F366314

General Info

Members Datasets Scaffolds Average Seq Length
256 158 512 280

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100215084|Ga0070679_1002150843
Length 294
Sequence VFRRPVLIRLEPLRQNGAVSAFVASIPSPSSGVFHLGPLTLHMYGVMLLLAIAACVWLTGVRWVRWGGDWDLVYRVAIWGVIAGIIGARLYHVVTSYNETSHEGWYWPLAVWKGGLGVWGGILFGTLVGAWIVRRSGASVRLFMDAVAPGLLLAQAIGRWGNYWNQELYGKHTTLPWGLEIHGKGSANTYHPTFLYEFIWNVIGVGVLLWIDRRFKLRRPALFALYVAWYTAFRTFEETLRIDPSNHFLGQRINFWVSLLCFVASVAFFVWWQFVRKPEVPKGPTMAVPRGRVR

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.94
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100215084 3300005530 Bacteria 1885
2 Ga0065707_10083210 3300005295 Bacteria 10007
3 Ga0070658_10008141 3300005327 Bacteria 8431
4 Ga0070658_10118464 3300005327 Bacteria 2198
5 Ga0070658_10473386 3300005327 Bacteria 1080
6 Ga0070683_100094891 3300005329 Bacteria 2804
7 Ga0070680_100050722 3300005336 Bacteria 3385
8 Ga0070682_100079071 3300005337 Bacteria 2123
9 Ga0070661_100219225 3300005344 Bacteria 1459
10 Ga0070668_100162918 3300005347 Bacteria 1810
11 Ga0070659_100258156 3300005366 Bacteria 1446
12 Ga0070667_100011136 3300005367 Bacteria 7440
13 Ga0070714_100015126 3300005435 Bacteria 6203
14 Ga0070714_100021299 3300005435 Bacteria 5304
15 Ga0070714_100032935 3300005435 Bacteria 4329
16 Ga0070714_100169679 3300005435 Bacteria 1979
17 Ga0070713_100377294 3300005436 Bacteria 1320
18 Ga0070711_100474890 3300005439 Bacteria 1027
19 Ga0070705_100009831 3300005440 Bacteria 4770
20 Ga0070700_100060168 3300005441 Bacteria 2394
21 Ga0070708_100780168 3300005445 Unclassified 898
22 Ga0070681_10030499 3300005458 Bacteria 5410
23 Ga0070681_10039310 3300005458 Bacteria 4743
24 Ga0070681_10093072 3300005458 Bacteria 2963
25 Ga0070706_100056578 3300005467 Unclassified 3619
26 Ga0070707_100204477 3300005468 Bacteria 1925
27 Ga0070698_100006139 3300005471 Bacteria 13087
28 Ga0070698_100043428 3300005471 Bacteria 4608
29 Ga0070698_100049500 3300005471 Unclassified 4288
30 Ga0070699_100020010 3300005518 Bacteria 5767
31 Ga0070679_100047175 3300005530 Bacteria 4295
32 Ga0070679_100233244 3300005530 Bacteria 1800
33 Ga0070679_100240556 3300005530 Bacteria 1767
34 Ga0070684_100239856 3300005535 Bacteria 1656
35 Ga0070696_100238708 3300005546 Bacteria 1370
36 Ga0070704_100109418 3300005549 Bacteria 2100
37 Ga0068855_100017572 3300005563 Bacteria 8601
38 Ga0068855_100166380 3300005563 Bacteria 2499
39 Ga0068855_100222541 3300005563 Bacteria 2116
40 Ga0068859_100018322 3300005617 Bacteria 7039
41 Ga0068864_100099924 3300005618 Bacteria 2571
42 Ga0068861_100039229 3300005719 Bacteria 3533
43 Ga0068862_100012040 3300005844 Bacteria 7147
44 Ga0068862_100157806 3300005844 Bacteria 2023
45 Ga0081539_10001069 3300005985 Bacteria 50060
46 Ga0070717_10021998 3300006028 Bacteria 5032
47 Ga0070712_100162631 3300006175 Bacteria 1725
48 Ga0075434_100047835 3300006871 Unclassified 4244
49 Ga0068865_100291994 3300006881 Bacteria 1302
50 Ga0097620_100018323 3300006931 Bacteria 7039
51 Ga0105240_10108289 3300009093 Bacteria 3367
52 Ga0105240_10154580 3300009093 Bacteria 2730
53 Ga0105240_10428591 3300009093 Bacteria 1484
54 Ga0105240_10438255 3300009093 Bacteria 1464
55 Ga0105245_10092239 3300009098 Bacteria 2789
56 Ga0114129_10622276 3300009147 Bacteria 1396
57 Ga0105249_10005917 3300009553 Bacteria 10593
58 Ga0157373_10099050 3300013100 Bacteria 2051
59 Ga0157373_10107895 3300013100 Bacteria 1958
60 Ga0157370_10021663 3300013104 Bacteria 6403
61 Ga0157370_10330910 3300013104 Bacteria 1404
62 Ga0157369_10001471 3300013105 Bacteria 28864
63 Ga0157369_10065392 3300013105 Bacteria 3913
64 Ga0157369_10066827 3300013105 Bacteria 3867
65 Ga0157374_10451405 3300013296 Bacteria 1287
66 Ga0157378_10263269 3300013297 Bacteria 1655
67 Ga0163162_10014206 3300013306 Bacteria 7780
68 Ga0157372_10529351 3300013307 Bacteria 1374
69 Ga0163163_10060245 3300014325 Bacteria 3758
70 Ga0157380_10578036 3300014326 Bacteria 1107
71 Ga0182008_10002948 3300014497 Bacteria 10479
72 Ga0182007_10021965 3300015262 Bacteria 2258
73 Ga0207653_10025133 3300025885 Bacteria 1904
74 Ga0207699_10028873 3300025906 Bacteria 3088
75 Ga0207705_10054030 3300025909 Bacteria 2895
76 Ga0207705_10081447 3300025909 Bacteria 2359
77 Ga0207705_10095044 3300025909 Bacteria 2187
78 Ga0207707_10014284 3300025912 Bacteria 6917
79 Ga0207707_10334518 3300025912 Bacteria 1306
80 Ga0207695_10071250 3300025913 Bacteria 3550
81 Ga0207693_10148170 3300025915 Bacteria 1845
82 Ga0207660_10004756 3300025917 Bacteria 8840
83 Ga0207660_10171542 3300025917 Bacteria 1679
84 Ga0207660_10560666 3300025917 Unclassified 929
85 Ga0207657_10003381 3300025919 Bacteria 17064
86 Ga0207657_10016205 3300025919 Bacteria 7194
87 Ga0207657_10156497 3300025919 Bacteria 1853
88 Ga0207649_10288144 3300025920 Bacteria 1196
89 Ga0207652_10036277 3300025921 Bacteria 4168
90 Ga0207652_10083449 3300025921 Bacteria 2798
91 Ga0207652_10251990 3300025921 Bacteria 1592
92 Ga0207652_10403337 3300025921 Bacteria 1234
93 Ga0207646_10031587 3300025922 Bacteria 4795
94 Ga0207646_10326565 3300025922 Bacteria 1386
95 Ga0207700_10107310 3300025928 Bacteria 2240
96 Ga0207700_10377977 3300025928 Bacteria 1238
97 Ga0207664_10002147 3300025929 Bacteria 12970
98 Ga0207664_10078994 3300025929 Bacteria 2670
99 Ga0207664_10095255 3300025929 Bacteria 2449
100 Ga0207664_10139780 3300025929 Bacteria 2047
101 Ga0207664_10174303 3300025929 Bacteria 1843
102 Ga0207706_10041824 3300025933 Bacteria 4062
103 Ga0207670_10211817 3300025936 Bacteria 1478
104 Ga0207661_10065756 3300025944 Bacteria 2944
105 Ga0207661_10369130 3300025944 Bacteria 1297
106 Ga0207667_10034779 3300025949 Bacteria 5408
107 Ga0207667_10214301 3300025949 Bacteria 1974
108 Ga0207667_10427101 3300025949 Bacteria 1348
109 Ga0207712_10045390 3300025961 Bacteria 3043
110 Ga0207658_10029856 3300025986 Bacteria 3855
111 Ga0207677_10033877 3300026023 Bacteria 3301
112 Ga0207639_10189794 3300026041 Bacteria 1754
113 Ga0207702_10552346 3300026078 Bacteria 1127
114 Ga0207675_100001286 3300026118 Bacteria 25132
115 Ga0268265_10630106 3300028380 Bacteria 1028
116 Ga0268264_10271317 3300028381 Unclassified 1585
117 Ga0265319_1020717 3300028563 Bacteria 2430
118 Ga0265319_1033792 3300028563 Bacteria 1764
119 Ga0265334_10007291 3300028573 Bacteria 4743
120 Ga0265318_10002296 3300028577 Bacteria 10270
121 Ga0265323_10059999 3300028653 Bacteria 1326
122 Ga0265322_10029306 3300028654 Bacteria 1573
123 Ga0265336_10064731 3300028666 Bacteria 1094
124 Ga0265336_10073649 3300028666 Bacteria 1021
125 Ga0265338_10003206 3300028800 Bacteria 23339
126 Ga0265338_10011260 3300028800 Bacteria 10357
127 Ga0265338_10059073 3300028800 Bacteria 3381
128 Ga0265338_10067651 3300028800 Bacteria 3083
129 Ga0265338_10070011 3300028800 Bacteria 3010
130 Ga0265338_10094837 3300028800 Bacteria 2453
131 Ga0265330_10026385 3300031235 Bacteria 2627
132 Ga0265332_10036465 3300031238 Bacteria 2134
133 Ga0265328_10003863 3300031239 Bacteria 6587
134 Ga0265320_10131991 3300031240 Bacteria 1134
135 Ga0265325_10063335 3300031241 Bacteria 1871
136 Ga0265340_10105665 3300031247 Bacteria 1305
137 Ga0265339_10031781 3300031249 Bacteria 2981
138 Ga0265339_10054721 3300031249 Bacteria 2166
139 Ga0265331_10011571 3300031250 Bacteria 4826
140 Ga0265327_10023700 3300031251 Bacteria 3626
141 Ga0265327_10034211 3300031251 Bacteria 2822
142 Ga0265316_10228879 3300031344 Bacteria 1369
143 Ga0265316_10290179 3300031344 Bacteria 1193
144 Ga0307408_100115164 3300031548 Bacteria 2073
145 Ga0265313_10073551 3300031595 Bacteria 1568
146 Ga0265314_10145435 3300031711 Bacteria 1460
147 Ga0307407_10004123 3300031903 Bacteria 6117
148 Ga0307412_10014443 3300031911 Unclassified 4659
149 Ga0307416_100120865 3300032002 Bacteria 2334
150 Ga0316583_10024000 3300032133 Bacteria 2178
151 Ga0373956_0126108 3300035119 Bacteria 1197
152 Ga0373946_0016659 3300035171 Bacteria 2803
153 Ga0395899_0015421 3300037312 Bacteria 5825
154 Ga0395899_0016139 3300037312 Bacteria 5694
155 Ga0395899_0071358 3300037312 Bacteria 2541
156 Ga0395900_0019026 3300037418 Bacteria 7003
157 Ga0395900_0029718 3300037418 Bacteria 5607
158 Ga0395900_0036584 3300037418 Bacteria 5060
159 Ga0395900_0056337 3300037418 Bacteria 4046
160 Ga0395900_0710561 3300037418 Bacteria 938
161 Ga0395898_0003141 3300037466 Bacteria 18655
162 Ga0395898_0013529 3300037466 Bacteria 8402
163 Ga0395898_0030860 3300037466 Bacteria 5361
164 Ga0395898_0138779 3300037466 Bacteria 2327
165 Ga0395898_0220008 3300037466 Bacteria 1811
166 Ga0395905_0004701 3300037471 Bacteria 14113
167 Ga0395905_0007393 3300037471 Bacteria 10922
168 Ga0395901_0005810 3300038443 Bacteria 12498
169 Ga0395901_0023156 3300038443 Bacteria 6367
170 Ga0395901_0048569 3300038443 Bacteria 4407
171 Ga0395901_0096066 3300038443 Bacteria 3106
172 Ga0395901_0367731 3300038443 Bacteria 1482
173 Ga0395901_0539097 3300038443 Bacteria 1184
174 Ga0451577_0062924 3300042876 Unclassified 3309
175 Ga0466969_0140797 3300044656 Bacteria 1115
176 Ga0466972_0067133 3300044658 Bacteria 1714
177 Ga0466963_0006098 3300044694 Bacteria 7108
178 Ga0466963_0025351 3300044694 Bacteria 3782
179 Ga0466964_0253494 3300044706 Bacteria 869
180 Ga0453684_0570656 3300044712 Bacteria 1244
181 Ga0466971_0036790 3300044719 Bacteria 2195
182 Ga0466959_0096948 3300045049 Bacteria 2114
183 Ga0451576_0273619 3300045051 Bacteria 1766
184 Ga0466958_0021999 3300045836 Bacteria 3730
185 Ga0466958_0088990 3300045836 Bacteria 1908
186 Ga0466967_0002073 3300045976 Bacteria 12269
187 Ga0466967_0005113 3300045976 Bacteria 9014
188 Ga0466967_0067194 3300045976 Bacteria 3197
189 Ga0466967_0134269 3300045976 Bacteria 2300
190 Ga0466967_0252468 3300045976 Bacteria 1685
191 Ga0466967_0257867 3300045976 Bacteria 1667
192 Ga0466967_0258415 3300045976 Bacteria 1666
193 Ga0495653_0063132 3300046463 Bacteria 2797
194 Ga0495653_0147926 3300046463 Bacteria 1644
195 Ga0495582_0013466 3300046473 Bacteria 4502
196 Ga0495662_0081234 3300046476 Bacteria 1576
197 Ga0495584_0125246 3300046491 Bacteria 1302
198 Ga0495594_0051729 3300046499 Bacteria 2261
199 Ga0495616_0099306 3300046513 Bacteria 1367
200 Ga0495598_0022471 3300046537 Bacteria 1689
201 Ga0495609_0049342 3300046538 Bacteria 1879
202 Ga0495667_0068679 3300046559 Bacteria 2314
203 Ga0495667_0212316 3300046559 Bacteria 1237
204 Ga0495656_0191639 3300046615 Bacteria 1010
205 Ga0495611_0086540 3300046648 Bacteria 1446
206 Ga0495635_0136229 3300046663 Bacteria 1673
207 Ga0495599_0214639 3300046678 Bacteria 1179
208 Ga0495599_0231249 3300046678 Bacteria 1129
209 Ga0495658_0037532 3300046683 Bacteria 2679
210 Ga0495613_0512939 3300046689 Bacteria 806
211 Ga0495624_0042458 3300046690 Bacteria 2906
212 Ga0495600_0184187 3300046809 Bacteria 1345
213 Ga0495581_0004910 3300047315 Bacteria 7733
214 Ga0495604_0168422 3300047317 Bacteria 1543
215 Ga0495680_0023044 3300047322 Bacteria 5182
216 Ga0495680_0102232 3300047322 Bacteria 2134
217 Ga0496100_0034863 3300048903 Bacteria 3162
218 Ga0496102_0310383 3300048905 Bacteria 1486
219 Ga0496104_0007177 3300048907 Bacteria 9823
220 Ga0496104_0041727 3300048907 Bacteria 4303
221 Ga0496104_0248857 3300048907 Bacteria 1690
222 Ga0496105_0000337 3300048908 Bacteria 30737
223 Ga0496105_0003110 3300048908 Bacteria 12208
224 Ga0496106_0062056 3300048909 Bacteria 2837
225 Ga0496107_0012576 3300048910 Bacteria 5910
226 Ga0496107_0311888 3300048910 Bacteria 1171
227 Ga0496108_0000956 3300048911 Bacteria 22460
228 Ga0496108_0179314 3300048911 Bacteria 1834
229 Ga0496109_0017149 3300048912 Bacteria 6340
230 Ga0496110_0000303 3300048913 Bacteria 32473
231 Ga0496110_0414858 3300048913 Bacteria 1227
232 Ga0496111_0000263 3300048914 Bacteria 25540
233 Ga0496111_0023797 3300048914 Bacteria 4303
234 Ga0496112_0000994 3300048915 Bacteria 20745
235 Ga0496112_0003126 3300048915 Bacteria 13582
236 Ga0496112_0108421 3300048915 Bacteria 2747
237 Ga0496112_0155302 3300048915 Bacteria 2255
238 Ga0496113_0000692 3300048916 Bacteria 17211
239 Ga0496113_0080655 3300048916 Bacteria 2493
240 Ga0496113_0130881 3300048916 Bacteria 1969
241 Ga0496113_0306166 3300048916 Bacteria 1273
242 Ga0496113_0423836 3300048916 Bacteria 1069
243 Ga0496114_0093066 3300048917 Bacteria 2562
244 Ga0496114_0624436 3300048917 Bacteria 949
245 Ga0501069_0073964 3300049585 Bacteria 1911
246 Ga0501073_0376247 3300049589 Bacteria 981
247 Ga0501080_0246159 3300049742 Bacteria 1631
248 nmdc:mga05p37_359028_c1 3300050507 Bacteria 1713
249 nmdc:mga0n895_10669_c1 3300050512 Bacteria 8136
250 nmdc:mga0a205_17705_c1 3300050515 Bacteria 6686
251 Ga0495619_0133964 3300053085 Bacteria 1704
252 Ga0495619_0183304 3300053085 Bacteria 1448
253 Ga0495619_0387142 3300053085 Bacteria 966
254 Ga0466962_0054082 3300061719 Bacteria 1919
255 Ga0466962_0135296 3300061719 Bacteria 1192
256 Ga0466962_0205038 3300061719 Bacteria 964
257 Ga0070679_100215084
258 Ga0065707_10083210
259 Ga0070658_10008141
260 Ga0070658_10118464
261 Ga0070658_10473386
262 Ga0070683_100094891
263 Ga0070680_100050722
264 Ga0070682_100079071
265 Ga0070661_100219225
266 Ga0070668_100162918
267 Ga0070659_100258156
268 Ga0070667_100011136
269 Ga0070714_100015126
270 Ga0070714_100021299
271 Ga0070714_100032935
272 Ga0070714_100169679
273 Ga0070713_100377294
274 Ga0070711_100474890
275 Ga0070705_100009831
276 Ga0070700_100060168
277 Ga0070708_100780168
278 Ga0070681_10030499
279 Ga0070681_10039310
280 Ga0070681_10093072
281 Ga0070706_100056578
282 Ga0070707_100204477
283 Ga0070698_100006139
284 Ga0070698_100043428
285 Ga0070698_100049500
286 Ga0070699_100020010
287 Ga0070679_100047175
288 Ga0070679_100233244
289 Ga0070679_100240556
290 Ga0070684_100239856
291 Ga0070696_100238708
292 Ga0070704_100109418
293 Ga0068855_100017572
294 Ga0068855_100166380
295 Ga0068855_100222541
296 Ga0068859_100018322
297 Ga0068864_100099924
298 Ga0068861_100039229
299 Ga0068862_100012040
300 Ga0068862_100157806
301 Ga0081539_10001069
302 Ga0070717_10021998
303 Ga0070712_100162631
304 Ga0075434_100047835
305 Ga0068865_100291994
306 Ga0097620_100018323
307 Ga0105240_10108289
308 Ga0105240_10154580
309 Ga0105240_10428591
310 Ga0105240_10438255
311 Ga0105245_10092239
312 Ga0114129_10622276
313 Ga0105249_10005917
314 Ga0157373_10099050
315 Ga0157373_10107895
316 Ga0157370_10021663
317 Ga0157370_10330910
318 Ga0157369_10001471
319 Ga0157369_10065392
320 Ga0157369_10066827
321 Ga0157374_10451405
322 Ga0157378_10263269
323 Ga0163162_10014206
324 Ga0157372_10529351
325 Ga0163163_10060245
326 Ga0157380_10578036
327 Ga0182008_10002948
328 Ga0182007_10021965
329 Ga0207653_10025133
330 Ga0207699_10028873
331 Ga0207705_10054030
332 Ga0207705_10081447
333 Ga0207705_10095044
334 Ga0207707_10014284
335 Ga0207707_10334518
336 Ga0207695_10071250
337 Ga0207693_10148170
338 Ga0207660_10004756
339 Ga0207660_10171542
340 Ga0207660_10560666
341 Ga0207657_10003381
342 Ga0207657_10016205
343 Ga0207657_10156497
344 Ga0207649_10288144
345 Ga0207652_10036277
346 Ga0207652_10083449
347 Ga0207652_10251990
348 Ga0207652_10403337
349 Ga0207646_10031587
350 Ga0207646_10326565
351 Ga0207700_10107310
352 Ga0207700_10377977
353 Ga0207664_10002147
354 Ga0207664_10078994
355 Ga0207664_10095255
356 Ga0207664_10139780
357 Ga0207664_10174303
358 Ga0207706_10041824
359 Ga0207670_10211817
360 Ga0207661_10065756
361 Ga0207661_10369130
362 Ga0207667_10034779
363 Ga0207667_10214301
364 Ga0207667_10427101
365 Ga0207712_10045390
366 Ga0207658_10029856
367 Ga0207677_10033877
368 Ga0207639_10189794
369 Ga0207702_10552346
370 Ga0207675_100001286
371 Ga0268265_10630106
372 Ga0268264_10271317
373 Ga0265319_1020717
374 Ga0265319_1033792
375 Ga0265334_10007291
376 Ga0265318_10002296
377 Ga0265323_10059999
378 Ga0265322_10029306
379 Ga0265336_10064731
380 Ga0265336_10073649
381 Ga0265338_10003206
382 Ga0265338_10011260
383 Ga0265338_10059073
384 Ga0265338_10067651
385 Ga0265338_10070011
386 Ga0265338_10094837
387 Ga0265330_10026385
388 Ga0265332_10036465
389 Ga0265328_10003863
390 Ga0265320_10131991
391 Ga0265325_10063335
392 Ga0265340_10105665
393 Ga0265339_10031781
394 Ga0265339_10054721
395 Ga0265331_10011571
396 Ga0265327_10023700
397 Ga0265327_10034211
398 Ga0265316_10228879
399 Ga0265316_10290179
400 Ga0307408_100115164
401 Ga0265313_10073551
402 Ga0265314_10145435
403 Ga0307407_10004123
404 Ga0307412_10014443
405 Ga0307416_100120865
406 Ga0316583_10024000
407 Ga0373956_0126108
408 Ga0373946_0016659
409 Ga0395899_0015421
410 Ga0395899_0016139
411 Ga0395899_0071358
412 Ga0395900_0019026
413 Ga0395900_0029718
414 Ga0395900_0036584
415 Ga0395900_0056337
416 Ga0395900_0710561
417 Ga0395898_0003141
418 Ga0395898_0013529
419 Ga0395898_0030860
420 Ga0395898_0138779
421 Ga0395898_0220008
422 Ga0395905_0004701
423 Ga0395905_0007393
424 Ga0395901_0005810
425 Ga0395901_0023156
426 Ga0395901_0048569
427 Ga0395901_0096066
428 Ga0395901_0367731
429 Ga0395901_0539097
430 Ga0451577_0062924
431 Ga0466969_0140797
432 Ga0466972_0067133
433 Ga0466963_0006098
434 Ga0466963_0025351
435 Ga0466964_0253494
436 Ga0453684_0570656
437 Ga0466971_0036790
438 Ga0466959_0096948
439 Ga0451576_0273619
440 Ga0466958_0021999
441 Ga0466958_0088990
442 Ga0466967_0002073
443 Ga0466967_0005113
444 Ga0466967_0067194
445 Ga0466967_0134269
446 Ga0466967_0252468
447 Ga0466967_0257867
448 Ga0466967_0258415
449 Ga0495653_0063132
450 Ga0495653_0147926
451 Ga0495582_0013466
452 Ga0495662_0081234
453 Ga0495584_0125246
454 Ga0495594_0051729
455 Ga0495616_0099306
456 Ga0495598_0022471
457 Ga0495609_0049342
458 Ga0495667_0068679
459 Ga0495667_0212316
460 Ga0495656_0191639
461 Ga0495611_0086540
462 Ga0495635_0136229
463 Ga0495599_0214639
464 Ga0495599_0231249
465 Ga0495658_0037532
466 Ga0495613_0512939
467 Ga0495624_0042458
468 Ga0495600_0184187
469 Ga0495581_0004910
470 Ga0495604_0168422
471 Ga0495680_0023044
472 Ga0495680_0102232
473 Ga0496100_0034863
474 Ga0496102_0310383
475 Ga0496104_0007177
476 Ga0496104_0041727
477 Ga0496104_0248857
478 Ga0496105_0000337
479 Ga0496105_0003110
480 Ga0496106_0062056
481 Ga0496107_0012576
482 Ga0496107_0311888
483 Ga0496108_0000956
484 Ga0496108_0179314
485 Ga0496109_0017149
486 Ga0496110_0000303
487 Ga0496110_0414858
488 Ga0496111_0000263
489 Ga0496111_0023797
490 Ga0496112_0000994
491 Ga0496112_0003126
492 Ga0496112_0108421
493 Ga0496112_0155302
494 Ga0496113_0000692
495 Ga0496113_0080655
496 Ga0496113_0130881
497 Ga0496113_0306166
498 Ga0496113_0423836
499 Ga0496114_0093066
500 Ga0496114_0624436
501 Ga0501069_0073964
502 Ga0501073_0376247
503 Ga0501080_0246159
504 nmdc:mga05p37_359028_c1
505 nmdc:mga0n895_10669_c1
506 nmdc:mga0a205_17705_c1
507 Ga0495619_0133964
508 Ga0495619_0183304
509 Ga0495619_0387142
510 Ga0466962_0054082
511 Ga0466962_0135296
512 Ga0466962_0205038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

31

271

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7473 1 260
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7299 1 260
8e0n-assembly1.cif.gz_A homotrimeric variant of tctrp9, bgl18 0.4348 94 260
3eom-assembly1.cif.gz_C 2.4 a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei 0.4237 120 262
3gqt-assembly1.cif.gz_A crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methylamine 0.4134 120 260
ID Description Score Start End Superfamily
af_K7KZ37_99_207_1.20.58.810 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Photosystem II Pbs27 0.6403 197 265 1.20.58.810
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4767 184 258 1.10.287.3510
af_F1QUY4_98_236_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4479 103 254 1.10.10.1740
3eomC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4462 125 262 1.20.140.10
3d6bA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4422 125 259 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A3D2UM16-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9514 12 258 GO:0005886
GO:0008961
GO:0042158
AF-A0A6L4A2D4-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.946 112 258 GO:0005886
GO:0008961
GO:0042158
AF-A0A1G2BTF6-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9422 118 255 GO:0005886
GO:0008961
GO:0042158
AF-A0A4P5UXX8-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9359 3 259 GO:0005886
GO:0008961
GO:0042158
AF-A0A838JT16-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.931 134 261 GO:0005886
GO:0008961
GO:0042158

Map