181
Sequence MAARRKKTRRRQARSPGAALSHVETGASGPQSRMVDVGRKPVTARSALARARLRFPAGILRRVLDAGGPKGPVTEVARAAGILAAKRTSDLIPMCHSLGLDHVEIRFEPESGRDPRELEVLCRASLRGRTGVEMEALVGAAVAALAVYDMVKALDHGITIEKVELLEKSGGRSGSWTRNGR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
188 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.39
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0.39
Rhizoplane 0.77
Rhizosphere 93.44
Stem 0
Stem Tuber 0
Unclassified 6.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100017831 3300006844 Bacteria 7845
2 JGI25405J52794_10000147 3300003911 Bacteria 8548
3 Ga0065704_10758164 3300005289 Unclassified 539
4 Ga0065707_10325939 3300005295 Bacteria 951
5 Ga0070683_100970748 3300005329 Bacteria 815
6 Ga0070683_101830573 3300005329 Bacteria 583
7 Ga0070682_100549764 3300005337 Unclassified 903
8 Ga0068868_100775998 3300005338 Bacteria 863
9 Ga0068868_101088484 3300005338 Bacteria 735
10 Ga0070671_100484645 3300005355 Bacteria 1063
11 Ga0070673_100688608 3300005364 Bacteria 938
12 Ga0070688_100134221 3300005365 Bacteria 1674
13 Ga0070709_10606992 3300005434 Bacteria 843
14 Ga0070700_101138369 3300005441 Bacteria 649
15 Ga0070694_100021923 3300005444 Bacteria 4088
16 Ga0070694_100109118 3300005444 Bacteria 1969
17 Ga0070708_100330966 3300005445 Bacteria 1435
18 Ga0070681_10009120 3300005458 Bacteria 9749
19 Ga0070706_100021766 3300005467 Bacteria 5904
20 Ga0070706_100108848 3300005467 Bacteria 2578
21 Ga0070706_100316896 3300005467 Bacteria 1455
22 Ga0070707_100013936 3300005468 Bacteria 7530
23 Ga0070707_100067652 3300005468 Bacteria 3437
24 Ga0070698_100012154 3300005471 Bacteria 9122
25 Ga0070698_100860104 3300005471 Bacteria 852
26 Ga0070698_100982577 3300005471 Bacteria 791
27 Ga0070699_100085488 3300005518 Bacteria 2752
28 Ga0070684_100018770 3300005535 Bacteria 5705
29 Ga0070697_100367861 3300005536 Bacteria 1244
30 Ga0070697_100592261 3300005536 Bacteria 974
31 Ga0070697_100615589 3300005536 Bacteria 955
32 Ga0068853_100728940 3300005539 Bacteria 947
33 Ga0070672_100412598 3300005543 Bacteria 1159
34 Ga0070686_100292454 3300005544 Bacteria 1205
35 Ga0070695_100143255 3300005545 Bacteria 1660
36 Ga0070696_100076714 3300005546 Bacteria 2360
37 Ga0070696_100571707 3300005546 Bacteria 908
38 Ga0070665_100015895 3300005548 Bacteria 7553
39 Ga0070665_100127543 3300005548 Bacteria 2547
40 Ga0070704_100064966 3300005549 Bacteria 2625
41 Ga0070704_100108365 3300005549 Bacteria 2109
42 Ga0070704_100637311 3300005549 Bacteria 940
43 Ga0070704_101193175 3300005549 Bacteria 694
44 Ga0068855_100460625 3300005563 Bacteria 1386
45 Ga0070664_101008775 3300005564 Bacteria 782
46 Ga0070702_100373684 3300005615 Bacteria 1011
47 Ga0068852_100080179 3300005616 Bacteria 2893
48 Ga0068859_101045960 3300005617 Bacteria 897
49 Ga0068859_101509460 3300005617 Bacteria 742
50 Ga0068866_10093727 3300005718 Bacteria 1641
51 Ga0068863_100077837 3300005841 Bacteria 3139
52 Ga0068858_101419622 3300005842 Bacteria 684
53 Ga0068860_100070575 3300005843 Bacteria 3321
54 Ga0068860_101913392 3300005843 Bacteria 615
55 Ga0081455_10000268 3300005937 Bacteria 68637
56 Ga0081455_10000739 3300005937 Bacteria 42444
57 Ga0081455_10003029 3300005937 Bacteria 19581
58 Ga0081455_10190219 3300005937 Bacteria 1546
59 Ga0081540_1014224 3300005983 Bacteria 5113
60 Ga0075432_10042788 3300006058 Unclassified 1586
61 Ga0068871_100339832 3300006358 Bacteria 1325
62 Ga0075428_100002658 3300006844 Bacteria 19408
63 Ga0075428_100057794 3300006844 Bacteria 4246
64 Ga0075428_100199510 3300006844 Bacteria 2163
65 Ga0075430_100949969 3300006846 Bacteria 708
66 Ga0075431_100316894 3300006847 Bacteria 1573
67 Ga0075429_100243421 3300006880 Bacteria 1575
68 Ga0075429_100426402 3300006880 Bacteria 1162
69 Ga0075429_100530567 3300006880 Bacteria 1032
70 Ga0075436_100090332 3300006914 Bacteria 2129
71 Ga0097620_101045874 3300006931 Bacteria 897
72 Ga0097620_101509459 3300006931 Bacteria 742
73 Ga0075435_101689033 3300007076 Bacteria 556
74 Ga0111539_10030440 3300009094 Bacteria 6560
75 Ga0111539_10505092 3300009094 Bacteria 1408
76 Ga0111539_10671321 3300009094 Unclassified 1207
77 Ga0105245_10004497 3300009098 Bacteria 12326
78 Ga0105245_10211269 3300009098 Bacteria 1868
79 Ga0114129_10105648 3300009147 Bacteria 3891
80 Ga0114129_10226874 3300009147 Bacteria 2517
81 Ga0114129_10366456 3300009147 Bacteria 1905
82 Ga0105243_10486090 3300009148 Bacteria 1166
83 Ga0105242_10001068 3300009176 Bacteria 21528
84 Ga0105248_11486872 3300009177 Bacteria 767
85 Ga0105249_11149559 3300009553 Unclassified 847
86 Ga0099796_10077799 3300010159 Bacteria 1211
87 Ga0105239_10306809 3300010375 Bacteria 1788
88 Ga0105246_11719130 3300011119 Bacteria 597
89 Ga0157370_10161963 3300013104 Bacteria 2081
90 Ga0157369_10482160 3300013105 Bacteria 1283
91 Ga0157374_10068143 3300013296 Bacteria 3347
92 Ga0163162_10638722 3300013306 Bacteria 1189
93 Ga0157372_10581390 3300013307 Bacteria 1305
94 Ga0157372_11094828 3300013307 Bacteria 922
95 Ga0157375_10232097 3300013308 Bacteria 2004
96 Ga0157380_11884260 3300014326 Bacteria 658
97 Ga0157377_10249075 3300014745 Bacteria 1150
98 Ga0157376_10164843 3300014969 Bacteria 2012
99 Ga0157376_11281765 3300014969 Bacteria 762
100 Ga0206353_11919383 3300020082 Bacteria 2158
101 Ga0213872_10045078 3300021361 Bacteria 2006
102 Ga0213874_10201102 3300021377 Bacteria 717
103 Ga0213876_10211170 3300021384 Bacteria 1032
104 Ga0209675_1003219 3300025291 Bacteria 7901
105 Ga0207426_1069855 3300025302 Bacteria 983
106 Ga0207647_10308746 3300025904 Bacteria 900
107 Ga0207699_10687543 3300025906 Bacteria 748
108 Ga0207705_10769669 3300025909 Bacteria 748
109 Ga0207684_11025159 3300025910 Bacteria 689
110 Ga0207707_10035642 3300025912 Bacteria 4350
111 Ga0207649_10338096 3300025920 Bacteria 1111
112 Ga0207646_10687452 3300025922 Bacteria 915
113 Ga0207687_10140430 3300025927 Bacteria 1832
114 Ga0207687_10167747 3300025927 Bacteria 1690
115 Ga0207644_10233921 3300025931 Bacteria 1461
116 Ga0207686_10016324 3300025934 Bacteria 4167
117 Ga0207709_11019561 3300025935 Bacteria 677
118 Ga0207670_10128825 3300025936 Bacteria 1850
119 Ga0207670_10874490 3300025936 Unclassified 752
120 Ga0207669_10072524 3300025937 Bacteria 2169
121 Ga0207691_10613776 3300025940 Bacteria 920
122 Ga0207679_11807091 3300025945 Bacteria 558
123 Ga0207651_10966816 3300025960 Bacteria 760
124 Ga0207712_10095815 3300025961 Bacteria 2195
125 Ga0207677_10894826 3300026023 Bacteria 800
126 Ga0207703_10216340 3300026035 Bacteria 1711
127 Ga0207708_10500017 3300026075 Bacteria 1019
128 Ga0207702_10375170 3300026078 Bacteria 1367
129 Ga0207641_10986843 3300026088 Bacteria 839
130 Ga0207648_10775392 3300026089 Bacteria 891
131 Ga0207676_10628588 3300026095 Bacteria 1034
132 Ga0207683_10330148 3300026121 Bacteria 1398
133 Ga0207698_10647591 3300026142 Bacteria 1046
134 Ga0207428_10070560 3300027907 Bacteria 2746
135 Ga0207428_10238750 3300027907 Bacteria 1358
136 Ga0268266_10002180 3300028379 Bacteria 21446
137 Ga0268266_10085151 3300028379 Bacteria 2761
138 Ga0268264_10096483 3300028381 Bacteria 2561
139 Ga0268264_11733300 3300028381 Bacteria 635
140 Ga0265334_10016610 3300028573 Bacteria 3043
141 Ga0265318_10001682 3300028577 Bacteria 12704
142 Ga0265323_10125775 3300028653 Unclassified 833
143 Ga0265332_10003866 3300031238 Bacteria 7149
144 Ga0265328_10002574 3300031239 Bacteria 8123
145 Ga0265320_10085167 3300031240 Bacteria 1471
146 Ga0265329_10041015 3300031242 Bacteria 1485
147 Ga0265340_10029655 3300031247 Bacteria 2748
148 Ga0265331_10009401 3300031250 Bacteria 5486
149 Ga0265331_10012775 3300031250 Bacteria 4536
150 Ga0265327_10280818 3300031251 Bacteria 736
151 Ga0265316_10027190 3300031344 Bacteria 4742
152 Ga0265316_10611674 3300031344 Bacteria 772
153 Ga0265313_10001496 3300031595 Bacteria 21782
154 Ga0316575_10425886 3300031665 Bacteria 571
155 Ga0265314_10006115 3300031711 Bacteria 10696
156 Ga0265342_10082438 3300031712 Bacteria 1855
157 Ga0265342_10279416 3300031712 Bacteria 884
158 Ga0316578_10078760 3300031728 Bacteria 1959
159 Ga0307413_11258567 3300031824 Unclassified 646
160 Ga0307406_10473543 3300031901 Bacteria 1010
161 Ga0307409_100700187 3300031995 Bacteria 1012
162 Ga0307416_102796118 3300032002 Bacteria 584
163 Ga0373928_0195787 3300035084 Bacteria 581
164 Ga0373932_0043848 3300035112 Bacteria 1302
165 Ga0373939_0146409 3300035114 Bacteria 856
166 Ga0373939_0158299 3300035114 Bacteria 830
167 Ga0373943_0669704 3300035170 Bacteria 614
168 Ga0316574_0756019 3300035398 Bacteria 594
169 Ga0373931_0054957 3300035691 Bacteria 2129
170 Ga0373931_0298699 3300035691 Bacteria 994
171 Ga0373931_0367413 3300035691 Bacteria 904
172 Ga0373935_0646056 3300035692 Bacteria 776
173 Ga0373947_0435643 3300035725 Bacteria 887
174 Ga0373947_0580100 3300035725 Bacteria 764
175 Ga0373937_0032227 3300036401 Bacteria 4754
176 Ga0373937_0298692 3300036401 Bacteria 1522
177 Ga0395899_0044482 3300037312 Bacteria 3308
178 Ga0395900_0037521 3300037418 Bacteria 4995
179 Ga0395900_0273706 3300037418 Bacteria 1682
180 Ga0395898_0071313 3300037466 Bacteria 3357
181 Ga0436364_0904114 3300037853 Bacteria 581
182 Ga0395901_0068211 3300038443 Bacteria 3705
183 Ga0395901_0164668 3300038443 Bacteria 2328
184 Ga0400483_041557 3300039062 Bacteria 5770
185 Ga0400483_160102 3300039062 Bacteria 2009
186 Ga0400483_162081 3300039062 Bacteria 4703
187 Ga0400483_181595 3300039062 Bacteria 28212
188 Ga0400483_201439 3300039062 Bacteria 21086
189 Ga0436365_0731033 3300039437 Bacteria 2126
190 Ga0436361_0671711 3300039447 Bacteria 14123
191 Ga0436363_0593323 3300039450 Bacteria 802
192 Ga0436362_0412848 3300039453 Bacteria 671
193 Ga0436362_1055393 3300039453 Bacteria 1112
194 Ga0451789_1143152 3300041443 Bacteria 598
195 Ga0439448_0295130 3300042005 Bacteria 575
196 Ga0450888_059142 3300042126 Bacteria 560
197 Ga0439464_0049867 3300042439 Bacteria 1208
198 Ga0451577_0022992 3300042876 Bacteria 5690
199 Ga0439440_0108036 3300042993 Bacteria 763
200 Ga0453683_0085274 3300044673 Bacteria 1979
201 Ga0453684_0298432 3300044712 Bacteria 1832
202 Ga0453684_0905728 3300044712 Unclassified 944
203 Ga0451576_0000030 3300045051 Bacteria 403352
204 Ga0451576_1578694 3300045051 Unclassified 681
205 Ga0466967_0215509 3300045976 Bacteria 1822
206 Ga0495608_0042389 3300046511 Bacteria 3044
207 Ga0495642_0051498 3300046528 Bacteria 1694
208 Ga0495667_0010481 3300046559 Bacteria 6271
209 Ga0495672_0308698 3300047320 Bacteria 747
210 Ga0495676_0269597 3300047321 Bacteria 1156
211 Ga0496112_0063907 3300048915 Bacteria 3631
212 Ga0501031_0102374 3300049568 Unclassified 1869
213 Ga0501032_0129301 3300049569 Bacteria 1667
214 Ga0501034_0033880 3300049571 Bacteria 5178
215 Ga0501034_0058556 3300049571 Bacteria 3872
216 Ga0501034_0125366 3300049571 Bacteria 2553
217 Ga0501034_0538038 3300049571 Bacteria 1078
218 Ga0501036_0113340 3300049572 Bacteria 2292
219 Ga0501037_0387940 3300049573 Bacteria 959
220 Ga0501039_0136547 3300049575 Bacteria 1926
221 Ga0501043_0289704 3300049579 Bacteria 1254
222 Ga0501043_1121029 3300049579 Bacteria 555
223 Ga0501046_0175603 3300049580 Bacteria 1605
224 Ga0501046_0352269 3300049580 Bacteria 1069
225 Ga0501047_0130538 3300049581 Bacteria 2393
226 Ga0501068_0004611 3300049584 Bacteria 7497
227 Ga0501070_0225226 3300049586 Bacteria 1537
228 Ga0501070_0279984 3300049586 Bacteria 1361
229 Ga0501072_0131434 3300049588 Bacteria 1995
230 Ga0501072_0361852 3300049588 Bacteria 1152
231 Ga0501072_0419636 3300049588 Bacteria 1061
232 Ga0501073_0110606 3300049589 Bacteria 1906
233 Ga0501076_0569546 3300049592 Bacteria 934
234 Ga0501079_0404461 3300049741 Unclassified 1071
235 Ga0501080_0542187 3300049742 Bacteria 1037
236 Ga0501080_0662673 3300049742 Bacteria 923
237 Ga0501035_0708924 3300049822 Unclassified 811
238 Ga0501044_0089369 3300049823 Bacteria 3109
239 Ga0501044_0295776 3300049823 Bacteria 1549
240 Ga0501045_0164449 3300049824 Unclassified 1652
241 nmdc:mga05p37_44496_c1 3300050507 Bacteria 5462
242 nmdc:mga05p37_60166_c1 3300050507 Bacteria 4677
243 nmdc:mga05p37_653687_c1 3300050507 Bacteria 1177
244 nmdc:mga09592_473859_c1 3300050508 Bacteria 1079
245 nmdc:mga09592_504508_c1 3300050508 Bacteria 1041
246 nmdc:mga09592_529074_c1 3300050508 Bacteria 1013
247 nmdc:mga09592_54111_c1 3300050508 Bacteria 3391
248 nmdc:mga0qj67_706071_c1 3300050509 Bacteria 802
249 nmdc:mga06r32_26549_c1 3300050510 Bacteria 5401
250 nmdc:mga06r32_791068_c1 3300050510 Bacteria 910
251 nmdc:mga08y16_401832_c1 3300050511 Bacteria 1402
252 nmdc:mga0n895_236703_c1 3300050512 Bacteria 1853
253 nmdc:mga0a205_704244_c1 3300050515 Unclassified 860
254 Ga0500595_087528 3300053119 Bacteria 905
255 Ga0500642_0002511 3300053130 Bacteria 5397
256 Ga0501082_0115764 3300060353 Bacteria 2322
257 Ga0530510_0303304 3300061734 Unclassified 1195
258 2566034905 2565956521 Bacteria 4468993
259 2842333369 2842333319 Bacteria 8899485
260 Ga0075428_100017831
261 JGI25405J52794_10000147
262 Ga0065704_10758164
263 Ga0065707_10325939
264 Ga0070683_100970748
265 Ga0070683_101830573
266 Ga0070682_100549764
267 Ga0068868_100775998
268 Ga0068868_101088484
269 Ga0070671_100484645
270 Ga0070673_100688608
271 Ga0070688_100134221
272 Ga0070709_10606992
273 Ga0070700_101138369
274 Ga0070694_100021923
275 Ga0070694_100109118
276 Ga0070708_100330966
277 Ga0070681_10009120
278 Ga0070706_100021766
279 Ga0070706_100108848
280 Ga0070706_100316896
281 Ga0070707_100013936
282 Ga0070707_100067652
283 Ga0070698_100012154
284 Ga0070698_100860104
285 Ga0070698_100982577
286 Ga0070699_100085488
287 Ga0070684_100018770
288 Ga0070697_100367861
289 Ga0070697_100592261
290 Ga0070697_100615589
291 Ga0068853_100728940
292 Ga0070672_100412598
293 Ga0070686_100292454
294 Ga0070695_100143255
295 Ga0070696_100076714
296 Ga0070696_100571707
297 Ga0070665_100015895
298 Ga0070665_100127543
299 Ga0070704_100064966
300 Ga0070704_100108365
301 Ga0070704_100637311
302 Ga0070704_101193175
303 Ga0068855_100460625
304 Ga0070664_101008775
305 Ga0070702_100373684
306 Ga0068852_100080179
307 Ga0068859_101045960
308 Ga0068859_101509460
309 Ga0068866_10093727
310 Ga0068863_100077837
311 Ga0068858_101419622
312 Ga0068860_100070575
313 Ga0068860_101913392
314 Ga0081455_10000268
315 Ga0081455_10000739
316 Ga0081455_10003029
317 Ga0081455_10190219
318 Ga0081540_1014224
319 Ga0075432_10042788
320 Ga0068871_100339832
321 Ga0075428_100002658
322 Ga0075428_100057794
323 Ga0075428_100199510
324 Ga0075430_100949969
325 Ga0075431_100316894
326 Ga0075429_100243421
327 Ga0075429_100426402
328 Ga0075429_100530567
329 Ga0075436_100090332
330 Ga0097620_101045874
331 Ga0097620_101509459
332 Ga0075435_101689033
333 Ga0111539_10030440
334 Ga0111539_10505092
335 Ga0111539_10671321
336 Ga0105245_10004497
337 Ga0105245_10211269
338 Ga0114129_10105648
339 Ga0114129_10226874
340 Ga0114129_10366456
341 Ga0105243_10486090
342 Ga0105242_10001068
343 Ga0105248_11486872
344 Ga0105249_11149559
345 Ga0099796_10077799
346 Ga0105239_10306809
347 Ga0105246_11719130
348 Ga0157370_10161963
349 Ga0157369_10482160
350 Ga0157374_10068143
351 Ga0163162_10638722
352 Ga0157372_10581390
353 Ga0157372_11094828
354 Ga0157375_10232097
355 Ga0157380_11884260
356 Ga0157377_10249075
357 Ga0157376_10164843
358 Ga0157376_11281765
359 Ga0206353_11919383
360 Ga0213872_10045078
361 Ga0213874_10201102
362 Ga0213876_10211170
363 Ga0209675_1003219
364 Ga0207426_1069855
365 Ga0207647_10308746
366 Ga0207699_10687543
367 Ga0207705_10769669
368 Ga0207684_11025159
369 Ga0207707_10035642
370 Ga0207649_10338096
371 Ga0207646_10687452
372 Ga0207687_10140430
373 Ga0207687_10167747
374 Ga0207644_10233921
375 Ga0207686_10016324
376 Ga0207709_11019561
377 Ga0207670_10128825
378 Ga0207670_10874490
379 Ga0207669_10072524
380 Ga0207691_10613776
381 Ga0207679_11807091
382 Ga0207651_10966816
383 Ga0207712_10095815
384 Ga0207677_10894826
385 Ga0207703_10216340
386 Ga0207708_10500017
387 Ga0207702_10375170
388 Ga0207641_10986843
389 Ga0207648_10775392
390 Ga0207676_10628588
391 Ga0207683_10330148
392 Ga0207698_10647591
393 Ga0207428_10070560
394 Ga0207428_10238750
395 Ga0268266_10002180
396 Ga0268266_10085151
397 Ga0268264_10096483
398 Ga0268264_11733300
399 Ga0265334_10016610
400 Ga0265318_10001682
401 Ga0265323_10125775
402 Ga0265332_10003866
403 Ga0265328_10002574
404 Ga0265320_10085167
405 Ga0265329_10041015
406 Ga0265340_10029655
407 Ga0265331_10009401
408 Ga0265331_10012775
409 Ga0265327_10280818
410 Ga0265316_10027190
411 Ga0265316_10611674
412 Ga0265313_10001496
413 Ga0316575_10425886
414 Ga0265314_10006115
415 Ga0265342_10082438
416 Ga0265342_10279416
417 Ga0316578_10078760
418 Ga0307413_11258567
419 Ga0307406_10473543
420 Ga0307409_100700187
421 Ga0307416_102796118
422 Ga0373928_0195787
423 Ga0373932_0043848
424 Ga0373939_0146409
425 Ga0373939_0158299
426 Ga0373943_0669704
427 Ga0316574_0756019
428 Ga0373931_0054957
429 Ga0373931_0298699
430 Ga0373931_0367413
431 Ga0373935_0646056
432 Ga0373947_0435643
433 Ga0373947_0580100
434 Ga0373937_0032227
435 Ga0373937_0298692
436 Ga0395899_0044482
437 Ga0395900_0037521
438 Ga0395900_0273706
439 Ga0395898_0071313
440 Ga0436364_0904114
441 Ga0395901_0068211
442 Ga0395901_0164668
443 Ga0400483_041557
444 Ga0400483_160102
445 Ga0400483_162081
446 Ga0400483_181595
447 Ga0400483_201439
448 Ga0436365_0731033
449 Ga0436361_0671711
450 Ga0436363_0593323
451 Ga0436362_0412848
452 Ga0436362_1055393
453 Ga0451789_1143152
454 Ga0439448_0295130
455 Ga0450888_059142
456 Ga0439464_0049867
457 Ga0451577_0022992
458 Ga0439440_0108036
459 Ga0453683_0085274
460 Ga0453684_0298432
461 Ga0453684_0905728
462 Ga0451576_0000030
463 Ga0451576_1578694
464 Ga0466967_0215509
465 Ga0495608_0042389
466 Ga0495642_0051498
467 Ga0495667_0010481
468 Ga0495672_0308698
469 Ga0495676_0269597
470 Ga0496112_0063907
471 Ga0501031_0102374
472 Ga0501032_0129301
473 Ga0501034_0033880
474 Ga0501034_0058556
475 Ga0501034_0125366
476 Ga0501034_0538038
477 Ga0501036_0113340
478 Ga0501037_0387940
479 Ga0501039_0136547
480 Ga0501043_0289704
481 Ga0501043_1121029
482 Ga0501046_0175603
483 Ga0501046_0352269
484 Ga0501047_0130538
485 Ga0501068_0004611
486 Ga0501070_0225226
487 Ga0501070_0279984
488 Ga0501072_0131434
489 Ga0501072_0361852
490 Ga0501072_0419636
491 Ga0501073_0110606
492 Ga0501076_0569546
493 Ga0501079_0404461
494 Ga0501080_0542187
495 Ga0501080_0662673
496 Ga0501035_0708924
497 Ga0501044_0089369
498 Ga0501044_0295776
499 Ga0501045_0164449
500 nmdc:mga05p37_44496_c1
501 nmdc:mga05p37_60166_c1
502 nmdc:mga05p37_653687_c1
503 nmdc:mga09592_473859_c1
504 nmdc:mga09592_504508_c1
505 nmdc:mga09592_529074_c1
506 nmdc:mga09592_54111_c1
507 nmdc:mga0qj67_706071_c1
508 nmdc:mga06r32_26549_c1
509 nmdc:mga06r32_791068_c1
510 nmdc:mga08y16_401832_c1
511 nmdc:mga0n895_236703_c1
512 nmdc:mga0a205_704244_c1
513 Ga0500595_087528
514 Ga0500642_0002511
515 Ga0501082_0115764
516 Ga0530510_0303304
517 2566034905
518 2842333369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

34

171

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.97 29 126
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9695 29 126
3jqk-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) 0.9496 30 136
3jqj-assembly1.cif.gz_B crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 0.9384 28 138
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9109 23 136
ID Description Score Start End Superfamily
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9695 29 126 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.913 25 113 3.30.70.640
4pydF00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8837 23 124 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8116 11 129 3.30.70.640
af_Q54NM6_454_628_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8055 33 134 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A087LWT7-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaC 0.9694 36 138 GO:0006777
GO:0061798
GO:0061799
AF-V5IB98-F1-model_v4 Putative molybdenum cofactor biosynthesis pathway protein 0.9693 29 136 GO:0006777
GO:0061798
GO:0061799
AF-A0A6N8K9V2-F1-model_v4 deleted 0.9685 30 138
AF-F9MUJ7-F1-model_v4 deleted 0.968 40 138
AF-A0A6L7JKN1-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9657 30 139 GO:0006777
GO:0061799

Map