F368215

General Info

Members Datasets Scaffolds Average Seq Length
258 177 516 248

Family's Representative Sequence

Representative Sequence 3300035090|Ga0373949_0000005|Ga0373949_0000005_22751_23554
Length 267
Sequence MTPIRTAIVDDEPLARAALRAVLASDPEIEVVGDCIGVDAPALIERARVELVFLDVQMPEVDGFQVLDALRPEALPAVVFVTAYDTYAVRAFEVHAVDYLLKPFDDARVATALARAKQRLAHGEAGEPAMPGPSDGVLALLNQRGEASGSRWIAPRGIERILVRTRGKIIAVRTPDIDWIEAADYYATLHVGGASYLIRQTMAELEASLDPRRFVRVHRGAIVHVDRIREVHPLFRGDCTLVLADGTQVKLSRTRRAEFERLFGTPR

Samples

Sample ID Description Type Environment
1 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
168 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
169 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
170 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
173 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
174 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
175 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 2643221638 Duganella sp. Root336D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0
Rhizoplane 6.98
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373949_0000005 3300035090 Bacteria 81783
2 LJNas_1000271 3300000546 Bacteria 8937
3 JGI24743J22301_10001497 3300001991 Unclassified 3251
4 JGI24034J26672_10007216 3300002239 Bacteria 1612
5 JGI25158J39367_1000465 3300002739 Bacteria 8295
6 JGI25152J39213_1000008 3300002773 Bacteria 154537
7 rootL2_10128623 3300003322 Bacteria 3207
8 Ga0055526_1026366 3300003771 Bacteria 1835
9 Ga0070676_10135795 3300005328 Bacteria 1560
10 Ga0070683_100000099 3300005329 Bacteria 56845
11 Ga0070683_100018561 3300005329 Bacteria 6164
12 Ga0070670_100000040 3300005331 Bacteria 149939
13 Ga0070670_100621857 3300005331 Bacteria 967
14 Ga0068869_100140898 3300005334 Bacteria 1862
15 Ga0068868_100000081 3300005338 Bacteria 57128
16 Ga0070689_100025512 3300005340 Unclassified 4441
17 Ga0070689_100046659 3300005340 Bacteria 3339
18 Ga0070689_100188458 3300005340 Bacteria 1679
19 Ga0070661_100141365 3300005344 Unclassified 1814
20 Ga0070692_10008329 3300005345 Bacteria 4621
21 Ga0070668_100100320 3300005347 Bacteria 2293
22 Ga0070669_100060044 3300005353 Bacteria 2792
23 Ga0070675_100477840 3300005354 Bacteria 1120
24 Ga0070671_100001409 3300005355 Bacteria 17959
25 Ga0070674_100091210 3300005356 Bacteria 2200
26 Ga0070673_100103105 3300005364 Bacteria 2353
27 Ga0070673_100190733 3300005364 Bacteria 1760
28 Ga0070688_100313382 3300005365 Bacteria 1138
29 Ga0070701_10206340 3300005438 Bacteria 1164
30 Ga0070711_100208476 3300005439 Bacteria 1512
31 Ga0070705_100238108 3300005440 Bacteria 1270
32 Ga0070705_100463671 3300005440 Bacteria 953
33 Ga0070663_100033672 3300005455 Unclassified 3541
34 Ga0070678_100625502 3300005456 Bacteria 963
35 Ga0070662_100060937 3300005457 Bacteria 2753
36 Ga0068867_100068497 3300005459 Bacteria 2648
37 Ga0068867_100093662 3300005459 Bacteria 2283
38 Ga0068867_100281802 3300005459 Bacteria 1363
39 Ga0070685_10004463 3300005466 Bacteria 7077
40 Ga0070707_100092166 3300005468 Bacteria 2934
41 Ga0070684_100000104 3300005535 Bacteria 54663
42 Ga0070684_100000922 3300005535 Bacteria 20877
43 Ga0068853_100027747 3300005539 Bacteria 4758
44 Ga0068853_100110332 3300005539 Bacteria 2443
45 Ga0068853_100238503 3300005539 Bacteria 1666
46 Ga0068853_100636682 3300005539 Bacteria 1014
47 Ga0070672_100095397 3300005543 Unclassified 2405
48 Ga0070693_100029198 3300005547 Bacteria 3006
49 Ga0070665_100017632 3300005548 Bacteria 7170
50 Ga0070665_100068497 3300005548 Bacteria 3558
51 Ga0070665_100074074 3300005548 Bacteria 3410
52 Ga0070665_100320136 3300005548 Bacteria 1555
53 Ga0068855_100062010 3300005563 Bacteria 4366
54 Ga0068855_100287902 3300005563 Bacteria 1822
55 Ga0070664_100037145 3300005564 Bacteria 4093
56 Ga0068857_100022096 3300005577 Bacteria 5597
57 Ga0068854_100131456 3300005578 Unclassified 1912
58 Ga0068856_100015938 3300005614 Bacteria 7266
59 Ga0068852_100029513 3300005616 Bacteria 4507
60 Ga0068859_100001611 3300005617 Bacteria 23070
61 Ga0068859_100198347 3300005617 Bacteria 2091
62 Ga0068866_10001855 3300005718 Bacteria 8860
63 Ga0068866_10046045 3300005718 Bacteria 2191
64 Ga0068866_10162670 3300005718 Bacteria 1303
65 Ga0068861_100267712 3300005719 Bacteria 1466
66 Ga0068870_10017455 3300005840 Bacteria 3447
67 Ga0068863_100108831 3300005841 Bacteria 2638
68 Ga0068858_100005413 3300005842 Bacteria 12506
69 Ga0068858_100381849 3300005842 Bacteria 1352
70 Ga0068860_100024297 3300005843 Bacteria 5857
71 Ga0068860_100141495 3300005843 Bacteria 2313
72 Ga0068860_100495115 3300005843 Bacteria 1220
73 Ga0068862_100017969 3300005844 Bacteria 5890
74 Ga0068862_100166922 3300005844 Bacteria 1968
75 Ga0070717_10164190 3300006028 Bacteria 1928
76 Ga0070717_10205278 3300006028 Bacteria 1727
77 Ga0068871_100123034 3300006358 Bacteria 2193
78 Ga0068871_100421055 3300006358 Bacteria 1192
79 Ga0068865_100036562 3300006881 Unclassified 3311
80 Ga0097620_100001611 3300006931 Bacteria 23070
81 Ga0097620_100198349 3300006931 Bacteria 2091
82 Ga0075435_100208740 3300007076 Bacteria 1656
83 Ga0105240_10194775 3300009093 Bacteria 2380
84 Ga0105245_10017762 3300009098 Bacteria 6209
85 Ga0105247_10010319 3300009101 Bacteria 5650
86 Ga0105241_10022376 3300009174 Bacteria 4682
87 Ga0105248_10138285 3300009177 Bacteria 2748
88 Ga0105237_10118213 3300009545 Bacteria 2645
89 Ga0105238_10000001 3300009551 Bacteria 2036163
90 Ga0105249_10060378 3300009553 Bacteria 3478
91 Ga0105239_10304947 3300010375 Bacteria 1794
92 Ga0105246_10018997 3300011119 Unclassified 4384
93 Ga0157373_10014784 3300013100 Bacteria 5718
94 Ga0157371_10026529 3300013102 Bacteria 4210
95 Ga0157369_10004389 3300013105 Bacteria 16656
96 Ga0157369_10006311 3300013105 Bacteria 13764
97 Ga0157369_10061796 3300013105 Bacteria 4037
98 Ga0157374_10000021 3300013296 Bacteria 272840
99 Ga0157374_10153514 3300013296 Bacteria 2240
100 Ga0157374_10312531 3300013296 Bacteria 1556
101 Ga0157378_10000027 3300013297 Bacteria 128412
102 Ga0157378_10000038 3300013297 Bacteria 116387
103 Ga0163162_10354422 3300013306 Bacteria 1600
104 Ga0157372_10065028 3300013307 Bacteria 4094
105 Ga0157372_10411316 3300013307 Bacteria 1576
106 Ga0157375_10000015 3300013308 Bacteria 308254
107 Ga0157375_10002804 3300013308 Bacteria 15081
108 Ga0157375_10003769 3300013308 Bacteria 13137
109 Ga0157375_10038074 3300013308 Bacteria 4614
110 Ga0163163_10008718 3300014325 Bacteria 9020
111 Ga0182008_10025095 3300014497 Unclassified 3031
112 Ga0157377_10000009 3300014745 Bacteria 385287
113 Ga0157377_10142755 3300014745 Bacteria 1473
114 Ga0157379_10041796 3300014968 Unclassified 4091
115 Ga0157379_10156769 3300014968 Bacteria 2054
116 Ga0157376_10000024 3300014969 Bacteria 220018
117 Ga0157376_10140921 3300014969 Bacteria 2163
118 Ga0157376_10217910 3300014969 Bacteria 1766
119 Ga0157376_10268077 3300014969 Bacteria 1603
120 Ga0182006_1022112 3300015261 Bacteria 2646
121 Ga0182007_10014077 3300015262 Unclassified 3028
122 Ga0163161_10021726 3300017792 Bacteria 4511
123 Ga0213872_10095261 3300021361 Bacteria 1329
124 Ga0213876_10000014 3300021384 Bacteria 310412
125 Ga0207425_1007909 3300025245 Bacteria 2765
126 Ga0207697_10020082 3300025315 Bacteria 2736
127 Ga0207710_10000372 3300025900 Bacteria 31303
128 Ga0207680_10213792 3300025903 Bacteria 1319
129 Ga0207647_10012348 3300025904 Bacteria 5946
130 Ga0207647_10016814 3300025904 Bacteria 4985
131 Ga0207645_10003101 3300025907 Bacteria 12742
132 Ga0207643_10000920 3300025908 Bacteria 17628
133 Ga0207643_10045753 3300025908 Bacteria 2472
134 Ga0207705_10125838 3300025909 Bacteria 1905
135 Ga0207695_10178111 3300025913 Bacteria 2048
136 Ga0207662_10071977 3300025918 Unclassified 2094
137 Ga0207662_10279046 3300025918 Bacteria 1105
138 Ga0207657_10000698 3300025919 Bacteria 35677
139 Ga0207649_10001311 3300025920 Bacteria 14843
140 Ga0207681_10541119 3300025923 Bacteria 957
141 Ga0207694_10000001 3300025924 Bacteria 4078485
142 Ga0207650_10000104 3300025925 Bacteria 111268
143 Ga0207650_10000335 3300025925 Bacteria 45551
144 Ga0207659_10560754 3300025926 Bacteria 972
145 Ga0207644_10004843 3300025931 Bacteria 8763
146 Ga0207706_10000784 3300025933 Bacteria 32928
147 Ga0207709_10278610 3300025935 Bacteria 1234
148 Ga0207709_10360048 3300025935 Bacteria 1101
149 Ga0207670_10016057 3300025936 Bacteria 4490
150 Ga0207670_10159105 3300025936 Bacteria 1684
151 Ga0207669_10009339 3300025937 Bacteria 4664
152 Ga0207669_10011582 3300025937 Bacteria 4299
153 Ga0207691_10003362 3300025940 Bacteria 15570
154 Ga0207691_10011052 3300025940 Bacteria 8664
155 Ga0207711_10017063 3300025941 Bacteria 6031
156 Ga0207711_10082768 3300025941 Unclassified 2806
157 Ga0207689_10003001 3300025942 Bacteria 15563
158 Ga0207689_10055628 3300025942 Bacteria 3256
159 Ga0207689_10110038 3300025942 Bacteria 2264
160 Ga0207689_10176299 3300025942 Bacteria 1763
161 Ga0207661_10000001 3300025944 Bacteria 937688
162 Ga0207661_10007317 3300025944 Bacteria 7852
163 Ga0207679_10000089 3300025945 Bacteria 79512
164 Ga0207667_10264642 3300025949 Bacteria 1758
165 Ga0207651_10009229 3300025960 Bacteria 5383
166 Ga0207651_10180477 3300025960 Bacteria 1674
167 Ga0207712_10187747 3300025961 Bacteria 1629
168 Ga0207668_10188484 3300025972 Bacteria 1632
169 Ga0207640_10019293 3300025981 Bacteria 4026
170 Ga0207658_10025422 3300025986 Unclassified 4146
171 Ga0207658_10043962 3300025986 Unclassified 3250
172 Ga0207677_10013813 3300026023 Bacteria 4691
173 Ga0207677_10419419 3300026023 Bacteria 1139
174 Ga0207703_10013377 3300026035 Bacteria 6395
175 Ga0207703_10408892 3300026035 Bacteria 1260
176 Ga0207639_10213309 3300026041 Bacteria 1663
177 Ga0207678_10002908 3300026067 Bacteria 15532
178 Ga0207702_10200196 3300026078 Unclassified 1850
179 Ga0207641_10000020 3300026088 Bacteria 286415
180 Ga0207641_10119830 3300026088 Bacteria 2346
181 Ga0207648_10007702 3300026089 Bacteria 10533
182 Ga0207648_10018416 3300026089 Bacteria 6323
183 Ga0207648_10661259 3300026089 Bacteria 966
184 Ga0207676_10002373 3300026095 Bacteria 13444
185 Ga0207676_10108706 3300026095 Bacteria 2316
186 Ga0207674_10002596 3300026116 Bacteria 22730
187 Ga0207675_100356071 3300026118 Bacteria 1435
188 Ga0207675_100441690 3300026118 Bacteria 1288
189 Ga0207683_10002577 3300026121 Bacteria 15828
190 Ga0207698_10224881 3300026142 Bacteria 1699
191 Ga0268266_10005104 3300028379 Bacteria 12373
192 Ga0268266_10025195 3300028379 Bacteria 5062
193 Ga0268266_10110086 3300028379 Bacteria 2439
194 Ga0268266_10204482 3300028379 Bacteria 1808
195 Ga0268264_10120129 3300028381 Bacteria 2315
196 Ga0268264_10228807 3300028381 Bacteria 1716
197 Ga0307515_10006467 3300028794 Bacteria 23447
198 Ga0307515_10509846 3300028794 Bacteria 813
199 Ga0307511_10003634 3300030521 Bacteria 15783
200 Ga0265332_10001692 3300031238 Bacteria 12032
201 Ga0307513_10042853 3300031456 Bacteria 4977
202 Ga0307509_10015191 3300031507 Bacteria 9000
203 Ga0307509_10051777 3300031507 Bacteria 4387
204 Ga0307509_10096688 3300031507 Bacteria 3004
205 Ga0307516_10059397 3300031730 Bacteria 3719
206 Ga0373941_0087205 3300035115 Bacteria 1064
207 Ga0436365_0236662 3300039437 Bacteria 205513
208 Ga0436361_0232807 3300039447 Bacteria 1431
209 Ga0436361_0278187 3300039447 Bacteria 3629
210 Ga0436361_0506208 3300039447 Bacteria 1854
211 Ga0495617_000960 3300046452 Bacteria 13411
212 Ga0495650_0000125 3300046471 Bacteria 178542
213 Ga0495637_0000494 3300046520 Bacteria 28654
214 Ga0495672_0000088 3300047320 Bacteria 153860
215 Ga0495679_071279 3300047446 Bacteria 1000
216 Ga0495686_0000109 3300047472 Bacteria 171482
217 Ga0495686_0001028 3300047472 Bacteria 33622
218 Ga0496100_0036686 3300048903 Bacteria 3095
219 Ga0496102_0036999 3300048905 Unclassified 4401
220 Ga0496103_0296060 3300048906 Bacteria 1041
221 Ga0496104_0027993 3300048907 Bacteria 5220
222 Ga0496108_0000051 3300048911 Bacteria 131546
223 Ga0496108_0103246 3300048911 Bacteria 2432
224 Ga0496109_0000018 3300048912 Bacteria 191977
225 Ga0496109_0057185 3300048912 Bacteria 3560
226 Ga0496110_0000138 3300048913 Bacteria 42078
227 Ga0496110_0160004 3300048913 Bacteria 2041
228 Ga0496111_0048181 3300048914 Unclassified 3070
229 Ga0496111_0164784 3300048914 Unclassified 1646
230 Ga0496112_0000821 3300048915 Bacteria 22029
231 Ga0496112_0043532 3300048915 Unclassified 4396
232 Ga0496112_0067176 3300048915 Bacteria 3538
233 Ga0496113_0000563 3300048916 Bacteria 18442
234 Ga0496113_0894406 3300048916 Unclassified 702
235 Ga0496115_0210210 3300048918 Bacteria 1607
236 Ga0496119_0153874 3300048922 Bacteria 1230
237 Ga0496119_0233846 3300048922 Bacteria 934
238 Ga0496121_0021933 3300048924 Bacteria 6229
239 Ga0496124_0406013 3300048927 Bacteria 944
240 Ga0496125_0006916 3300048928 Bacteria 12142
241 Ga0496126_0046735 3300048929 Bacteria 3967
242 Ga0495678_002045 3300049459 Bacteria 14438
243 nmdc:mga09592_65269_c1 3300050508 Bacteria 3083
244 nmdc:mga0rr50_9674_c1 3300050513 Bacteria 6077
245 Ga0500635_0011152 3300053080 Bacteria 2548
246 Ga0500578_0270084 3300053086 Bacteria 1018
247 Ga0500566_0003785 3300053094 Bacteria 9027
248 Ga0500640_001172 3300053095 Bacteria 7662
249 Ga0500554_142196 3300053102 Bacteria 811
250 Ga0500572_014042 3300053111 Bacteria 1994
251 Ga0500595_000197 3300053119 Bacteria 41034
252 Ga0500597_002077 3300053120 Bacteria 5418
253 Ga0500597_087724 3300053120 Bacteria 1351
254 Ga0500614_000602 3300053123 Bacteria 9169
255 Ga0500642_0156259 3300053130 Bacteria 1070
256 Ga0500564_101492 3300053138 Bacteria 1271
257 Ga0500636_0104588 3300053177 Bacteria 1606
258 2644216740 2643221638 Bacteria 6579467
259 Ga0373949_0000005
260 LJNas_1000271
261 JGI24743J22301_10001497
262 JGI24034J26672_10007216
263 JGI25158J39367_1000465
264 JGI25152J39213_1000008
265 rootL2_10128623
266 Ga0055526_1026366
267 Ga0070676_10135795
268 Ga0070683_100000099
269 Ga0070683_100018561
270 Ga0070670_100000040
271 Ga0070670_100621857
272 Ga0068869_100140898
273 Ga0068868_100000081
274 Ga0070689_100025512
275 Ga0070689_100046659
276 Ga0070689_100188458
277 Ga0070661_100141365
278 Ga0070692_10008329
279 Ga0070668_100100320
280 Ga0070669_100060044
281 Ga0070675_100477840
282 Ga0070671_100001409
283 Ga0070674_100091210
284 Ga0070673_100103105
285 Ga0070673_100190733
286 Ga0070688_100313382
287 Ga0070701_10206340
288 Ga0070711_100208476
289 Ga0070705_100238108
290 Ga0070705_100463671
291 Ga0070663_100033672
292 Ga0070678_100625502
293 Ga0070662_100060937
294 Ga0068867_100068497
295 Ga0068867_100093662
296 Ga0068867_100281802
297 Ga0070685_10004463
298 Ga0070707_100092166
299 Ga0070684_100000104
300 Ga0070684_100000922
301 Ga0068853_100027747
302 Ga0068853_100110332
303 Ga0068853_100238503
304 Ga0068853_100636682
305 Ga0070672_100095397
306 Ga0070693_100029198
307 Ga0070665_100017632
308 Ga0070665_100068497
309 Ga0070665_100074074
310 Ga0070665_100320136
311 Ga0068855_100062010
312 Ga0068855_100287902
313 Ga0070664_100037145
314 Ga0068857_100022096
315 Ga0068854_100131456
316 Ga0068856_100015938
317 Ga0068852_100029513
318 Ga0068859_100001611
319 Ga0068859_100198347
320 Ga0068866_10001855
321 Ga0068866_10046045
322 Ga0068866_10162670
323 Ga0068861_100267712
324 Ga0068870_10017455
325 Ga0068863_100108831
326 Ga0068858_100005413
327 Ga0068858_100381849
328 Ga0068860_100024297
329 Ga0068860_100141495
330 Ga0068860_100495115
331 Ga0068862_100017969
332 Ga0068862_100166922
333 Ga0070717_10164190
334 Ga0070717_10205278
335 Ga0068871_100123034
336 Ga0068871_100421055
337 Ga0068865_100036562
338 Ga0097620_100001611
339 Ga0097620_100198349
340 Ga0075435_100208740
341 Ga0105240_10194775
342 Ga0105245_10017762
343 Ga0105247_10010319
344 Ga0105241_10022376
345 Ga0105248_10138285
346 Ga0105237_10118213
347 Ga0105238_10000001
348 Ga0105249_10060378
349 Ga0105239_10304947
350 Ga0105246_10018997
351 Ga0157373_10014784
352 Ga0157371_10026529
353 Ga0157369_10004389
354 Ga0157369_10006311
355 Ga0157369_10061796
356 Ga0157374_10000021
357 Ga0157374_10153514
358 Ga0157374_10312531
359 Ga0157378_10000027
360 Ga0157378_10000038
361 Ga0163162_10354422
362 Ga0157372_10065028
363 Ga0157372_10411316
364 Ga0157375_10000015
365 Ga0157375_10002804
366 Ga0157375_10003769
367 Ga0157375_10038074
368 Ga0163163_10008718
369 Ga0182008_10025095
370 Ga0157377_10000009
371 Ga0157377_10142755
372 Ga0157379_10041796
373 Ga0157379_10156769
374 Ga0157376_10000024
375 Ga0157376_10140921
376 Ga0157376_10217910
377 Ga0157376_10268077
378 Ga0182006_1022112
379 Ga0182007_10014077
380 Ga0163161_10021726
381 Ga0213872_10095261
382 Ga0213876_10000014
383 Ga0207425_1007909
384 Ga0207697_10020082
385 Ga0207710_10000372
386 Ga0207680_10213792
387 Ga0207647_10012348
388 Ga0207647_10016814
389 Ga0207645_10003101
390 Ga0207643_10000920
391 Ga0207643_10045753
392 Ga0207705_10125838
393 Ga0207695_10178111
394 Ga0207662_10071977
395 Ga0207662_10279046
396 Ga0207657_10000698
397 Ga0207649_10001311
398 Ga0207681_10541119
399 Ga0207694_10000001
400 Ga0207650_10000104
401 Ga0207650_10000335
402 Ga0207659_10560754
403 Ga0207644_10004843
404 Ga0207706_10000784
405 Ga0207709_10278610
406 Ga0207709_10360048
407 Ga0207670_10016057
408 Ga0207670_10159105
409 Ga0207669_10009339
410 Ga0207669_10011582
411 Ga0207691_10003362
412 Ga0207691_10011052
413 Ga0207711_10017063
414 Ga0207711_10082768
415 Ga0207689_10003001
416 Ga0207689_10055628
417 Ga0207689_10110038
418 Ga0207689_10176299
419 Ga0207661_10000001
420 Ga0207661_10007317
421 Ga0207679_10000089
422 Ga0207667_10264642
423 Ga0207651_10009229
424 Ga0207651_10180477
425 Ga0207712_10187747
426 Ga0207668_10188484
427 Ga0207640_10019293
428 Ga0207658_10025422
429 Ga0207658_10043962
430 Ga0207677_10013813
431 Ga0207677_10419419
432 Ga0207703_10013377
433 Ga0207703_10408892
434 Ga0207639_10213309
435 Ga0207678_10002908
436 Ga0207702_10200196
437 Ga0207641_10000020
438 Ga0207641_10119830
439 Ga0207648_10007702
440 Ga0207648_10018416
441 Ga0207648_10661259
442 Ga0207676_10002373
443 Ga0207676_10108706
444 Ga0207674_10002596
445 Ga0207675_100356071
446 Ga0207675_100441690
447 Ga0207683_10002577
448 Ga0207698_10224881
449 Ga0268266_10005104
450 Ga0268266_10025195
451 Ga0268266_10110086
452 Ga0268266_10204482
453 Ga0268264_10120129
454 Ga0268264_10228807
455 Ga0307515_10006467
456 Ga0307515_10509846
457 Ga0307511_10003634
458 Ga0265332_10001692
459 Ga0307513_10042853
460 Ga0307509_10015191
461 Ga0307509_10051777
462 Ga0307509_10096688
463 Ga0307516_10059397
464 Ga0373941_0087205
465 Ga0436365_0236662
466 Ga0436361_0232807
467 Ga0436361_0278187
468 Ga0436361_0506208
469 Ga0495617_000960
470 Ga0495650_0000125
471 Ga0495637_0000494
472 Ga0495672_0000088
473 Ga0495679_071279
474 Ga0495686_0000109
475 Ga0495686_0001028
476 Ga0496100_0036686
477 Ga0496102_0036999
478 Ga0496103_0296060
479 Ga0496104_0027993
480 Ga0496108_0000051
481 Ga0496108_0103246
482 Ga0496109_0000018
483 Ga0496109_0057185
484 Ga0496110_0000138
485 Ga0496110_0160004
486 Ga0496111_0048181
487 Ga0496111_0164784
488 Ga0496112_0000821
489 Ga0496112_0043532
490 Ga0496112_0067176
491 Ga0496113_0000563
492 Ga0496113_0894406
493 Ga0496115_0210210
494 Ga0496119_0153874
495 Ga0496119_0233846
496 Ga0496121_0021933
497 Ga0496124_0406013
498 Ga0496125_0006916
499 Ga0496126_0046735
500 Ga0495678_002045
501 nmdc:mga09592_65269_c1
502 nmdc:mga0rr50_9674_c1
503 Ga0500635_0011152
504 Ga0500578_0270084
505 Ga0500566_0003785
506 Ga0500640_001172
507 Ga0500554_142196
508 Ga0500572_014042
509 Ga0500595_000197
510 Ga0500597_002077
511 Ga0500597_087724
512 Ga0500614_000602
513 Ga0500642_0156259
514 Ga0500564_101492
515 Ga0500636_0104588
516 2644216740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

167

264

0.97

PF00072

Response_reg

Response regulator receiver domain

6

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9103 12 126
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9079 13 126
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.8944 15 128
5w43-assembly1.cif.gz_A structure of the two-component response regulator rcsb-dna complex 0.8884 13 129
2r25-assembly1.cif.gz_B complex of ypd1 and sln1-r1 with bound mg2+ and bef3- 0.8873 13 125
ID Description Score Start End Superfamily
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9266 14 128 3.40.50.2300
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9079 13 126 3.40.50.2300
af_P0AFT5_129_238_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.8987 140 244 2.40.50.1020
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8982 15 127 3.40.50.2300
af_Q2FVQ7_36_146_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.895 140 246 2.40.50.1020
ID Description Score Start End GO Terms
AF-A0A519UEC9-F1-model_v4 Response regulator 0.9564 14 136 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4Q3FDX0-F1-model_v4 Response regulator 0.9512 15 91 GO:0000160
AF-A0A4Q5YEC4-F1-model_v4 Response regulator 0.9471 15 136 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A850JB85-F1-model_v4 LytTR family transcriptional regulator 0.9392 142 247 GO:0000156
GO:0003677
AF-A0A7C7U9T4-F1-model_v4 Response regulator 0.9344 13 87 GO:0000160

Map