F367628

General Info

Members Datasets Scaffolds Average Seq Length
257 187 514 399

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0024258|Ga0501032_0024258_2866_4143
Length 425
Sequence MTAMTKKAENPVAHLTPEDIEAIGRELDAIRQEVIDSRGEADAAYIRRMIKTQRYLELGSRAVLLASLFPPAWVVGTAGLSVAKILDNMEIGHNILHGQWDWMRDPKIHSTVWEWDSASTAEGWKHSHNEVHHTYTNIIGKDNDLGYGIMRVDEDQRWTPGCLVQPLINFVNMLVFEYGIAAYDLELGRNLRLPKEKRPANFKDSLRKTLRKVRKQATKDYLVHPLLSGPSFLTTLAANLTANVVRNVWSHSVIMCGHFPEGVETYEKAAIDPNETRGEWYLRQMLGSANISGSRLMHIMTGNLSHQIEHHLWPDLPSNRYAEVAPRVRALFEKYNLNYCSRPLVPQVYSAWHKVVRLSLPNNWLATTTWRNLPEQLGVLWKMTTGDRAVRRALQKRLDYFAAGAPGEPEPAPEPVLLTLGARPA

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
80 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2643221561 Nocardioides sp. Root151 Isolate Unclassified
161 2643221576 Nocardioides sp. Root614 Isolate Unclassified
162 2643221590 Nocardioides sp. Root682 Isolate Unclassified
163 2643221604 Nocardioides sp. Root190 Isolate Unclassified
164 2643221615 Nocardioides sp. Root224 Isolate Unclassified
165 2643221617 Nocardioides sp. Root79 Isolate Unclassified
166 2643221620 Nocardioides sp. Root240 Isolate Unclassified
167 2643221641 Nocardioides sp. Root122 Isolate Unclassified
168 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
169 2643221696 Nocardioides sp. Root140 Isolate Unclassified
170 2643221711 Terrabacter sp. Root85 Isolate Unclassified
171 2738541305 Nocardioides sp. CF167 Isolate Unclassified
172 2739367898 Nocardioides sp. CF479 Isolate Unclassified
173 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
174 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
175 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
176 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
177 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
178 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
179 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
180 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
181 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
182 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
183 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
184 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
185 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
186 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
187 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.66
Metatranscriptomes 5.45
Isolates 10.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.78
Bulb 0
Endosphere 14.79
Nodule 0.39
Rhizoplane 8.56
Rhizosphere 60.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0024258 3300049569 Bacteria 4189
2 LJQas_1008284 3300000549 Bacteria 1265
3 JGI24738J21930_10002286 3300002075 Bacteria 5068
4 Ga0006778J45830_1009276 3300003162 Bacteria 2393
5 Ga0006759J45824_1021373 3300003163 Bacteria 1548
6 Ga0006781J51513_1006649 3300003568 Bacteria 1573
7 Ga0007410J51695_1009119 3300003574 Bacteria 1304
8 Ga0032354_1010097 3300003693 Bacteria 2365
9 Ga0058859_11817123 3300004798 Bacteria 1394
10 Ga0058860_10015645 3300004801 Bacteria 1315
11 Ga0070682_100018163 3300005337 Bacteria 4106
12 Ga0068868_100078668 3300005338 Bacteria 2640
13 Ga0070660_100037363 3300005339 Bacteria 3682
14 Ga0070660_100220474 3300005339 Bacteria 1541
15 Ga0070692_10008056 3300005345 Bacteria 4678
16 Ga0070674_100025582 3300005356 Bacteria 3845
17 Ga0070667_100018742 3300005367 Bacteria 5741
18 Ga0070667_100094532 3300005367 Bacteria 2576
19 Ga0070701_10002986 3300005438 Bacteria 6616
20 Ga0070707_100073059 3300005468 Bacteria 3307
21 Ga0070698_100024711 3300005471 Bacteria 6266
22 Ga0070684_100031123 3300005535 Bacteria 4540
23 Ga0068853_100040779 3300005539 Bacteria 3963
24 Ga0068852_100007131 3300005616 Bacteria 8143
25 Ga0068866_10056016 3300005718 Bacteria 2027
26 Ga0068861_100024145 3300005719 Bacteria 4393
27 Ga0068870_10003620 3300005840 Bacteria 6562
28 Ga0068860_100000713 3300005843 Bacteria 38044
29 Ga0068862_100075714 3300005844 Bacteria 2912
30 Ga0081455_10022746 3300005937 Bacteria 5849
31 Ga0075365_10002911 3300006038 Bacteria 8638
32 Ga0075365_10004791 3300006038 Bacteria 7216
33 Ga0075365_10009982 3300006038 Bacteria 5499
34 Ga0075365_10010152 3300006038 Bacteria 5467
35 Ga0075365_10024409 3300006038 Bacteria 3814
36 Ga0075365_10033718 3300006038 Bacteria 3301
37 Ga0075365_10037673 3300006038 Bacteria 3140
38 Ga0075365_10090264 3300006038 Bacteria 2087
39 Ga0075368_10000310 3300006042 Bacteria 14200
40 Ga0075368_10001843 3300006042 Bacteria 6815
41 Ga0075368_10015084 3300006042 Bacteria 2861
42 Ga0075364_10021595 3300006051 Bacteria 4058
43 Ga0075364_10045388 3300006051 Bacteria 2860
44 Ga0075362_10033812 3300006177 Bacteria 2225
45 Ga0075367_10016366 3300006178 Bacteria 4050
46 Ga0075369_10058012 3300006186 Bacteria 1685
47 Ga0075428_100065253 3300006844 Bacteria 3987
48 Ga0068865_100012091 3300006881 Bacteria 5425
49 Ga0111539_10196970 3300009094 Bacteria 2349
50 Ga0105245_10011291 3300009098 Bacteria 7778
51 Ga0105243_10004324 3300009148 Bacteria 11248
52 Ga0105237_10018137 3300009545 Bacteria 7287
53 Ga0105238_10264779 3300009551 Bacteria 1699
54 Ga0105239_10002745 3300010375 Bacteria 22112
55 Ga0157369_10478417 3300013105 Bacteria 1289
56 Ga0163162_10346325 3300013306 Bacteria 1619
57 Ga0157372_10021672 3300013307 Bacteria 6946
58 Ga0157372_10046510 3300013307 Bacteria 4817
59 Ga0157375_10077704 3300013308 Bacteria 3350
60 Ga0157375_10142924 3300013308 Bacteria 2521
61 Ga0157375_10166076 3300013308 Bacteria 2352
62 Ga0163163_10133004 3300014325 Bacteria 2527
63 Ga0207647_10056024 3300025904 Bacteria 2420
64 Ga0207643_10008374 3300025908 Bacteria 5546
65 Ga0207657_10008508 3300025919 Bacteria 10407
66 Ga0207657_10029235 3300025919 Bacteria 5019
67 Ga0207646_10082319 3300025922 Bacteria 2878
68 Ga0207694_10088879 3300025924 Bacteria 2436
69 Ga0207687_10023577 3300025927 Bacteria 4104
70 Ga0207706_10026596 3300025933 Bacteria 5178
71 Ga0207709_10030283 3300025935 Bacteria 3147
72 Ga0207704_10159474 3300025938 Bacteria 1603
73 Ga0207691_10001264 3300025940 Bacteria 25336
74 Ga0207651_10008057 3300025960 Bacteria 5656
75 Ga0207658_10095130 3300025986 Bacteria 2320
76 Ga0207708_10000259 3300026075 Bacteria 41740
77 Ga0207648_10082596 3300026089 Bacteria 2802
78 Ga0207675_100007084 3300026118 Bacteria 10597
79 Ga0268264_10000354 3300028381 Bacteria 69023
80 Ga0307515_10067821 3300028794 Bacteria 4914
81 Ga0314311_1259583 3300030733 Bacteria 1589
82 Ga0307410_10235686 3300031852 Bacteria 1415
83 Ga0307406_10005066 3300031901 Bacteria 7185
84 Ga0307407_10014341 3300031903 Bacteria 3877
85 Ga0307407_10040394 3300031903 Bacteria 2601
86 Ga0307412_10068185 3300031911 Bacteria 2418
87 Ga0307412_10240674 3300031911 Bacteria 1399
88 Ga0307409_100019230 3300031995 Bacteria 4618
89 Ga0307409_100043345 3300031995 Bacteria 3377
90 Ga0307416_100020511 3300032002 Bacteria 4719
91 Ga0307416_100134940 3300032002 Bacteria 2230
92 Ga0307416_100183564 3300032002 Bacteria 1963
93 Ga0307411_10079635 3300032005 Bacteria 2250
94 Ga0307415_100029714 3300032126 Bacteria 3496
95 Ga0307415_100081882 3300032126 Bacteria 2307
96 Ga0307415_100222360 3300032126 Bacteria 1514
97 Ga0307510_10173446 3300033180 Bacteria 1731
98 Ga0395900_0060221 3300037418 Bacteria 3908
99 Ga0395898_0131455 3300037466 Bacteria 2397
100 Ga0395905_0019724 3300037471 Bacteria 6392
101 Ga0436361_1040915 3300039447 Bacteria 3005
102 Ga0451837_1620368 3300041494 Bacteria 2852
103 Ga0451839_1130317 3300041496 Bacteria 5058
104 Ga0466972_0012300 3300044658 Bacteria 4302
105 Ga0466965_0019730 3300044683 Bacteria 3238
106 Ga0466965_0040313 3300044683 Bacteria 2299
107 Ga0466966_0002691 3300044684 Bacteria 11644
108 Ga0466961_0035865 3300044693 Bacteria 3183
109 Ga0466961_0081973 3300044693 Bacteria 2041
110 Ga0466963_0087789 3300044694 Bacteria 2115
111 Ga0466964_0032886 3300044706 Bacteria 2063
112 Ga0466971_0010190 3300044719 Bacteria 4105
113 Ga0466968_0029270 3300044735 Bacteria 2277
114 Ga0466970_0021605 3300044765 Bacteria 3353
115 Ga0466970_0023249 3300044765 Bacteria 3236
116 Ga0466970_0043961 3300044765 Bacteria 2378
117 Ga0466970_0047617 3300044765 Bacteria 2285
118 Ga0466970_0057330 3300044765 Bacteria 2083
119 Ga0466957_0005322 3300044842 Bacteria 7218
120 Ga0466957_0019760 3300044842 Bacteria 3964
121 Ga0466957_0057945 3300044842 Bacteria 2372
122 Ga0466957_0106319 3300044842 Bacteria 1775
123 Ga0466957_0118146 3300044842 Bacteria 1688
124 Ga0466960_0008532 3300044901 Bacteria 4198
125 Ga0466960_0041330 3300044901 Bacteria 2184
126 Ga0466960_0053139 3300044901 Bacteria 1962
127 Ga0466960_0104098 3300044901 Bacteria 1466
128 Ga0466959_0012382 3300045049 Bacteria 6161
129 Ga0466958_0005742 3300045836 Bacteria 6707
130 Ga0466958_0030520 3300045836 Bacteria 3202
131 Ga0466967_0020983 3300045976 Bacteria 5292
132 Ga0466967_0072429 3300045976 Bacteria 3088
133 Ga0466967_0147930 3300045976 Bacteria 2192
134 Ga0466967_0153122 3300045976 Bacteria 2157
135 Ga0495653_0006740 3300046463 Bacteria 9429
136 Ga0496101_0018201 3300048904 Bacteria 4774
137 Ga0496102_0000001 3300048905 Bacteria 873433
138 Ga0496102_0002357 3300048905 Bacteria 16115
139 Ga0496102_0016436 3300048905 Bacteria 6464
140 Ga0496102_0245182 3300048905 Bacteria 1689
141 Ga0496103_0000007 3300048906 Bacteria 354915
142 Ga0496104_0052344 3300048907 Bacteria 3856
143 Ga0496105_0027886 3300048908 Bacteria 4617
144 Ga0496105_0125756 3300048908 Bacteria 2113
145 Ga0496106_0025150 3300048909 Bacteria 4429
146 Ga0496106_0032458 3300048909 Bacteria 3893
147 Ga0496107_0010986 3300048910 Bacteria 6301
148 Ga0496108_0038591 3300048911 Bacteria 3979
149 Ga0496110_0031966 3300048913 Bacteria 4542
150 Ga0496110_0087963 3300048913 Bacteria 2774
151 Ga0496112_0042429 3300048915 Bacteria 4451
152 Ga0496113_0035456 3300048916 Bacteria 3648
153 Ga0496114_0001525 3300048917 Bacteria 17558
154 Ga0496114_0003542 3300048917 Bacteria 11980
155 Ga0496114_0081359 3300048917 Bacteria 2736
156 Ga0496114_0115289 3300048917 Bacteria 2305
157 Ga0496115_0205961 3300048918 Bacteria 1625
158 Ga0496116_0000018 3300048919 Bacteria 545877
159 Ga0496117_0000015 3300048920 Bacteria 583316
160 Ga0496118_0000012 3300048921 Bacteria 583316
161 Ga0496119_0000947 3300048922 Bacteria 37356
162 Ga0496119_0037997 3300048922 Bacteria 3117
163 Ga0496120_0000195 3300048923 Bacteria 104031
164 Ga0496121_0000177 3300048924 Bacteria 141456
165 Ga0496126_0000906 3300048929 Bacteria 51430
166 Ga0501306_000935 3300049127 Bacteria 2527
167 Ga0501309_000442 3300049129 Bacteria 3299
168 Ga0501305_000803 3300049161 Bacteria 2777
169 Ga0501318_002710 3300049534 Bacteria 1563
170 Ga0501325_001161 3300049541 Bacteria 1549
171 Ga0501032_0070016 3300049569 Bacteria 2340
172 Ga0501034_0005013 3300049571 Bacteria 14559
173 Ga0501036_0007806 3300049572 Bacteria 8750
174 Ga0501037_0001756 3300049573 Bacteria 15756
175 Ga0501038_0003412 3300049574 Bacteria 14806
176 Ga0501038_0005980 3300049574 Bacteria 11254
177 Ga0501038_0066172 3300049574 Bacteria 3078
178 Ga0501039_0020913 3300049575 Bacteria 5018
179 Ga0501039_0032329 3300049575 Bacteria 4033
180 Ga0501040_0046683 3300049576 Bacteria 2956
181 Ga0501041_0001801 3300049577 Bacteria 12006
182 Ga0501042_0003312 3300049578 Bacteria 10082
183 Ga0501042_0009683 3300049578 Bacteria 6435
184 Ga0501042_0185673 3300049578 Bacteria 1500
185 Ga0501043_0006753 3300049579 Bacteria 9162
186 Ga0501046_0003024 3300049580 Bacteria 15538
187 Ga0501048_0002376 3300049582 Bacteria 14366
188 Ga0501067_0007125 3300049583 Bacteria 6209
189 Ga0501069_0121140 3300049585 Bacteria 1494
190 Ga0501070_0006086 3300049586 Bacteria 10281
191 Ga0501070_0163350 3300049586 Bacteria 1835
192 Ga0501071_0010507 3300049587 Bacteria 6207
193 Ga0501071_0123185 3300049587 Bacteria 1923
194 Ga0501075_0021198 3300049591 Bacteria 4735
195 Ga0501076_0004033 3300049592 Bacteria 10372
196 Ga0501076_0215818 3300049592 Bacteria 1568
197 Ga0501081_0042551 3300049743 Bacteria 3113
198 Ga0501035_0098029 3300049822 Bacteria 2573
199 Ga0501044_0005955 3300049823 Bacteria 13492
200 Ga0501045_0006864 3300049824 Bacteria 7887
201 nmdc:mga03683_14304_c1 3300050489 Bacteria 1855
202 nmdc:mga03n38_54654_c1 3300050490 Bacteria 1796
203 nmdc:mga03n38_9757_c1 3300050490 Bacteria 3503
204 nmdc:mga00v17_13323_c1 3300050491 Bacteria 4563
205 nmdc:mga0yw44_106561_c1 3300050492 Bacteria 1792
206 nmdc:mga0yw44_15337_c1 3300050492 Bacteria 4101
207 nmdc:mga0yw44_18008_c1 3300050492 Bacteria 3860
208 nmdc:mga0yw44_28643_c1 3300050492 Bacteria 3207
209 nmdc:mga0yw44_30124_c1 3300050492 Bacteria 3141
210 nmdc:mga0yw44_48139_c1 3300050492 Bacteria 2570
211 nmdc:mga06z11_123444_c1 3300050494 Bacteria 1447
212 nmdc:mga06z11_2045_c1 3300050494 Bacteria 7655
213 nmdc:mga06z11_47501_c1 3300050494 Bacteria 2181
214 nmdc:mga04h51_7329_c1 3300050495 Bacteria 2905
215 nmdc:mga07m45_23268_c1 3300050496 Bacteria 3385
216 nmdc:mga07m45_24050_c1 3300050496 Bacteria 3334
217 nmdc:mga07m45_33305_c1 3300050496 Bacteria 2861
218 nmdc:mga08y16_13087_c1 3300050511 Bacteria 8728
219 nmdc:mga0sz30_23551_c1 3300050516 Bacteria 2506
220 nmdc:mga0sz30_23764_c1 3300050516 Bacteria 2497
221 Ga0495601_0063884 3300053077 Bacteria 2340
222 Ga0500643_001936 3300053087 Bacteria 11224
223 Ga0500644_0000185 3300053088 Bacteria 39629
224 Ga0500593_000132 3300053117 Bacteria 29758
225 Ga0501084_0016728 3300054114 Bacteria 6090
226 Ga0587119_000546 3300059658 Bacteria 2550
227 Ga0587071_012066 3300060344 Bacteria 1468
228 Ga0466962_0007028 3300061719 Bacteria 5394
229 Ga0530510_0058026 3300061734 Bacteria 2798
230 2643824998 2643221561 Bacteria 4984412
231 2643890579 2643221576 Bacteria 5214352
232 2643959635 2643221590 Bacteria 5214697
233 2644032909 2643221604 Bacteria 5014917
234 2644092811 2643221615 Bacteria 5487866
235 2644100591 2643221617 Bacteria 5139111
236 2644116999 2643221620 Bacteria 5134593
237 2644228194 2643221641 Bacteria 4490190
238 2644322424 2643221657 Bacteria 5490246
239 2644534695 2643221696 Bacteria 5431823
240 2644609312 2643221711 Bacteria 4865335
241 2738869485 2738541305 Bacteria 4910150
242 2740165690 2739367898 Bacteria 4367674
243 2774395961 2773857762 Bacteria 5971770
244 2809197629 2808606439 Bacteria 5952208
245 2812347909 2811994878 Bacteria 5992952
246 2816505030 2816332139 Bacteria 9138787
247 2819426402 2818991318 Bacteria 5266538
248 2819664830 2818991458 Bacteria 4794049
249 2832007269 2832004796 Bacteria 6538017
250 2855388697 2855386786 Bacteria 4752232
251 2857484783 2857481737 Bacteria 4761446
252 2866068760 2866065130 Bacteria 6518152
253 2891968698 2891968417 Bacteria 5821697
254 2902795056 2902792274 Bacteria 7270173
255 2984578497 2984576629 Bacteria 4248407
256 2990259305 2990256926 Bacteria 4252839
257 8054612178 8054609563 Bacteria 5170090
258 Ga0501032_0024258
259 LJQas_1008284
260 JGI24738J21930_10002286
261 Ga0006778J45830_1009276
262 Ga0006759J45824_1021373
263 Ga0006781J51513_1006649
264 Ga0007410J51695_1009119
265 Ga0032354_1010097
266 Ga0058859_11817123
267 Ga0058860_10015645
268 Ga0070682_100018163
269 Ga0068868_100078668
270 Ga0070660_100037363
271 Ga0070660_100220474
272 Ga0070692_10008056
273 Ga0070674_100025582
274 Ga0070667_100018742
275 Ga0070667_100094532
276 Ga0070701_10002986
277 Ga0070707_100073059
278 Ga0070698_100024711
279 Ga0070684_100031123
280 Ga0068853_100040779
281 Ga0068852_100007131
282 Ga0068866_10056016
283 Ga0068861_100024145
284 Ga0068870_10003620
285 Ga0068860_100000713
286 Ga0068862_100075714
287 Ga0081455_10022746
288 Ga0075365_10002911
289 Ga0075365_10004791
290 Ga0075365_10009982
291 Ga0075365_10010152
292 Ga0075365_10024409
293 Ga0075365_10033718
294 Ga0075365_10037673
295 Ga0075365_10090264
296 Ga0075368_10000310
297 Ga0075368_10001843
298 Ga0075368_10015084
299 Ga0075364_10021595
300 Ga0075364_10045388
301 Ga0075362_10033812
302 Ga0075367_10016366
303 Ga0075369_10058012
304 Ga0075428_100065253
305 Ga0068865_100012091
306 Ga0111539_10196970
307 Ga0105245_10011291
308 Ga0105243_10004324
309 Ga0105237_10018137
310 Ga0105238_10264779
311 Ga0105239_10002745
312 Ga0157369_10478417
313 Ga0163162_10346325
314 Ga0157372_10021672
315 Ga0157372_10046510
316 Ga0157375_10077704
317 Ga0157375_10142924
318 Ga0157375_10166076
319 Ga0163163_10133004
320 Ga0207647_10056024
321 Ga0207643_10008374
322 Ga0207657_10008508
323 Ga0207657_10029235
324 Ga0207646_10082319
325 Ga0207694_10088879
326 Ga0207687_10023577
327 Ga0207706_10026596
328 Ga0207709_10030283
329 Ga0207704_10159474
330 Ga0207691_10001264
331 Ga0207651_10008057
332 Ga0207658_10095130
333 Ga0207708_10000259
334 Ga0207648_10082596
335 Ga0207675_100007084
336 Ga0268264_10000354
337 Ga0307515_10067821
338 Ga0314311_1259583
339 Ga0307410_10235686
340 Ga0307406_10005066
341 Ga0307407_10014341
342 Ga0307407_10040394
343 Ga0307412_10068185
344 Ga0307412_10240674
345 Ga0307409_100019230
346 Ga0307409_100043345
347 Ga0307416_100020511
348 Ga0307416_100134940
349 Ga0307416_100183564
350 Ga0307411_10079635
351 Ga0307415_100029714
352 Ga0307415_100081882
353 Ga0307415_100222360
354 Ga0307510_10173446
355 Ga0395900_0060221
356 Ga0395898_0131455
357 Ga0395905_0019724
358 Ga0436361_1040915
359 Ga0451837_1620368
360 Ga0451839_1130317
361 Ga0466972_0012300
362 Ga0466965_0019730
363 Ga0466965_0040313
364 Ga0466966_0002691
365 Ga0466961_0035865
366 Ga0466961_0081973
367 Ga0466963_0087789
368 Ga0466964_0032886
369 Ga0466971_0010190
370 Ga0466968_0029270
371 Ga0466970_0021605
372 Ga0466970_0023249
373 Ga0466970_0043961
374 Ga0466970_0047617
375 Ga0466970_0057330
376 Ga0466957_0005322
377 Ga0466957_0019760
378 Ga0466957_0057945
379 Ga0466957_0106319
380 Ga0466957_0118146
381 Ga0466960_0008532
382 Ga0466960_0041330
383 Ga0466960_0053139
384 Ga0466960_0104098
385 Ga0466959_0012382
386 Ga0466958_0005742
387 Ga0466958_0030520
388 Ga0466967_0020983
389 Ga0466967_0072429
390 Ga0466967_0147930
391 Ga0466967_0153122
392 Ga0495653_0006740
393 Ga0496101_0018201
394 Ga0496102_0000001
395 Ga0496102_0002357
396 Ga0496102_0016436
397 Ga0496102_0245182
398 Ga0496103_0000007
399 Ga0496104_0052344
400 Ga0496105_0027886
401 Ga0496105_0125756
402 Ga0496106_0025150
403 Ga0496106_0032458
404 Ga0496107_0010986
405 Ga0496108_0038591
406 Ga0496110_0031966
407 Ga0496110_0087963
408 Ga0496112_0042429
409 Ga0496113_0035456
410 Ga0496114_0001525
411 Ga0496114_0003542
412 Ga0496114_0081359
413 Ga0496114_0115289
414 Ga0496115_0205961
415 Ga0496116_0000018
416 Ga0496117_0000015
417 Ga0496118_0000012
418 Ga0496119_0000947
419 Ga0496119_0037997
420 Ga0496120_0000195
421 Ga0496121_0000177
422 Ga0496126_0000906
423 Ga0501306_000935
424 Ga0501309_000442
425 Ga0501305_000803
426 Ga0501318_002710
427 Ga0501325_001161
428 Ga0501032_0070016
429 Ga0501034_0005013
430 Ga0501036_0007806
431 Ga0501037_0001756
432 Ga0501038_0003412
433 Ga0501038_0005980
434 Ga0501038_0066172
435 Ga0501039_0020913
436 Ga0501039_0032329
437 Ga0501040_0046683
438 Ga0501041_0001801
439 Ga0501042_0003312
440 Ga0501042_0009683
441 Ga0501042_0185673
442 Ga0501043_0006753
443 Ga0501046_0003024
444 Ga0501048_0002376
445 Ga0501067_0007125
446 Ga0501069_0121140
447 Ga0501070_0006086
448 Ga0501070_0163350
449 Ga0501071_0010507
450 Ga0501071_0123185
451 Ga0501075_0021198
452 Ga0501076_0004033
453 Ga0501076_0215818
454 Ga0501081_0042551
455 Ga0501035_0098029
456 Ga0501044_0005955
457 Ga0501045_0006864
458 nmdc:mga03683_14304_c1
459 nmdc:mga03n38_54654_c1
460 nmdc:mga03n38_9757_c1
461 nmdc:mga00v17_13323_c1
462 nmdc:mga0yw44_106561_c1
463 nmdc:mga0yw44_15337_c1
464 nmdc:mga0yw44_18008_c1
465 nmdc:mga0yw44_28643_c1
466 nmdc:mga0yw44_30124_c1
467 nmdc:mga0yw44_48139_c1
468 nmdc:mga06z11_123444_c1
469 nmdc:mga06z11_2045_c1
470 nmdc:mga06z11_47501_c1
471 nmdc:mga04h51_7329_c1
472 nmdc:mga07m45_23268_c1
473 nmdc:mga07m45_24050_c1
474 nmdc:mga07m45_33305_c1
475 nmdc:mga08y16_13087_c1
476 nmdc:mga0sz30_23551_c1
477 nmdc:mga0sz30_23764_c1
478 Ga0495601_0063884
479 Ga0500643_001936
480 Ga0500644_0000185
481 Ga0500593_000132
482 Ga0501084_0016728
483 Ga0587119_000546
484 Ga0587071_012066
485 Ga0466962_0007028
486 Ga0530510_0058026
487 2643824998
488 2643890579
489 2643959635
490 2644032909
491 2644092811
492 2644100591
493 2644116999
494 2644228194
495 2644322424
496 2644534695
497 2644609312
498 2738869485
499 2740165690
500 2774395961
501 2809197629
502 2812347909
503 2816505030
504 2819426402
505 2819664830
506 2832007269
507 2855388697
508 2857484783
509 2866068760
510 2891968698
511 2902795056
512 2984578497
513 2990259305
514 8054612178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

62

343

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oz1-assembly1.cif.gz_A crystal structure of the adenylation (a) domain of the carboxylate reductase (car) gr01_22995 from mycobacterium chelonae 0.2866 244 351
1s8l-assembly1.cif.gz_A anion-free form of the d85s mutant of bacteriorhodopsin from crystals grown in the presence of halide 0.28 18 248
1s8l-assembly1.cif.gz_A anion-free form of the d85s mutant of bacteriorhodopsin from crystals grown in the presence of halide 0.2635 18 248
7rdr-assembly1.cif.gz_A circular tandem repeat protein with novel repeat topology and enhanced subunit contact surfaces 0.1892 19 397
8g4c-assembly1.cif.gz_A bceabs atpgs high res tm 0.1876 206 359
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6393 72 342 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6249 72 342 3.30.40.10
1s8lA00 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.28 18 248 1.20.1070.10
1s8lA00 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2635 18 248 1.20.1070.10
af_Q91ZB7_5_285_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2245 18 279 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A6B3HTD8-F1-model_v4 Acyl-CoA desaturase 0.984 119 353 GO:0006629
GO:0016020
GO:0016717
AF-A0A4R4MCX7-F1-model_v4 deleted 0.9838 4 310
AF-I4EYZ2-F1-model_v4 Fatty acid desaturase (EC 1.14.19.-) 0.9817 1 396 GO:0006629
GO:0016020
GO:0016717
AF-A0A7K0Q282-F1-model_v4 Acyl-CoA desaturase 0.9813 77 396 GO:0006629
GO:0016020
GO:0016717
AF-A0A4R4MCX7-F1-model_v4 deleted 0.9806 4 310

Map